4V3QA

Designed armadillo repeat protein with 4 internal repeats, 2nd generation c-cap and 3rd generation n-cap.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
247
structure length
247
Chain Sequence
HHHHHHGSELPQMVQQLNSPDQQELQSALRKLSQIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YIII_M4_AII
publication title Structures of designed armadillo-repeat proteins show propagation of inter-repeat interface effects.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 109
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 4v3qA00
2NYLB 4K92A 4D49A 1JDHA 4FQ3A 4CRVB 4FZFA 4XZRB 4U54A 3RZXA 3ND2A 4DB9A 5BZUA 1EJLI 1QBKB 4WV6A 5D5KC 4YGXA 2P8QA 3WPTA 5AEIA 3BSXA 4H3KA 5KL8A 1F59A 2XA7A 4R10A 4V3OA 2IAEA 2Z6GA 3IBVA 4EVPA 4FZAA 2PKGA 3OUWA 1M8WA 4I5LA 4MFUA 3C2HA 3BCTA 3EA5B 3ZIRA 2XA7B 1O6PA 1BK5A 3LWWA 3ODRA 3L6XA 3FEXC 3GVOA 4U3JC 3Q0SA 4DZSA 4P6ZB 2X1GF 2BAPA 3GRLA 3C2GA 4BA3A 1WA5C 2OT8A 1Q1SC 3O2TA 2QK1A 2JAKA 3H3DX 1Y2AC 4IMIA 3BWTA 4PLRA 2PF4A 4U5OA 2Z5NA 4PLQA 4B8JA 4MZ6E 1UN0A 3TT9A 1M8ZA 3K5YA 3L3QA 4CT7B 2NPPA 1EE4A 2QK2A 3K5QA 5E6QB 5HHGE 3Q0PA 2JKRA 2Z5OA 1U6GC 4BPLA 1XM9A 3L6YA 4OO6A 4P6ZG 4LACA 3K64A 1IALA 4R0ZA 3NMWA 1JPPA 2NYMA 3QG9A 4HXTA 4UWXA 4DBAA 1UPKA 2VGLA 3QMLC 2NPPB 5BZVA 4JW2B 3OUXA 1M1EA 2QMRA 2JKRB 1IQ1C 3T7UA 4U5UA 3UL0B 3V74A 4I2WA 4CB8A 3BX2A 1PJNB 2BCTA 5B56A 5JJAA 1B3UA 5BYMA 2C1MA 4HNMA 2YNRA 3OPBA 2VGLB 4CB9A 3V6YA 3ZKVA 3Q0MA 3UKXB 4KZGA 3GS3A 2IX3A 5SW9A 4UAFB 4FFBC 5EWPA 3PSTA 3VWAA 2QNAA 3ZHPA 3UKWB 3L3FX 5K9SA 3K5ZA 4GMOA 1O6OA 2IW3A 2F31A 3TJZB 4DB8A 3TPOA 4UQIA 1PJMB 3TPMA 3UVUA 4CT6B 3QHEA 1Z2CB 4CV5B 2IAEB 3DW8A 4MFVA 1TH1A 1M5NS 2H4MA 4O27A 3UKYB 2GL7A 4MZ5E 3Q0LA 1IB2A 2YJYA 2Z6HA 4BQKA 2Q5DA 4HTVA 1UKLA 3KNDA 1W63A 5J3VA 4EVTA 1G3JA 1W9CA 2IE4A 4RXHB 4ZDUA 3NMZA 4B18A 3K49A 1XQSA 3O2SA 5DN7A 5H2XA 2JDQA 3ZIQA 3K4EA 4V3QA 3WOZA 1IBRB 3Q5UA 4YI0C 3WOYA 3UKZB 5FC8E 5SVZA 3W3UA 4E4VA 4JLQA 1OYZA 4DJSA 1QGRA 3V71A 5KLAA 3O4XA 1Q1TC 1T08A 3K61A 3OBVA 5K6SA 3NMXA 4PLSA 3ZINA 3WYFC 3BSBA 3GQ2A 4U5LA 4B8PA 4TNMA 4U5VA 3IFQA 4L7MA 4V3RA 5HUWC 1M8XA 3UL1B 4B8OA 3AU3A 4FDDA 4HM9A 4QMJA 1XQRA 4YJLA 2YNSA 4UADA 4Y5JA 2NYMB 3O2QA 1I7XA 5KLRB 4CBAA 4DB6A 4YK6A 4FZDA 5BZ5A 4K6JA 4U58A 1HO8A 1QGKA 5KLTB 5HUYC 3ZIOA 1LRVA 2W3CA 3NOWA 4OIHA 3EBBA 4ADYA 5SWFA 3FGAA 4RZPA 4DVGB 2BKUB 3VE6A 3Q0RA 4G3AA 4U5SA 5CTTA 3LTJA 4I5NA 4NEEA 1UPLA 4I2ZA 3BTRC 5KL1A 1V18A 2WTKA 3TX7A 3RZ9A 2BNXA 2FV2A 4EVAA 2C1TA 4A0CA 4YJEA 1EE5A 3QGCA 4UQIB 