4V3QA

Designed armadillo repeat protein with 4 internal repeats, 2nd generation c-cap and 3rd generation n-cap.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
247
structure length
247
Chain Sequence
HHHHHHGSELPQMVQQLNSPDQQELQSALRKLSQIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGDEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords YIII_M4_AII
publication title Structures of designed armadillo-repeat proteins show propagation of inter-repeat interface effects.
pubmed doi rcsb
source organism Synthetic construct
total genus 109
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 4v3qA00
2Z5KA 3V71A 5KLTB 4D49A 4CB8A 4ADYA 2XA7B 2XA7A 3DW8A 3C2GA 3GB8A 3GAEA 4PLRA 4JW2B 4YK6A 3KNDA 1IQ1C 1EE5A 4RV1A 2DB0A 3WOYA 2FV2A 3TX7A 2QNAA 2YJYA 3EG5B 4GMOA 4PLQA 4MFVA 3BX3A 2YNRA 2GL7A 3L3QA 5K9SA 2BAPA 2Z5OA 5KLAA 1EE4A 3QMLC 1XM9A 3ODSA 2WTKA 1QBKB 2X1GF 4CT7B 2BCTA 4U58A 3UKZB 1OYZA 1Q1TC 3BX2A 3K5ZA 5JJAA 3O2QA 3K7WA 3ODRA 3PSTA 4P6ZG 2OF3A 4PVZA 1O6OA 5DN7A 4B8JA 4FZAA 3NMXA 1M8WA 3IBVA 4DB9A 4DVGB 4U5NA 3LTMA 1UN0A 2IAEA 1WA5B 1PJMB 1UPLA 1Q1SC 2F31A 1EJLI 2IX3A 3ZKVA 3K5YA 4LACA 5BZUA 5HUWC 4CV5B 4YI0C 3NMZA 3BCTA 4MFUA 4V3OA 1QGRA 1I7XA 3TJZB 5AEIA 3TT9A 3BSXA 4RZPA 1JPWA 4QMHA 4R0ZA 3V6YA 2NYMA 3EBBA 3WYFC 4I2ZA 1IB2A 4I2WA 3Q0MA 2YNSA 4OO6A 4YJEA 4HNMA 3ZINA 5BZ1A 4FDDA 4B18A 3UL1B 3UKWB 1JDHA 2QK1A 2P8QA 4YGXA 1XQSA 4WV6A 3K5QA 2QMRA 3AU3A 5SVZA 4FFBC 3Q0RA 1F59A 5EKFA 2PKGA 3UVUA 3RZ9A 1M1EA 1LRVA 3OBVA 2C1TA 4UAFB 3EA5B 4CRUB 4HM9A 4YJLA 5KLRB 3C5WA 3Q0PA 3ZIRA 2Z5JA 3FEXC 4BPLA 2H4MA 5FC8E 4V3RA 3V74A 4U3JC 4NEEA 3WOZA 1JPPA 4R11A 3W3UA 5K6SA 1W9CA 2IE4A 4DBAA 4DB8A 3QGBA 3OUWA 1GCJA 3Q0NA 4MZ6E 4QMIA 4FZFA 3GS3A 2Q5DA 4DB6A 5CTTA 4FZDA 3L3FX 3PSPA 1WA5C 1QZ7A 3Q0LA 5D5KC 1B3UA 3K64A 3K7VA 3H3DX 3TPOA 4FQ3A 2OT8A 4H3KA 2X19B 4OIHA 2JKRB 2JKRA 5KL8A 4DZSA 2IW3A 4I5LA 4U5UA 4U5LA 1BK6A 3ZHPA 5B56A 4B8OA 5J3VA 3K61A 2RU4B 2RU4A 4R10A 1TH1A 3WPTA 1G3JA 3O4XA 2NPPB 2NPPA 3ZIOA 2JDQA 4EVAA 4NZWA 3ZIQA 4HXTA 5BZVA 3GNIA 1IALA 3A6PA 5BZ5A 5H2XA 4CBAA 5HHGE 2W3CA 2JAKA 1UKLA 1W63B 1W63A 2IE3A 1M8XA 1I7WA 4B8PA 5EWPA 2QK2A 5EKGA 4P6ZB 2C1MA 3BSBA 3OPBA 3OUXA 4U5VA 3ZIPA 3VWAA 3QGCA 4U5SA 4DJSA 3FGAB 4TNMA 1BK5A 1IBRB 3Q5UA 3RZXA 1XQRA 5LSWA 3O2TA 4IMIA 4JLQA 3Q0SA 1Z2CB 4UADA 2VGLB 2VGLA 4QMJA 3OQSA 3BWTA 2PF4A 3O2SA 1LUJA 1HO8A 3GRLA 3LTJA 2Z6HA 3VE6A 1EJYI 3ND2A 3K49A 4Y5JA 3LWWA 4PLSA 4GMNA 3BTRC 2Z5MA 3FEYC 3TPMA 1T08A 2NYLB 2NYLA 4EVTA 4HTVA 3QG9A 3NMWA 4XZRB 4UAEA 4EV8A 4UQIB 4UQIA 4U54A 3UL0B 4CT6B 3DADA 3IFQA 4CB9A 4H3HA 1M8YA 1QGKA 3L6YA 1U6GC 3C2HA 3UKYB 4G3AA 5SWFA 2IAEB 1M8ZA 2Z6GA 2BKUB 2Z5NA 3Q0QA 2IWHA 4ZDUA 4BA3A 4I5NA 4RXHB 5SW9A 4MZ5E 2BNXA 4BQKA 1PJNB 3K62A 1O6PA 3GQ2A 3QHEA 4EV9A 3T7UA 4UWXA 3GVTA 4A0CA 3NOWA 4K92A 5HUYC 4O27A 3K4EA 2NYMB 4IMJA 5E6QB 1Y2AC 4D4EA 1UPKA 1V18A 4U5OA 4K6JA 4CRVB 1M5NS 4KZGA 3GVOA 2JKTB 2JKTA 3L6XA 4V3QA 3UKXB 4EVPA 4E4VA 3Q0OA 4L7MA 5KL1A 5H2WA 3FGAA 3TJ3A 5BYMA
chains in the Genus database with same CATH superfamily
4I6IA 2Z5KA 3V71A 4I7IA 5KLTB 5CL4A 4D49A 4CB8A 4ADYA 5CLCA 2XA7B 2XA7A 3DW8A 3C2GA 3GB8A 3GAEA 4PLRA 4I0YA 4JW2B 4YK6A 3KNDA 1IQ1C 1EE5A 4RV1A 2DB0A 3WOYA 2FV2A 3TX7A 2QNAA 2YJYA 1N4KA 3EG5B 4GMOA 4PLQA 4MFVA 3BX3A 2YNRA 2GL7A 3L3QA 5K9SA 2BAPA 2Z5OA 5CL7A 5KLAA 1EE4A 3QMLC 1XM9A 3ODSA 2WTKA 1QBKB 2X1GF 4CT7B 2BCTA 4U58A 3UKZB 1OYZA 1Q1TC 3BX2A 3K5ZA 5JJAA 3O2QA 3K7WA 3ODRA 3PSTA 4P6ZG 3VLEA 2OF3A 4PVZA 1O6OA 5DN7A 4B8JA 4FZAA 3NMXA 1M8WA 3IBVA 4DB9A 4DVGB 4U5NA 3LTMA 4L4HA 1UN0A 2IAEA 1WA5B 1PJMB 1UPLA 1Q1SC 5CL5A 2F31A 1EJLI 2IX3A 3ZKVA 3K5YA 4LACA 5BZUA 5HUWC 4CV5B 4YI0C 3NMZA 3BCTA 5CLDA 4MFUA 4V3OA 1QGRA 1I7XA 4A3TA 3TJZB 5AEIA 3TT9A 4I3NA 4RZPA 3BSXA 1JPWA 4QMHA 4R0ZA 3V6YA 2NYMA 3EBBA 3WYFC 4I2ZA 1IB2A 4I2WA 3Q0MA 2YNSA 4OO6A 4YJEA 4HNMA 3ZINA 5BZ1A 4FDDA 4B18A 3UL1B 3UKWB 1JDHA 2QK1A 2P8QA 4YGXA 1XQSA 4WV6A 3UJ0A 3VLFA 3K5QA 2QMRA 3JY1A 3AU3A 5SVZA 4FFBC 5CLEA 3Q0RA 1F59A 5EKFA 2PKGA 3JX7A 3UVUA 3RZ9A 4JW2A 3VLDA 1M1EA 3SLAA 1LRVA 3OBVA 2C1TA 4UAFB 3EA5B 4CRUB 4HM9A 4YJLA 4L4IA 5KLRB 3C5WA 3Q0PA 3ZIRA 2Z5JA 3FEXC 5CL8A 4BPLA 2H4MA 5FC8E 4V3RA 3V74A 4U3JC 4NEEA 3WOZA 1JPPA 4R11A 3W3UA 5K6SA 1W9CA 2IE4A 4DBAA 4DB8A 3QGBA 3BVSA 3OUWA 1GCJA 3Q0NA 4MZ6E 4QMIA 4FZFA 3GS3A 2Q5DA 4DB6A 5CTTA 4FZDA 3L3FX 3PSPA 1WA5C 5CLBA 1QZ7A 3Q0LA 5D5KC 1B3UA 4FP7A 3K64A 3K7VA 3H3DX 3TPOA 4I1EA 4FQ3A 2OT8A 4H3KA 2X19B 4OIHA 2JKRB 2JKRA 4I37A 1LSHA 5KL8A 4DZSA 2IW3A 4I5LA 4U5UA 4U5LA 1BK6A 3ZHPA 5B56A 4B8OA 5J3VA 3K61A 2RU4B 2RU4A 3ZIKA 4R10A 1TH1A 3WPTA 1G3JA 3O4XA 3T8SA 2NPPB 2NPPA 3ZIOA 2JDQA 4EVAA 4NZWA 4I8MA 3ZIQA 4HXTA 5BZVA 3GNIA 1IALA 3A6PA 5BZ5A 5H2XA 4CBAA 5HHGE 2W3CA 2JAKA 1UKLA 1W63B 1W63A 2IE3A 1M8XA 1I7WA 4B8PA 5EWPA 2XOAA 2QK2A 5EKGA 4P6ZB 2C1MA 5KUBA 4JKQA 3BSBA 3OPBA 3OUXA 4U5VA 3JXYA 3ZIPA 3VWAA 3QGCA 4U5SA 4DJSA 5CLAA 3FGAB 4TNMA 1BK5A 1IBRB 3Q5UA 4I96A 3RZXA 1XQRA 5LSWA 3O2TA 4IMIA 4JLQA 3Q0SA 1Z2CB 4UADA 2VGLB 2VGLA 4QMJA 3OQSA 3BWTA 2PF4A 3O2SA 1LUJA 1HO8A 