4CRUB 3FGAB 3TJ3A 1BK6A 3Q0OA 5EKGA 4NZWA 1JPWA 4GMNA 3BX3A 2JKTA 2Z5JA 4UAEA 4QMIA 5EKFA 3GNIA 3K62A 3DADA 5LSWA 4D4EA 4R11A 3K7WA 1I7WA 2X19B 3C5WA 3FEYC 3QGBA 3GB8A 4H3HA 2RU4A 3GAEA 2Z5MA 3A6PA 1W63B 4QMHA 3EG5B 2NYLA 4RV1A 5H2WA 4EV9A 2IWHA 4EV8A 3K7VA 2JKTB 5BZ1A 1WA5B 1EJYI 4PVZA 2Z5KA 2OF3A 3PSPA 1GCJA 2DB0A 4U5NA 2IE3A 3ZIPA 3OQSA 1LUJA 2RU4B 3ODSA 3GVTA 1M8YA 4IMJA 3Q0QA 1QZ7A 3Q0NA 3LTMA
chains in the Genus database with same CATH superfamily
2NYLB 4K92A 4D49A 1JDHA 4FQ3A 4CRVB 4FZFA 4XZRB 4U54A 3RZXA 3ND2A 4DB9A 5BZUA 1EJLI 1QBKB 4WV6A 5D5KC 4YGXA 2P8QA 3WPTA 5AEIA 3BSXA 4H3KA 5KL8A 3BVSA 1F59A 2XA7A 4R10A 4V3OA 2IAEA 2Z6GA 3IBVA 4L4IA 4EVPA 4FZAA 2PKGA 3OUWA 1M8WA 4I5LA 4MFUA 1TE4A 5CLBA 3C2HA 3BCTA 3EA5B 3SL9A 3ZIRA 5CL8A 2XA7B 1O6PA 1BK5A 3LWWA 3ODRA 3L6XA 3FEXC 3GVOA 4U3JC 3Q0SA 4DZSA 4P6ZB 2X1GF 2BAPA 3GRLA 3C2GA 4BA3A 1WA5C 2OT8A 3VLEA 5CLAA 5CL9A 1Q1SC 3O2TA 4U2XD 2QK1A 2JAKA 3H3DX 1Y2AC 4IMIA 3BWTA 4PLRA 2PF4A 4U5OA 2Z5NA 4PLQA 5CLEA 4B8JA 4MZ6E 5CL7A 1UN0A 3TT9A 1M8ZA 3K5YA 3L3QA 4CT7B 2NPPA 4FP7A 1EE4A 2QK2A 3K5QA 4JW2A 5E6QB 5CL4A 5HHGE 3Q0PA 2JKRA 2Z5OA 5CL6A 1U6GC 4BPLA 1XM9A 3L6YA 4I96A 4OO6A 4P6ZG 4LACA 3K64A 4A3VA 1IALA 4R0ZA 3NMWA 1JPPA 2NYMA 3QG9A 4HXTA 4UWXA 4DBAA 1UPKA 2VGLA 3QMLC 2NPPB 5BZVA 4JW2B 3OUXA 1M1EA 2QMRA 2JKRB 2XOAA 1IQ1C 3T7UA 4U5UA 3UL0B 3V74A 4I2WA 4CB8A 3JXYA 3BX2A 4I37A 1PJNB 2BCTA 5B56A 5JJAA 1B3UA 5BYMA 2C1MA 4HNMA 2YNRA 3OPBA 2VGLB 4CB9A 3V6YA 3ZKVA 3Q0MA 3UKXB 4KZGA 3GS3A 2IX3A 5SW9A 4UAFB 4FFBC 5EWPA 3PSTA 3VWAA 4JW3C 2QNAA 3ZHPA 3UKWB 3L3FX 5K9SA 3K5ZA 4GMOA 1O6OA 2IW3A 5CLCA 1N4KA 2F31A 3TJZB 4DB8A 3TPOA 4UQIA 1PJMB 3TPMA 3UVUA 4CT6B 4I1EA 3QHEA 1Z2CB 4CV5B 2IAEB 3DW8A 4MFVA 1TH1A 1M5NS 2H4MA 4O27A 3UKYB 2GL7A 4MZ5E 3Q0LA 1IB2A 2YJYA 1LSHA 2Z6HA 2Q5DA 4BQKA 4HTVA 1UKLA 4I0YA 3ZIKA 3KNDA 1W63A 4I6IA 5J3VA 4EVTA 1G3JA 5CL3A 1W9CA 2IE4A 4RXHB 4ZDUA 3NMZA 4B18A 3K49A 4JKQA 1XQSA 3O2SA 5DN7A 5H2XA 2JDQA 3ZIQA 3K4EA 4V3QA 3WOZA 1IBRB 3Q5UA 4YI0C 3WOYA 3UKZB 5FC8E 5SVZA 3W3UA 4E4VA 4JLQA 1OYZA 4DJSA 1QGRA 3V71A 5KLAA 3O4XA 1Q1TC 3SLAA 1T08A 3K61A 3OBVA 5K6SA 3NMXA 4PLSA 3ZINA 3WYFC 3BSBA 3GQ2A 4U5LA 4B8PA 4TNMA 4U5VA 3IFQA 4L7MA 4V3RA 5HUWC 1M8XA 3UJ4A 3UL1B 4B8OA 5KUBA 3AU3A 4FDDA 4I8MA 4HM9A 4QMJA 3JY1A 1XQRA 4YJLA 3VLDA 2YNSA 4UADA 4Y5JA 2NYMB 3O2QA 1I7XA 5KLRB 4CBAA 4DB6A 4YK6A 4FZDA 4A3TA 5BZ5A 4K6JA 4U58A 1HO8A 1QGKA 5KLTB 5HUYC 3ZIOA 4L4HA 1LRVA 2W3CA 3NOWA 4OIHA 3EBBA 4ADYA 5SWFA 3ZILA 3FGAA 3UJ0A 4RZPA 4DVGB 