3GRLA 3LTJA 1TE4A 2Z6HA 3VE6A 5CL6A 1EJYI 3ND2A 3K49A 4Y5JA 3LWWA 4PLSA 4GMNA 3BTRC 3UJ4A 2Z5MA 3FEYC 3TPMA 1T08A 2NYLB 2NYLA 4EVTA 4HTVA 3QG9A 3NMWA 4XZRB 4UAEA 4EV8A 3JXZA 5CL9A 4UQIB 4UQIA 4U54A 3UL0B 4CT6B 3DADA 4JW3C 3IFQA 4CB9A 3ZILA 4H3HA 1M8YA 1QGKA 3L6YA 1U6GC 3C2HA 3UKYB 4G3AA 3SL9A 5SWFA 2IAEB 1M8ZA 2Z6GA 2BKUB 2Z5NA 3Q0QA 2IWHA 4ZDUA 4BA3A 4I5NA 4RXHB 5CL3A 5SW9A 4MZ5E 2BNXA 4BQKA 1PJNB 3K62A 1O6PA 3GQ2A 3QHEA 4EV9A 3T7UA 4UWXA 3GVTA 4A0CA 3NOWA 4K92A 5HUYC 4O27A 3K4EA 4I2SA 2NYMB 4IMJA 5E6QB 1Y2AC 4D4EA 1UPKA 1V18A 4U5OA 4K6JA 4CRVB 1M5NS 4KZGA 3GVOA 2JKTB 2JKTA 3L6XA 4V3QA 3UKXB 4EVPA 4E4VA 3Q0OA 4L7MA 5KL1A 5H2WA 3FGAA 4U2XD 3TJ3A 5BYMA 4A3VA
chains in the Genus database with same CATH topology
4I6IA 2Z5KA 3V71A 4I7IA 5KLTB 5CL4A 4D49A 4CB8A 4ADYA 5CLCA 2XA7B 2XA7A 3DW8A 3C2GA 3GB8A 3GAEA 4PLRA 4I0YA 4JW2B 4YK6A 3KNDA 1IQ1C 1EE5A 4RV1A 2DB0A 3WOYA 2FV2A 3TX7A 2QNAA 2YJYA 3EG5B 4GMOA 4PLQA 4MFVA 3BX3A 2YNRA 2GL7A 3L3QA 5K9SA 2BAPA 2Z5OA 5CL7A 5KLAA 1EE4A 3QMLC 1XM9A 3ODSA 2WTKA 1QBKB 2X1GF 4CT7B 2BCTA 4U58A 3UKZB 1OYZA 1Q1TC 3BX2A 3K5ZA 5JJAA 3O2QA 3K7WA 3ODRA 3PSTA 4P6ZG 3VLEA 2OF3A 4PVZA 1O6OA 5DN7A 4B8JA 4FZAA 3NMXA 1M8WA 3IBVA 4DB9A 4DVGB 4U5NA 3LTMA 4L4HA 1UN0A 2IAEA 1WA5B 1PJMB 1UPLA 1Q1SC 5CL5A 2F31A 1EJLI 2IX3A 3ZKVA 3K5YA 4LACA 5BZUA 5HUWC 4CV5B 4YI0C 3NMZA 3BCTA 5CLDA 4MFUA 4V3OA 1QGRA 1I7XA 4A3TA 3TJZB 5AEIA 3TT9A 4I3NA 4RZPA 3BSXA 1JPWA 4QMHA 4R0ZA 3V6YA 2NYMA 3EBBA 3WYFC 4I2ZA 1IB2A 4I2WA 3Q0MA 2YNSA 4OO6A 4YJEA 4HNMA 3ZINA 5BZ1A 4FDDA 4B18A 3UL1B 3UKWB 1JDHA 2QK1A 2P8QA 4YGXA 1XQSA 4WV6A 3VLFA 3K5QA 2QMRA 3JY1A 3AU3A 5SVZA 4FFBC 5CLEA 3Q0RA 1F59A 5EKFA 2PKGA 3JX7A 3UVUA 3RZ9A 4JW2A 3VLDA 1M1EA 3SLAA 1LRVA 3OBVA 2C1TA 4UAFB 3EA5B 4CRUB 4HM9A 4YJLA 4L4IA 5KLRB 3C5WA 3Q0PA 3ZIRA 2Z5JA 3FEXC 5CL8A 4BPLA 2H4MA 5FC8E 4V3RA 3V74A 4U3JC 4NEEA 3WOZA 1JPPA 4R11A 3W3UA 5K6SA 1W9CA 2IE4A 4DBAA 4DB8A 3QGBA 3BVSA 3OUWA 1GCJA 3Q0NA 4MZ6E 4QMIA 4FZFA 3GS3A 2Q5DA 4DB6A 5CTTA 4FZDA 3L3FX 3PSPA 1WA5C 5CLBA 1QZ7A 3Q0LA 5D5KC 1B3UA 4FP7A 3K64A 3K7VA 3H3DX 3TPOA 4I1EA 4FQ3A 2OT8A 4H3KA 2X19B 4OIHA 2JKRB 2JKRA 4I37A 5KL8A 4DZSA 2IW3A 4I5LA 4U5UA 4U5LA 1BK6A 3ZHPA 5B56A 4B8OA 5J3VA 3K61A 2RU4B 2RU4A 3ZIKA 4R10A 1TH1A 3WPTA 1G3JA 3O4XA 2NPPB 2NPPA 3ZIOA 2JDQA 4EVAA 4NZWA 4I8MA 3ZIQA 4HXTA 5BZVA 3GNIA 1IALA 3A6PA 5BZ5A 5H2XA 4CBAA 5HHGE 2W3CA 2JAKA 1UKLA 1W63B 1W63A 2IE3A 1M8XA 1I7WA 4B8PA 5EWPA 2XOAA 2QK2A 5EKGA 4P6ZB 2C1MA 5KUBA 4JKQA 3BSBA 3OPBA 3OUXA 4U5VA 3JXYA 3ZIPA 3VWAA 3QGCA 4U5SA 4DJSA 5CLAA 3FGAB 4TNMA 1BK5A 1IBRB 3Q5UA 4I96A 3RZXA 1XQRA 5LSWA 3O2TA 4IMIA 4JLQA 3Q0SA 1Z2CB 4UADA 2VGLB 2VGLA 4QMJA 3OQSA 3BWTA 2PF4A 3O2SA 1LUJA 1HO8A 3GRLA 3LTJA 1TE4A 2Z6HA 3VE6A 5CL6A 1EJYI 3ND2A 3K49A 4Y5JA 3LWWA 4PLSA 4GMNA 3BTRC 2Z5MA 3FEYC 3TPMA 1T08A 2NYLB 2NYLA 4EVTA 4HTVA 3QG9A 3NMWA 4XZRB 4UAEA 4EV8A 3JXZA 5CL9A 4UQIB 4UQIA 4U54A 3UL0B 4CT6B 3DADA 4JW3C 3IFQA 4CB9A 3ZILA 4H3HA 1M8YA 1QGKA 3L6YA 1U6GC 3C2HA 3UKYB 4G3AA 3SL9A 5SWFA 2IAEB 1M8ZA 2Z6GA 2BKUB 2Z5NA 3Q0QA 2IWHA 4ZDUA 4BA3A 4I5NA 4RXHB 5CL3A 5SW9A 4MZ5E 2BNXA 4BQKA 1PJNB 3K62A 1O6PA 3GQ2A 3QHEA 4EV9A 3T7UA 4UWXA 3GVTA 4A0CA 3NOWA 4K92A 5HUYC 4O27A 3K4EA 4I2SA 2NYMB 4IMJA 5E6QB 1Y2AC 4D4EA 1UPKA 1V18A 4U5OA 4K6JA 4CRVB 1M5NS 4KZGA 3GVOA 2JKTB 2JKTA 3L6XA 4V3QA 3UKXB 4EVPA 4E4VA 3Q0OA 4L7MA 5KL1A 5H2WA 3FGAA 4U2XD 3TJ3A 5BYMA 4A3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5K A;  3V71 A;  5KLT B;  4D49 A;  4CB8 A;  4ADY A;  2XA7 B;  2XA7 A;  3DW8 A;  3C2G A;  3GB8 A;  3GAE A;  4PLR A;  4JW2 B;  4YK6 A;  3KND A;  1IQ1 C;  1EE5 A;  4RV1 A;  2DB0 A;  3WOY A;  2FV2 A;  3TX7 A;  2QNA A;  2YJY A;  3EG5 B;  4GMO A;  4PLQ A;  4MFV A;  3BX3 A;  2YNR A;  2GL7 A;  3L3Q A;  5K9S A;  2BAP A;  2Z5O A;  5KLA A;  1EE4 A;  3QML C;  1XM9 A;  3ODS A;  2WTK A;  1QBK B;  2X1G F;  4CT7 B;  2BCT A;  4U58 A;  3UKZ B;  1OYZ A;  1Q1T C;  3BX2 A;  3K5Z A;  5JJA A;  3O2Q A;  3K7W A;  3ODR A;  3PST A;  4P6Z G;  2OF3 A;  4PVZ A;  1O6O A;  5DN7 A;  4B8J A;  4FZA A;  3NMX A;  1M8W A;  3IBV A;  4DB9 A;  4DVG B;  4U5N A;  3LTM A;  1UN0 A;  2IAE A;  1WA5 B;  1PJM B;  1UPL A;  1Q1S C;  2F31 A;  1EJL I;  2IX3 A;  3ZKV A;  3K5Y A;  4LAC A;  5BZU A;  5HUW C;  4CV5 B;  4YI0 C;  3NMZ A;  3BCT A;  4MFU A;  4V3O A;  1QGR A;  1I7X A;  3TJZ B;  5AEI A;  3TT9 A;  3BSX A;  4RZP A;  1JPW A;  4QMH A;  4R0Z A;  3V6Y A;  2NYM A;  3EBB A;  3WYF C;  4I2Z A;  1IB2 A;  4I2W A;  3Q0M A;  2YNS A;  4OO6 A;  4YJE A;  4HNM A;  3ZIN A;  5BZ1 A;  4FDD A;  4B18 A;  3UL1 B;  3UKW B;  1JDH A;  2QK1 A;  2P8Q A;  4YGX A;  1XQS A;  4WV6 A;  3K5Q A;  2QMR A;  3AU3 A;  5SVZ A;  4FFB C;  3Q0R A;  1F59 A;  5EKF A;  2PKG A;  3UVU A;  3RZ9 A;  1M1E A;  1LRV A;  3OBV A;  2C1T A;  4UAF B;  3EA5 B;  4CRU B;  4HM9 A;  4YJL A;  5KLR B;  3C5W A;  3Q0P A;  3ZIR A;  2Z5J A;  3FEX C;  4BPL A;  2H4M A;  5FC8 E;  4V3R A;  3V74 A;  4U3J C;  4NEE A;  3WOZ A;  1JPP A;  4R11 A;  3W3U A;  5K6S A;  1W9C A;  2IE4 A;  4DBA A;  4DB8 A;  3QGB A;  3OUW A;  1GCJ A;  