2BKUB 3VE6A 3Q0RA 4G3AA 4U5SA 3JXZA 5CTTA 3LTJA 4I5NA 4NEEA 1UPLA 4I2ZA 3BTRC 5KL1A 1V18A 2WTKA 3TX7A 3RZ9A 2BNXA 2FV2A 4EVAA 2C1TA 4A0CA 4YJEA 1EE5A 3QGCA 4UQIB 4CRUB 3FGAB 3TJ3A 1BK6A 3Q0OA 5EKGA 4NZWA 1JPWA 4GMNA 3BX3A 2JKTA 2Z5JA 4UAEA 4QMIA 5EKFA 3GNIA 3K62A 3DADA 5LSWA 4D4EA 4R11A 3T8SA 3K7WA 1I7WA 4I2SA 5CLDA 2X19B 3C5WA 3FEYC 3QGBA 3GB8A 4H3HA 2RU4A 3GAEA 2Z5MA 3A6PA 1W63B 4QMHA 3EG5B 3JX7A 2NYLA 4RV1A 5H2WA 4EV9A 2IWHA 4EV8A 3K7VA 2JKTB 5BZ1A 1WA5B 4I3NA 1EJYI 4PVZA 2Z5KA 2OF3A 3PSPA 1GCJA 2DB0A 4U5NA 2IE3A 3VLFA 3ZIPA 3OQSA 1LUJA 2RU4B 3ODSA 3GVTA 5CL5A 1M8YA 4IMJA 3Q0QA 4I7IA 1QZ7A 3Q0NA 3LTMA
chains in the Genus database with same CATH topology
2NYLB 4K92A 4D49A 1JDHA 4FQ3A 4CRVB 4FZFA 4XZRB 4U54A 3RZXA 3ND2A 4DB9A 5BZUA 1EJLI 1QBKB 4WV6A 5D5KC 4YGXA 2P8QA 3WPTA 5AEIA 3BSXA 4H3KA 5KL8A 3BVSA 1F59A 2XA7A 4R10A 4V3OA 2IAEA 2Z6GA 3IBVA 4L4IA 4EVPA 4FZAA 2PKGA 3OUWA 1M8WA 4I5LA 4MFUA 1TE4A 5CLBA 3C2HA 3BCTA 3EA5B 3SL9A 3ZIRA 5CL8A 2XA7B 1O6PA 1BK5A 3LWWA 3ODRA 3L6XA 3FEXC 3GVOA 4U3JC 3Q0SA 4DZSA 4P6ZB 2X1GF 2BAPA 3GRLA 3C2GA 4BA3A 1WA5C 2OT8A 3VLEA 5CLAA 5CL9A 1Q1SC 3O2TA 4U2XD 2QK1A 2JAKA 3H3DX 1Y2AC 4IMIA 3BWTA 4PLRA 2PF4A 4U5OA 2Z5NA 4PLQA 5CLEA 4B8JA 4MZ6E 5CL7A 1UN0A 3TT9A 1M8ZA 3K5YA 3L3QA 4CT7B 2NPPA 4FP7A 1EE4A 2QK2A 3K5QA 4JW2A 5E6QB 5CL4A 5HHGE 3Q0PA 2JKRA 2Z5OA 5CL6A 1U6GC 4BPLA 1XM9A 3L6YA 4I96A 4OO6A 4P6ZG 4LACA 3K64A 4A3VA 1IALA 4R0ZA 3NMWA 1JPPA 2NYMA 3QG9A 4HXTA 4UWXA 4DBAA 1UPKA 2VGLA 3QMLC 2NPPB 5BZVA 4JW2B 3OUXA 1M1EA 2QMRA 2JKRB 2XOAA 1IQ1C 3T7UA 4U5UA 3UL0B 3V74A 4I2WA 4CB8A 3JXYA 3BX2A 4I37A 1PJNB 2BCTA 5B56A 5JJAA 1B3UA 5BYMA 2C1MA 4HNMA 2YNRA 3OPBA 2VGLB 4CB9A 3V6YA 3ZKVA 3Q0MA 3UKXB 4KZGA 3GS3A 2IX3A 5SW9A 4UAFB 4FFBC 5EWPA 3PSTA 3VWAA 4JW3C 2QNAA 3ZHPA 3UKWB 3L3FX 5K9SA 3K5ZA 4GMOA 1O6OA 2IW3A 5CLCA 2F31A 3TJZB 4DB8A 3TPOA 4UQIA 1PJMB 3TPMA 3UVUA 4CT6B 4I1EA 3QHEA 1Z2CB 4CV5B 2IAEB 3DW8A 4MFVA 1TH1A 1M5NS 2H4MA 4O27A 3UKYB 2GL7A 4MZ5E 3Q0LA 1IB2A 2YJYA 2Z6HA 2Q5DA 4BQKA 4HTVA 1UKLA 4I0YA 3ZIKA 3KNDA 1W63A 4I6IA 5J3VA 4EVTA 1G3JA 5CL3A 1W9CA 2IE4A 4RXHB 4ZDUA 3NMZA 4B18A 3K49A 4JKQA 1XQSA 3O2SA 5DN7A 5H2XA 2JDQA 3ZIQA 3K4EA 4V3QA 3WOZA 1IBRB 3Q5UA 4YI0C 3WOYA 3UKZB 5FC8E 5SVZA 3W3UA 4E4VA 4JLQA 1OYZA 4DJSA 1QGRA 3V71A 5KLAA 3O4XA 1Q1TC 3SLAA 1T08A 3K61A 3OBVA 5K6SA 3NMXA 4PLSA 3ZINA 3WYFC 3BSBA 3GQ2A 4U5LA 4B8PA 4TNMA 4U5VA 3IFQA 4L7MA 4V3RA 5HUWC 1M8XA 3UL1B 4B8OA 5KUBA 3AU3A 4FDDA 4I8MA 4HM9A 4QMJA 3JY1A 1XQRA 4YJLA 3VLDA 2YNSA 