3Q0N A;  4MZ6 E;  4QMI A;  4FZF A;  3GS3 A;  2Q5D A;  4DB6 A;  5CTT A;  4FZD A;  3L3F X;  3PSP A;  1WA5 C;  1QZ7 A;  3Q0L A;  5D5K C;  1B3U A;  3K64 A;  3K7V A;  3H3D X;  3TPO A;  4FQ3 A;  2OT8 A;  4H3K A;  2X19 B;  4OIH A;  2JKR B;  2JKR A;  5KL8 A;  4DZS A;  2IW3 A;  4I5L A;  4U5U A;  4U5L A;  1BK6 A;  3ZHP A;  5B56 A;  4B8O A;  5J3V A;  3K61 A;  2RU4 B;  2RU4 A;  4R10 A;  1TH1 A;  3WPT A;  1G3J A;  3O4X A;  2NPP B;  2NPP A;  3ZIO A;  2JDQ A;  4EVA A;  4NZW A;  3ZIQ A;  4HXT A;  5BZV A;  3GNI A;  1IAL A;  3A6P A;  5BZ5 A;  5H2X A;  4CBA A;  5HHG E;  2W3C A;  2JAK A;  1UKL A;  1W63 B;  1W63 A;  2IE3 A;  1M8X A;  1I7W A;  4B8P A;  5EWP A;  2QK2 A;  5EKG A;  4P6Z B;  2C1M A;  3BSB A;  3OPB A;  3OUX A;  4U5V A;  3ZIP A;  3VWA A;  3QGC A;  4U5S A;  4DJS A;  3FGA B;  4TNM A;  1BK5 A;  1IBR B;  3Q5U A;  3RZX A;  1XQR A;  5LSW A;  3O2T A;  4IMI A;  4JLQ A;  3Q0S A;  1Z2C B;  4UAD A;  2VGL B;  2VGL A;  4QMJ A;  3OQS A;  3BWT A;  2PF4 A;  3O2S A;  1LUJ A;  1HO8 A;  3GRL A;  3LTJ A;  2Z6H A;  3VE6 A;  1EJY I;  3ND2 A;  3K49 A;  4Y5J A;  3LWW A;  4PLS A;  4GMN A;  3BTR C;  2Z5M A;  3FEY C;  3TPM A;  1T08 A;  2NYL B;  2NYL A;  4EVT A;  4HTV A;  3QG9 A;  3NMW A;  4XZR B;  4UAE A;  4EV8 A;  4UQI B;  4UQI A;  4U54 A;  3UL0 B;  4CT6 B;  3DAD A;  3IFQ A;  4CB9 A;  4H3H A;  1M8Y A;  1QGK A;  3L6Y A;  1U6G C;  3C2H A;  3UKY B;  4G3A A;  5SWF A;  2IAE B;  1M8Z A;  2Z6G A;  2BKU B;  2Z5N A;  3Q0Q A;  2IWH A;  4ZDU A;  4BA3 A;  4I5N A;  4RXH B;  5SW9 A;  4MZ5 E;  2BNX A;  4BQK A;  1PJN B;  3K62 A;  1O6P A;  3GQ2 A;  3QHE A;  4EV9 A;  3T7U A;  4UWX A;  3GVT A;  4A0C A;  3NOW A;  4K92 A;  5HUY C;  4O27 A;  3K4E A;  2NYM B;  4IMJ A;  5E6Q B;  1Y2A C;  4D4E A;  1UPK A;  1V18 A;  4U5O A;  4K6J A;  4CRV B;  1M5N S;  4KZG A;  3GVO A;  2JKT B;  2JKT A;  3L6X A;  4V3Q A;  3UKX B;  4EVP A;  4E4V A;  3Q0O A;  4L7M A;  5KL1 A;  5H2W A;  3FGA A;  3TJ3 A;  5BYM A; 
#chains in the Genus database with same CATH topology
 4I6I A;  2Z5K A;  3V71 A;  4I7I A;  5KLT B;  5CL4 A;  4D49 A;  4CB8 A;  4ADY A;  5CLC A;  2XA7 B;  2XA7 A;  3DW8 A;  3C2G A;  3GB8 A;  3GAE A;  4PLR A;  4I0Y A;  4JW2 B;  4YK6 A;  3KND A;  1IQ1 C;  1EE5 A;  4RV1 A;  2DB0 A;  3WOY A;  2FV2 A;  3TX7 A;  2QNA A;  2YJY A;  1N4K A;  3EG5 B;  4GMO A;  4PLQ A;  4MFV A;  3BX3 A;  2YNR A;  2GL7 A;  3L3Q A;  5K9S A;  2BAP A;  2Z5O A;  5CL7 A;  5KLA A;  1EE4 A;  3QML C;  1XM9 A;  3ODS A;  2WTK A;  1QBK B;  2X1G F;  4CT7 B;  2BCT A;  4U58 A;  3UKZ B;  1OYZ A;  1Q1T C;  3BX2 A;  3K5Z A;  5JJA A;  3O2Q A;  3K7W A;  3ODR A;  3PST A;  4P6Z G;  3VLE A;  2OF3 A;  4PVZ A;  1O6O A;  5DN7 A;  4B8J A;  4FZA A;  3NMX A;  1M8W A;  3IBV A;  4DB9 A;  4DVG B;  4U5N A;  3LTM A;  4L4H A;  1UN0 A;  2IAE A;  1WA5 B;  1PJM B;  1UPL A;  1Q1S C;  5CL5 A;  2F31 A;  1EJL I;  2IX3 A;  3ZKV A;  3K5Y A;  4LAC A;  5BZU A;  5HUW C;  4CV5 B;  4YI0 C;  3NMZ A;  3BCT A;  5CLD A;  4MFU A;  4V3O A;  1QGR A;  1I7X A;  4A3T A;  3TJZ B;  5AEI A;  3TT9 A;  4I3N A;  4RZP A;  3BSX A;  1JPW A;  4QMH A;  4R0Z A;  3V6Y A;  2NYM A;  3EBB A;  3WYF C;  4I2Z A;  1IB2 A;  4I2W A;  3Q0M A;  2YNS A;  4OO6 A;  4YJE A;  4HNM A;  3ZIN A;  5BZ1 A;  4FDD A;  4B18 A;  3UL1 B;  3UKW B;  1JDH A;  2QK1 A;  2P8Q A;  4YGX A;  1XQS A;  4WV6 A;  3UJ0 A;  3VLF A;  3K5Q A;  2QMR A;  3JY1 A;  3AU3 A;  5SVZ A;  4FFB C;  5CLE A;  3Q0R A;  1F59 A;  5EKF A;  2PKG A;  3JX7 A;  3UVU A;  3RZ9 A;  4JW2 A;  3VLD A;  1M1E A;  3SLA A;  1LRV A;  3OBV A;  2C1T A;  4UAF B;  3EA5 B;  4CRU B;  4HM9 A;  4YJL A;  4L4I A;  5KLR B;  3C5W A;  3Q0P A;  3ZIR A;  2Z5J A;  3FEX C;  5CL8 A;  4BPL A;  2H4M A;  5FC8 E;  4V3R A;  3V74 A;  4U3J C;  4NEE A;  3WOZ A;  1JPP A;  4R11 A;  3W3U A;  5K6S A;  1W9C A;  2IE4 A;  4DBA A;  4DB8 A;  3QGB A;  3BVS A;  3OUW A;  1GCJ A;  3Q0N A;  4MZ6 E;  4QMI A;  4FZF A;  3GS3 A;  2Q5D A;  4DB6 A;  5CTT A;  4FZD A;  3L3F X;  3PSP A;  1WA5 C;  5CLB A;  1QZ7 A;  3Q0L A;  5D5K C;  1B3U A;  4FP7 A;  3K64 A;  3K7V A;  3H3D X;  3TPO A;  4I1E A;  4FQ3 A;  2OT8 A;  4H3K A;  2X19 B;  4OIH A;  2JKR B;  2JKR A;  4I37 A;  1LSH A;  5KL8 A;  4DZS A;  2IW3 A;  4I5L A;  4U5U A;  4U5L A;  1BK6 A;  3ZHP A;  5B56 A;  4B8O A;  5J3V A;  3K61 A;  2RU4 B;  2RU4 A;  3ZIK A;  4R10 A;  1TH1 A;  3WPT A;  1G3J A;  3O4X A;  3T8S A;  2NPP B;  2NPP A;  3ZIO A;  2JDQ A;  4EVA A;  4NZW A;  4I8M A;  3ZIQ A;  4HXT A;  5BZV A;  3GNI A;  1IAL A;  3A6P A;  5BZ5 A;  5H2X A;  4CBA A;  5HHG E;  2W3C A;  2JAK A;  1UKL A;  1W63 B;  1W63 A;  2IE3 A;  1M8X A;  1I7W A;  4B8P A;  5EWP A;  2XOA A;  2QK2 A;  5EKG A;  4P6Z B;  2C1M A;  5KUB A;  4JKQ A;  3BSB A;  3OPB A;  3OUX A;  4U5V A;  3JXY A;  3ZIP A;  3VWA A;  3QGC A;  4U5S A;  4DJS A;  5CLA A;  3FGA B;  4TNM A;  1BK5 A;  1IBR B;  3Q5U A;  4I96 A;  3RZX A;  1XQR A;  5LSW A;  3O2T A;  4IMI A;  4JLQ A;  3Q0S A;  1Z2C B;  4UAD A;  2VGL B;  2VGL A;  4QMJ A;  3OQS A;  3BWT A;  2PF4 A;  3O2S A;  1LUJ A;  1HO8 A;  3GRL A;  3LTJ A;  1TE4 A;  2Z6H A;  3VE6 A;  5CL6 A;  1EJY I;  3ND2 A;  