4UADA 4Y5JA 2NYMB 3O2QA 1I7XA 5KLRB 4CBAA 4DB6A 4YK6A 4FZDA 4A3TA 5BZ5A 4K6JA 4U58A 1HO8A 1QGKA 5KLTB 5HUYC 3ZIOA 4L4HA 1LRVA 2W3CA 3NOWA 4OIHA 3EBBA 4ADYA 5SWFA 3ZILA 3FGAA 4RZPA 4DVGB 2BKUB 3VE6A 3Q0RA 4G3AA 4U5SA 3JXZA 5CTTA 3LTJA 4I5NA 4NEEA 1UPLA 4I2ZA 3BTRC 5KL1A 1V18A 2WTKA 3TX7A 3RZ9A 2BNXA 2FV2A 4EVAA 2C1TA 4A0CA 4YJEA 1EE5A 3QGCA 4UQIB 4CRUB 3FGAB 3TJ3A 1BK6A 3Q0OA 5EKGA 4NZWA 1JPWA 4GMNA 3BX3A 2JKTA 2Z5JA 4UAEA 4QMIA 5EKFA 3GNIA 3K62A 3DADA 5LSWA 4D4EA 4R11A 3K7WA 1I7WA 4I2SA 5CLDA 2X19B 3C5WA 3FEYC 3QGBA 3GB8A 4H3HA 2RU4A 3GAEA 2Z5MA 3A6PA 1W63B 4QMHA 3EG5B 3JX7A 2NYLA 4RV1A 5H2WA 4EV9A 2IWHA 4EV8A 3K7VA 2JKTB 5BZ1A 1WA5B 4I3NA 1EJYI 4PVZA 2Z5KA 2OF3A 3PSPA 1GCJA 2DB0A 4U5NA 2IE3A 3VLFA 3ZIPA 3OQSA 1LUJA 2RU4B 3ODSA 3GVTA 5CL5A 1M8YA 4IMJA 3Q0QA 4I7IA 1QZ7A 3Q0NA 3LTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYL B;  4K92 A;  4D49 A;  1JDH A;  4FQ3 A;  4CRV B;  4FZF A;  4XZR B;  4U54 A;  3RZX A;  3ND2 A;  4DB9 A;  5BZU A;  1EJL I;  1QBK B;  4WV6 A;  5D5K C;  4YGX A;  2P8Q A;  3WPT A;  5AEI A;  3BSX A;  4H3K A;  5KL8 A;  1F59 A;  2XA7 A;  4R10 A;  4V3O A;  2IAE A;  2Z6G A;  3IBV A;  4EVP A;  4FZA A;  2PKG A;  3OUW A;  1M8W A;  4I5L A;  4MFU A;  3C2H A;  3BCT A;  3EA5 B;  3ZIR A;  2XA7 B;  1O6P A;  1BK5 A;  3LWW A;  3ODR A;  3L6X A;  3FEX C;  3GVO A;  4U3J C;  3Q0S A;  4DZS A;  4P6Z B;  2X1G F;  2BAP A;  3GRL A;  3C2G A;  4BA3 A;  1WA5 C;  2OT8 A;  1Q1S C;  3O2T A;  2QK1 A;  2JAK A;  3H3D X;  1Y2A C;  4IMI A;  3BWT A;  4PLR A;  2PF4 A;  4U5O A;  2Z5N A;  4PLQ A;  4B8J A;  4MZ6 E;  1UN0 A;  3TT9 A;  1M8Z A;  3K5Y A;  3L3Q A;  4CT7 B;  2NPP A;  1EE4 A;  2QK2 A;  3K5Q A;  5E6Q B;  5HHG E;  3Q0P A;  2JKR A;  2Z5O A;  1U6G C;  4BPL A;  1XM9 A;  3L6Y A;  4OO6 A;  4P6Z G;  4LAC A;  3K64 A;  1IAL A;  4R0Z A;  3NMW A;  1JPP A;  2NYM A;  3QG9 A;  4HXT A;  4UWX A;  4DBA A;  1UPK A;  2VGL A;  3QML C;  2NPP B;  5BZV A;  4JW2 B;  3OUX A;  1M1E A;  2QMR A;  2JKR B;  1IQ1 C;  3T7U A;  4U5U A;  3UL0 B;  3V74 A;  4I2W A;  4CB8 A;  3BX2 A;  1PJN B;  2BCT A;  5B56 A;  5JJA A;  1B3U A;  5BYM A;  2C1M A;  4HNM A;  2YNR A;  3OPB A;  2VGL B;  4CB9 A;  3V6Y A;  3ZKV A;  3Q0M A;  3UKX B;  4KZG A;  3GS3 A;  2IX3 A;  5SW9 A;  4UAF B;  4FFB C;  5EWP A;  3PST A;  3VWA A;  2QNA A;  3ZHP A;  3UKW B;  3L3F X;  5K9S A;  3K5Z A;  4GMO A;  1O6O A;  2IW3 A;  2F31 A;  3TJZ B;  4DB8 A;  3TPO A;  4UQI A;  1PJM B;  3TPM A;  3UVU A;  4CT6 B;  3QHE A;  1Z2C B;  4CV5 B;  2IAE B;  3DW8 A;  4MFV A;  1TH1 A;  1M5N S;  2H4M A;  4O27 A;  3UKY B;  2GL7 A;  4MZ5 E;  3Q0L A;  1IB2 A;  2YJY A;  2Z6H A;  4BQK A;  2Q5D A;  4HTV A;  1UKL A;  3KND A;  1W63 A;  5J3V A;  4EVT A;  1G3J A;  1W9C A;  2IE4 A;  4RXH B;  4ZDU A;  3NMZ A;  4B18 A;  3K49 A;  1XQS A;  3O2S A;  5DN7 A;  5H2X A;  2JDQ A;  3ZIQ A;  3K4E A;  4V3Q A;  3WOZ A;  1IBR B;  3Q5U A;  4YI0 C;  3WOY A;  3UKZ B;  5FC8 E;  5SVZ A;  3W3U A;  4E4V A;  4JLQ A;  1OYZ A;  4DJS A;  1QGR A;  3V71 A;  5KLA A;  3O4X A;  1Q1T C;  1T08 A;  3K61 A;  3OBV A;  5K6S A;  3NMX A;  4PLS A;  3ZIN A;  3WYF C;  3BSB A;  3GQ2 A;  4U5L A;  4B8P A;  4TNM A;  4U5V A;  3IFQ A;  4L7M A;  4V3R A;  5HUW C;  1M8X A;  3UL1 B;  4B8O A;  3AU3 A;  4FDD A;  4HM9 A;  4QMJ A;  1XQR A;  4YJL A;  2YNS A;  4UAD A;  4Y5J A;  2NYM B;  3O2Q A;  1I7X A;  5KLR B;  4CBA A;  4DB6 A;  4YK6 A;  4FZD A;  5BZ5 A;  4K6J A;  4U58 A;  1HO8 A;  1QGK A;  5KLT B;  5HUY C;  3ZIO A;  1LRV A;  2W3C A;  3NOW A;  4OIH A;  3EBB A;  4ADY A;  5SWF A;  3FGA A;  4RZP A;  4DVG B;  2BKU B;  3VE6 A;  3Q0R A;  4G3A A;  4U5S A;  5CTT A;  3LTJ A;  4I5N A;  4NEE A;  1UPL A;  4I2Z A;  3BTR C;  5KL1 A;  1V18 A;  2WTK A;  3TX7 A;  3RZ9 A;  2BNX A;  2FV2 A;  4EVA A;  2C1T A;  4A0C A;  4YJE A;  1EE5 A;  3QGC A;  4UQI B;  4CRU B;  3FGA B;  3TJ3 A;  1BK6 A;  3Q0O A;  5EKG A;  4NZW A;  1JPW A;  4GMN A;  3BX3 A;  2JKT A;  2Z5J A;  4UAE A;  4QMI A;  5EKF A;  3GNI A;  3K62 A;  3DAD A;  5LSW A;  4D4E A;  4R11 A;  3K7W A;  1I7W A;  2X19 B;  3C5W A;  3FEY C;  3QGB A;  3GB8 A;  4H3H A;  2RU4 A;  3GAE A;  2Z5M A;  3A6P A;  1W63 B;  4QMH A;  3EG5 B;  2NYL A;  4RV1 A;  5H2W A;  4EV9 A;  2IWH A;  4EV8 A;  3K7V A;  2JKT B;  5BZ1 A;  1WA5 B;  1EJY I;  4PVZ A;  2Z5K A;  2OF3 A;  3PSP A;  1GCJ A;  2DB0 A;  4U5N A;  2IE3 A;  3ZIP A;  3OQS A;  1LUJ A;  2RU4 B;  3ODS A;  3GVT A;  1M8Y A;  4IMJ A;  3Q0Q A;  1QZ7 A;  3Q0N A;  3LTM A; 
#chains in the Genus database with same CATH topology
 2NYL B;  4K92 A;  4D49 A;  1JDH A;  4FQ3 A;  4CRV B;  4FZF A;  4XZR B;  4U54 A;  3RZX A;  3ND2 A;  4DB9 A;  5BZU A;  1EJL I;  1QBK B;  4WV6 A;  5D5K C;  4YGX A;  2P8Q A;  3WPT A;  5AEI A;  3BSX A;  4H3K A;  5KL8 A;  3BVS A;  1F59 A;  2XA7 A;  4R10 A;  4V3O A;  2IAE A;  2Z6G A;  3IBV A;  4L4I A;  4EVP A;  4FZA A;  2PKG A;  3OUW A;  1M8W A;  4I5L A;  4MFU A;  1TE4 A;  5CLB A;  3C2H A;  3BCT A;  3EA5 B;  3SL9 A;  3ZIR A;  5CL8 A;  2XA7 B;  1O6P A;  1BK5 A;  3LWW A;  3ODR A;  3L6X A;  3FEX C;  3GVO A;  4U3J C;  3Q0S A;  4DZS