3K49 A;  4Y5J A;  3LWW A;  4PLS A;  4GMN A;  3BTR C;  3UJ4 A;  2Z5M A;  3FEY C;  3TPM A;  1T08 A;  2NYL B;  2NYL A;  4EVT A;  4HTV A;  3QG9 A;  3NMW A;  4XZR B;  4UAE A;  4EV8 A;  3JXZ A;  5CL9 A;  4UQI B;  4UQI A;  4U54 A;  3UL0 B;  4CT6 B;  3DAD A;  4JW3 C;  3IFQ A;  4CB9 A;  3ZIL A;  4H3H A;  1M8Y A;  1QGK A;  3L6Y A;  1U6G C;  3C2H A;  3UKY B;  4G3A A;  3SL9 A;  5SWF A;  2IAE B;  1M8Z A;  2Z6G A;  2BKU B;  2Z5N A;  3Q0Q A;  2IWH A;  4ZDU A;  4BA3 A;  4I5N A;  4RXH B;  5CL3 A;  5SW9 A;  4MZ5 E;  2BNX A;  4BQK A;  1PJN B;  3K62 A;  1O6P A;  3GQ2 A;  3QHE A;  4EV9 A;  3T7U A;  4UWX A;  3GVT A;  4A0C A;  3NOW A;  4K92 A;  5HUY C;  4O27 A;  3K4E A;  4I2S A;  2NYM B;  4IMJ A;  5E6Q B;  1Y2A C;  4D4E A;  1UPK A;  1V18 A;  4U5O A;  4K6J A;  4CRV B;  1M5N S;  4KZG A;  3GVO A;  2JKT B;  2JKT A;  3L6X A;  4V3Q A;  3UKX B;  4EVP A;  4E4V A;  3Q0O A;  4L7M A;  5KL1 A;  5H2W A;  3FGA A;  4U2X D;  3TJ3 A;  5BYM A;  4A3V A; 
#chains in the Genus database with same CATH homology
 4I6I A;  2Z5K A;  3V71 A;  4I7I A;  5KLT B;  5CL4 A;  4D49 A;  4CB8 A;  4ADY A;  5CLC A;  2XA7 B;  2XA7 A;  3DW8 A;  3C2G A;  3GB8 A;  3GAE A;  4PLR A;  4I0Y A;  4JW2 B;  4YK6 A;  3KND A;  1IQ1 C;  1EE5 A;  4RV1 A;  2DB0 A;  3WOY A;  2FV2 A;  3TX7 A;  2QNA A;  2YJY A;  3EG5 B;  4GMO A;  4PLQ A;  4MFV A;  3BX3 A;  2YNR A;  2GL7 A;  3L3Q A;  5K9S A;  2BAP A;  2Z5O A;  5CL7 A;  5KLA A;  1EE4 A;  3QML C;  1XM9 A;  3ODS A;  2WTK A;  1QBK B;  2X1G F;  4CT7 B;  2BCT A;  4U58 A;  3UKZ B;  1OYZ A;  1Q1T C;  3BX2 A;  3K5Z A;  5JJA A;  3O2Q A;  3K7W A;  3ODR A;  3PST A;  4P6Z G;  3VLE A;  2OF3 A;  4PVZ A;  1O6O A;  5DN7 A;  4B8J A;  4FZA A;  3NMX A;  1M8W A;  3IBV A;  4DB9 A;  4DVG B;  4U5N A;  3LTM A;  4L4H A;  1UN0 A;  2IAE A;  1WA5 B;  1PJM B;  1UPL A;  1Q1S C;  5CL5 A;  2F31 A;  1EJL I;  2IX3 A;  3ZKV A;  3K5Y A;  4LAC A;  5BZU A;  5HUW C;  4CV5 B;  4YI0 C;  3NMZ A;  3BCT A;  5CLD A;  4MFU A;  4V3O A;  1QGR A;  1I7X A;  4A3T A;  3TJZ B;  5AEI A;  3TT9 A;  4I3N A;  4RZP A;  3BSX A;  1JPW A;  4QMH A;  4R0Z A;  3V6Y A;  2NYM A;  3EBB A;  3WYF C;  4I2Z A;  1IB2 A;  4I2W A;  3Q0M A;  2YNS A;  4OO6 A;  4YJE A;  4HNM A;  3ZIN A;  5BZ1 A;  4FDD A;  4B18 A;  3UL1 B;  3UKW B;  1JDH A;  2QK1 A;  2P8Q A;  4YGX A;  1XQS A;  4WV6 A;  3VLF A;  3K5Q A;  2QMR A;  3JY1 A;  3AU3 A;  5SVZ A;  4FFB C;  5CLE A;  3Q0R A;  1F59 A;  5EKF A;  2PKG A;  3JX7 A;  3UVU A;  3RZ9 A;  4JW2 A;  3VLD A;  1M1E A;  3SLA A;  1LRV A;  3OBV A;  2C1T A;  