A;  4P6Z B;  2X1G F;  2BAP A;  3GRL A;  3C2G A;  4BA3 A;  1WA5 C;  2OT8 A;  3VLE A;  5CLA A;  5CL9 A;  1Q1S C;  3O2T A;  4U2X D;  2QK1 A;  2JAK A;  3H3D X;  1Y2A C;  4IMI A;  3BWT A;  4PLR A;  2PF4 A;  4U5O A;  2Z5N A;  4PLQ A;  5CLE A;  4B8J A;  4MZ6 E;  5CL7 A;  1UN0 A;  3TT9 A;  1M8Z A;  3K5Y A;  3L3Q A;  4CT7 B;  2NPP A;  4FP7 A;  1EE4 A;  2QK2 A;  3K5Q A;  4JW2 A;  5E6Q B;  5CL4 A;  5HHG E;  3Q0P A;  2JKR A;  2Z5O A;  5CL6 A;  1U6G C;  4BPL A;  1XM9 A;  3L6Y A;  4I96 A;  4OO6 A;  4P6Z G;  4LAC A;  3K64 A;  4A3V A;  1IAL A;  4R0Z A;  3NMW A;  1JPP A;  2NYM A;  3QG9 A;  4HXT A;  4UWX A;  4DBA A;  1UPK A;  2VGL A;  3QML C;  2NPP B;  5BZV A;  4JW2 B;  3OUX A;  1M1E A;  2QMR A;  2JKR B;  2XOA A;  1IQ1 C;  3T7U A;  4U5U A;  3UL0 B;  3V74 A;  4I2W A;  4CB8 A;  3JXY A;  3BX2 A;  4I37 A;  1PJN B;  2BCT A;  5B56 A;  5JJA A;  1B3U A;  5BYM A;  2C1M A;  4HNM A;  2YNR A;  3OPB A;  2VGL B;  4CB9 A;  3V6Y A;  3ZKV A;  3Q0M A;  3UKX B;  4KZG A;  3GS3 A;  2IX3 A;  5SW9 A;  4UAF B;  4FFB C;  5EWP A;  3PST A;  3VWA A;  4JW3 C;  2QNA A;  3ZHP A;  3UKW B;  3L3F X;  5K9S A;  3K5Z A;  4GMO A;  1O6O A;  2IW3 A;  5CLC A;  1N4K A;  2F31 A;  3TJZ B;  4DB8 A;  3TPO A;  4UQI A;  1PJM B;  3TPM A;  3UVU A;  4CT6 B;  4I1E A;  3QHE A;  1Z2C B;  4CV5 B;  2IAE B;  3DW8 A;  4MFV A;  1TH1 A;  1M5N S;  2H4M A;  4O27 A;  3UKY B;  2GL7 A;  4MZ5 E;  3Q0L A;  1IB2 A;  2YJY A;  1LSH A;  2Z6H A;  2Q5D A;  4BQK A;  4HTV A;  1UKL A;  4I0Y A;  3ZIK A;  3KND A;  1W63 A;  4I6I A;  5J3V A;  4EVT A;  1G3J A;  5CL3 A;  1W9C A;  2IE4 A;  4RXH B;  4ZDU A;  3NMZ A;  4B18 A;  3K49 A;  4JKQ A;  1XQS A;  3O2S A;  5DN7 A;  5H2X A;  2JDQ A;  3ZIQ A;  3K4E A;  4V3Q A;  3WOZ A;  1IBR B;  3Q5U A;  4YI0 C;  3WOY A;  3UKZ B;  5FC8 E;  5SVZ A;  3W3U A;  4E4V A;  4JLQ A;  1OYZ A;  4DJS A;  1QGR A;  3V71 A;  5KLA A;  3O4X A;  1Q1T C;  3SLA A;  1T08 A;  3K61 A;  3OBV A;  5K6S A;  3NMX A;  4PLS A;  3ZIN A;  3WYF C;  3BSB A;  3GQ2 A;  4U5L A;  4B8P A;  4TNM A;  4U5V A;  3IFQ A;  4L7M A;  4V3R A;  5HUW C;  1M8X A;  3UJ4 A;  3UL1 B;  4B8O A;  5KUB A;  3AU3 A;  4FDD A;  4I8M A;  4HM9 A;  4QMJ A;  3JY1 A;  1XQR A;  4YJL A;  3VLD A;  2YNS A;  4UAD A;  4Y5J A;  2NYM B;  3O2Q A;  1I7X A;  5KLR B;  4CBA A;  4DB6 A;  4YK6 A;  4FZD A;  4A3T A;  5BZ5 A;  4K6J A;  4U58 A;  1HO8 A;  1QGK A;  5KLT B;  5HUY C;  3ZIO A;  4L4H A;  1LRV A;  2W3C A;  3NOW A;  4OIH A;  3EBB A;  4ADY A;  5SWF A;  3ZIL A;  3FGA A;  3UJ0 A;  4RZP A;  4DVG B;  2BKU B;  