4UAF B;  3EA5 B;  4CRU B;  4HM9 A;  4YJL A;  4L4I A;  5KLR B;  3C5W A;  3Q0P A;  3ZIR A;  2Z5J A;  3FEX C;  5CL8 A;  4BPL A;  2H4M A;  5FC8 E;  4V3R A;  3V74 A;  4U3J C;  4NEE A;  3WOZ A;  1JPP A;  4R11 A;  3W3U A;  5K6S A;  1W9C A;  2IE4 A;  4DBA A;  4DB8 A;  3QGB A;  3BVS A;  3OUW A;  1GCJ A;  3Q0N A;  4MZ6 E;  4QMI A;  4FZF A;  3GS3 A;  2Q5D A;  4DB6 A;  5CTT A;  4FZD A;  3L3F X;  3PSP A;  1WA5 C;  5CLB A;  1QZ7 A;  3Q0L A;  5D5K C;  1B3U A;  4FP7 A;  3K64 A;  3K7V A;  3H3D X;  3TPO A;  4I1E A;  4FQ3 A;  2OT8 A;  4H3K A;  2X19 B;  4OIH A;  2JKR B;  2JKR A;  4I37 A;  5KL8 A;  4DZS A;  2IW3 A;  4I5L A;  4U5U A;  4U5L A;  1BK6 A;  3ZHP A;  5B56 A;  4B8O A;  5J3V A;  3K61 A;  2RU4 B;  2RU4 A;  3ZIK A;  4R10 A;  1TH1 A;  3WPT A;  1G3J A;  3O4X A;  2NPP B;  2NPP A;  3ZIO A;  2JDQ A;  4EVA A;  4NZW A;  4I8M A;  3ZIQ A;  4HXT A;  5BZV A;  3GNI A;  1IAL A;  3A6P A;  5BZ5 A;  5H2X A;  4CBA A;  5HHG E;  2W3C A;  2JAK A;  1UKL A;  1W63 B;  1W63 A;  2IE3 A;  1M8X A;  1I7W A;  4B8P A;  5EWP A;  2XOA A;  2QK2 A;  5EKG A;  4P6Z B;  2C1M A;  5KUB A;  4JKQ A;  3BSB A;  3OPB A;  3OUX A;  4U5V A;  3JXY A;  3ZIP A;  3VWA A;  3QGC A;  4U5S A;  4DJS A;  5CLA A;  3FGA B;  4TNM A;  1BK5 A;  1IBR B;  3Q5U A;  4I96 A;  3RZX A;  1XQR A;  5LSW A;  3O2T A;  4IMI A;  4JLQ A;  3Q0S A;  1Z2C B;  4UAD A;  2VGL B;  2VGL A;  4QMJ A;  3OQS A;  3BWT A;  2PF4 A;  3O2S A;  1LUJ A;  1HO8 A;  3GRL A;  3LTJ A;  1TE4 A;  2Z6H A;  3VE6 A;  5CL6 A;  1EJY I;  3ND2 A;  3K49 A;  4Y5J A;  3LWW A;  4PLS A;  4GMN A;  3BTR C;  2Z5M A;  3FEY C;  3TPM A;  1T08 A;  2NYL B;  2NYL A;  4EVT A;  4HTV A;  3QG9 A;  3NMW A;  4XZR B;  4UAE A;  4EV8 A;  3JXZ A;  5CL9 A;  4UQI B;  4UQI A;  4U54 A;  3UL0 B;  4CT6 B;  3DAD A;  4JW3 C;  3IFQ A;  4CB9 A;  3ZIL A;  4H3H A;  1M8Y A;  1QGK A;  3L6Y A;  1U6G C;  3C2H A;  3UKY B;  4G3A A;  3SL9 A;  5SWF A;  2IAE B;  1M8Z A;  2Z6G A;  2BKU B;  2Z5N A;  3Q0Q A;  2IWH A;  4ZDU A;  4BA3 A;  4I5N A;  4RXH B;  5CL3 A;  5SW9 A;  4MZ5 E;  2BNX A;  4BQK A;  1PJN B;  3K62 A;  1O6P A;  3GQ2 A;  3QHE A;  4EV9 A;  3T7U A;  4UWX A;  3GVT A;  4A0C A;  3NOW A;  4K92 A;  5HUY C;  4O27 A;  3K4E A;  4I2S A;  2NYM B;  4IMJ A;  5E6Q B;  1Y2A C;  4D4E A;  1UPK A;  1V18 A;  4U5O A;  4K6J A;  4CRV B;  1M5N S;  4KZG A;  3GVO A;  2JKT B;  2JKT A;  3L6X A;  4V3Q A;  3UKX B;  4EVP A;  4E4V A;  3Q0O A;  4L7M A;  5KL1 A;  5H2W A;  3FGA A;  4U2X D;  3TJ3 A;  5BYM A;  4A3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...