3VE6 A;  3Q0R A;  4G3A A;  4U5S A;  3JXZ A;  5CTT A;  3LTJ A;  4I5N A;  4NEE A;  1UPL A;  4I2Z A;  3BTR C;  5KL1 A;  1V18 A;  2WTK A;  3TX7 A;  3RZ9 A;  2BNX A;  2FV2 A;  4EVA A;  2C1T A;  4A0C A;  4YJE A;  1EE5 A;  3QGC A;  4UQI B;  4CRU B;  3FGA B;  3TJ3 A;  1BK6 A;  3Q0O A;  5EKG A;  4NZW A;  1JPW A;  4GMN A;  3BX3 A;  2JKT A;  2Z5J A;  4UAE A;  4QMI A;  5EKF A;  3GNI A;  3K62 A;  3DAD A;  5LSW A;  4D4E A;  4R11 A;  3T8S A;  3K7W A;  1I7W A;  4I2S A;  5CLD A;  2X19 B;  3C5W A;  3FEY C;  3QGB A;  3GB8 A;  4H3H A;  2RU4 A;  3GAE A;  2Z5M A;  3A6P A;  1W63 B;  4QMH A;  3EG5 B;  3JX7 A;  2NYL A;  4RV1 A;  5H2W A;  4EV9 A;  2IWH A;  4EV8 A;  3K7V A;  2JKT B;  5BZ1 A;  1WA5 B;  4I3N A;  1EJY I;  4PVZ A;  2Z5K A;  2OF3 A;  3PSP A;  1GCJ A;  2DB0 A;  4U5N A;  2IE3 A;  3VLF A;  3ZIP A;  3OQS A;  1LUJ A;  2RU4 B;  3ODS A;  3GVT A;  5CL5 A;  1M8Y A;  4IMJ A;  3Q0Q A;  4I7I A;  1QZ7 A;  3Q0N A;  3LTM A; 
#chains in the Genus database with same CATH homology
 2NYL B;  4K92 A;  4D49 A;  1JDH A;  4FQ3 A;  4CRV B;  4FZF A;  4XZR B;  4U54 A;  3RZX A;  3ND2 A;  4DB9 A;  5BZU A;  1EJL I;  1QBK B;  4WV6 A;  5D5K C;  4YGX A;  2P8Q A;  3WPT A;  5AEI A;  3BSX A;  4H3K A;  5KL8 A;  3BVS A;  1F59 A;  2XA7 A;  4R10 A;  4V3O A;  2IAE A;  2Z6G A;  3IBV A;  4L4I A;  4EVP A;  4FZA A;  2PKG A;  3OUW A;  1M8W A;  4I5L A;  4MFU A;  1TE4 A;  5CLB A;  3C2H A;  3BCT A;  3EA5 B;  3SL9 A;  3ZIR A;  5CL8 A;  2XA7 B;  1O6P A;  1BK5 A;  3LWW A;  3ODR A;  3L6X A;  3FEX C;  3GVO A;  4U3J C;  3Q0S A;  4DZS A;  4P6Z B;  2X1G F;  2BAP A;  3GRL A;  3C2G A;  4BA3 A;  1WA5 C;  2OT8 A;  3VLE A;  5CLA A;  5CL9 A;  1Q1S C;  3O2T A;  4U2X D;  2QK1 A;  2JAK A;  3H3D X;  1Y2A C;  4IMI A;  3BWT A;  4PLR A;  2PF4 A;  4U5O A;  2Z5N A;  4PLQ A;  5CLE A;  4B8J A;  4MZ6 E;  5CL7 A;  1UN0 A;  3TT9 A;  1M8Z A;  3K5Y A;  3L3Q A;  4CT7 B;  2NPP A;  4FP7 A;  1EE4 A;  2QK2 A;  3K5Q A;  4JW2 A;  5E6Q B;  5CL4 A;  5HHG E;  3Q0P A;  2JKR A;  2Z5O A;  5CL6 A;  1U6G C;  4BPL A;  1XM9 A;  3L6Y A;  4I96 A;  4OO6 A;  4P6Z G;  4LAC A;  3K64 A;  4A3V A;  1IAL A;  4R0Z A;  3NMW A;  1JPP A;  2NYM A;  3QG9 A;  4HXT A;  4UWX A;  4DBA A;  1UPK A;  2VGL A;  3QML C;  2NPP B;  5BZV A;  4JW2 B;  3OUX A;  1M1E A;  2QMR A;  2JKR B;  2XOA A;  1IQ1 C;  3T7U A;  4U5U A;  3UL0 B;  3V74 A;  4I2W A;  4CB8 A;  3JXY A;  3BX2 A;  4I37 A;  1PJN B;  2BCT A;  5B56 A;  5JJA A;  1B3U A;  5BYM A;  2C1M A;  4HNM A;  2YNR A;  3OPB A;  2VGL B;  4CB9 A;  3V6Y A;  3ZKV A;  3Q0M A;  3UKX B;  4KZG A;  3GS3 A;  2IX3 A;  5SW9 A;  4UAF B;  4FFB C;  5EWP A;  3PST A;  3VWA A;  4JW3 C;  2QNA A;  3ZHP A;  3UKW B;  3L3F X;  5K9S A;  3K5Z A;  4GMO A;  1O6O A;  2IW3 A;  5CLC A;  2F31 A;  3TJZ B;  4DB8 A;  3TPO A;  4UQI A;  1PJM B;  3TPM A;  3UVU A;  4CT6 B;  4I1E A;  3QHE A;  1Z2C B;  4CV5 B;  2IAE B;  3DW8 A;  4MFV A;  1TH1 A;  1M5N S;  2H4M A;  4O27 A;  3UKY B;  2GL7 A;  4MZ5 E;  3Q0L A;  1IB2 A;  2YJY A;  2Z6H A;  2Q5D A;  4BQK A;  4HTV A;  1UKL A;  4I0Y A;  3ZIK A;  3KND A;  1W63 A;  4I6I A;  5J3V A;  4EVT A;  1G3J A;  5CL3 A;  1W9C A;  2IE4 A;  4RXH B;  4ZDU A;  3NMZ A;  4B18 A;  3K49 A;  4JKQ A;  1XQS A;  3O2S A;  5DN7 A;  5H2X A;  2JDQ A;  3ZIQ A;  3K4E A;  4V3Q A;  3WOZ A;  1IBR B;  3Q5U A;  4YI0 C;  3WOY A;  3UKZ B;  5FC8 E;  5SVZ A;  3W3U A;  4E4V A;  4JLQ A;  1OYZ A;  4DJS A;  1QGR A;  3V71 A;  5KLA A;  3O4X A;  1Q1T C;  3SLA A;  1T08 A;  3K61 A;  3OBV A;  5K6S A;  3NMX A;  4PLS A;  3ZIN A;  3WYF C;  3BSB A;  3GQ2 A;  4U5L A;  4B8P A;  4TNM A;  4U5V A;  3IFQ A;  4L7M A;  4V3R A;  5HUW C;  1M8X A;  3UL1 B;  4B8O A;  5KUB A;  3AU3 A;  4FDD A;  4I8M A;  4HM9 A;  4QMJ A;  3JY1 A;  1XQR A;  4YJL A;  3VLD A;  2YNS A;  4UAD A;  4Y5J A;  2NYM B;  3O2Q A;  1I7X A;  5KLR B;  4CBA A;  4DB6 A;  4YK6 A;  4FZD A;  4A3T A;  5BZ5 A;  4K6J A;  4U58 A;  1HO8 A;  1QGK A;  5KLT B;  5HUY C;  3ZIO A;  4L4H A;  1LRV A;  2W3C A;  3NOW A;  4OIH A;  3EBB A;  4ADY A;  5SWF A;  3ZIL A;  3FGA A;  4RZP A;  4DVG B;  2BKU B;  3VE6 A;  3Q0R A;  4G3A A;  4U5S A;  3JXZ A;  5CTT A;  3LTJ A;  4I5N A;  4NEE A;  1UPL A;  4I2Z A;  3BTR C;  5KL1 A;  1V18 A;  2WTK A;  3TX7 A;  3RZ9 A;  2BNX A;  2FV2 A;  4EVA A;  2C1T A;  4A0C A;  4YJE A;  1EE5 A;  3QGC A;  4UQI B;  4CRU B;  3FGA B;  3TJ3 A;  1BK6 A;  3Q0O A;  5EKG A;  4NZW A;  1JPW A;  4GMN A;  3BX3 A;  2JKT A;  2Z5J A;  4UAE A;  4QMI A;  5EKF A;  3GNI A;  3K62 A;  3DAD A;  5LSW A;  4D4E A;  4R11 A;  3K7W A;  1I7W A;  4I2S A;  5CLD A;  2X19 B;  3C5W A;  3FEY C;  3QGB A;  3GB8 A;  4H3H A;  2RU4 A;  3GAE A;  2Z5M A;  3A6P A;  1W63 B;  4QMH A;  3EG5 B;  3JX7 A;  2NYL A;  4RV1 A;  5H2W A;  4EV9 A;  2IWH A;  4EV8 A;  3K7V A;  2JKT B;  5BZ1 A;  1WA5 B;  4I3N A;  1EJY I;  4PVZ A;  2Z5K A;  2OF3 A;  3PSP A;  1GCJ A;  2DB0 A;  4U5N A;  2IE3 A;  3VLF A;  3ZIP A;  3OQS A;  1LUJ A;  2RU4 B;  3ODS A;  3GVT A;  5CL5 A;  1M8Y A;  4IMJ A;  3Q0Q A;  4I7I A;  1QZ7 A;  3Q0N A;  3LTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...