3WOZA

Crystal structure of clasp2 tog domain (tog3)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
225
structure length
225
Chain Sequence
TEDVAEVLNRCASSNWSERKEGLLGLQNLLKNQRTLSRIELKRLCEIFTRMFADPHGKVFSMFLETLVDFIQVHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDITRESFPNDLQFNILMRFTVDQTQTPSLKVKVAILKYIETLAKQMDPRDFTNSSETRLAVSRVITWTTEPKSSDVRKAAQSVLISLFELNTPEFTMLLGALPKTFQDGATKLLHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords CLIP-associating protein 2
publication title CLASP2 Has Two Distinct TOG Domains That Contribute Differently to Microtubule Dynamics
pubmed doi rcsb
source organism Mus musculus
total genus 78
structure length 225
sequence length 225
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 3wozA00
4U58A 1B3UA 3A6PA 1Q1TC 5LSWA 3EBBA 5EKGA 5EWPA 1QZ7A 4JW2B 4B18A 3ZIQA 1PJNB 1I7XA 3IBVA 3GAEA 3W3UA 4DB9A 2RU4B 1EJYI 4HXTA 4OIHA 3ZIRA 1TH1A 3UVUA 2BAPA 1GCJA 4KZGA 3K64A 2Z5OA 5SWFA 4YJEA 3TJ3A 3ODRA 1O6PA 4E4VA 3GQ2A 1BK5A 5HHGE 4FQ3A 2IWHA 3BWTA 4DB8A 3Q0NA 3K5QA 4O27A 2QNAA 4NZWA 4CB9A 2IX3A 3Q0SA 1LRVA 4NEEA 3VWAA 1WA5B 4PVZA 2Z5JA 5HUWC 3C2HA 2YNSA 4GMNA 3FGAA 2WTKA 5BYMA 2JKRA 4R10A 5CTTA 3O2QA 4K92A 1W63B 3RZXA 2BNXA 4HNMA 5FC8E 3Q0RA 3UKWB 3IFQA 4XZRB 3L6XA 1IBRB 3TJZB 5HUYC 1JPWA 4FDDA 3BTRC 5AEIA 2YJYA 4FZAA 1I7WA 4U5NA 3NMWA 2RU4A 5BZ1A 2NPPA 4ZDUA 3TT9A 2GL7A 4PLQA 4CV5B 5KL1A 4DVGB 3O2SA 1XQSA 3OUWA 4YGXA 3H3DX 2XA7B 3DW8A 3FGAB 3QHEA 3GRLA 4U3JC 4D49A 2JKRB 4CB8A 4RZPA 2QK2A 4JLQA 4WV6A 4MFVA 3NMZA 3BSXA 1M5NS 1M1EA 4UAEA 3TPMA 1EE4A 4U5VA 4QMJA 3WOYA 3EA5B 1JDHA 4MFUA 2NYMB 4U5LA 5K9SA 1Z2CB 3UL1B 4BQKA 3NMXA 4I2WA 2H4MA 3PSTA 2JAKA 2BKUB 3QGBA 3GB8A 2NPPB 1W63A 3OPBA 4UWXA 4IMJA 4UQIB 5SW9A 4UAFB 4OO6A 2VGLB 2QMRA 4EVPA 2F31A 3K61A 1HO8A 2DB0A 5KL8A 4BPLA 5H2WA 4CRVB 1F59A 4U5SA 3GVOA 2C1TA 4LACA 5SVZA 5KLTB 2JKTA 3BX3A 3C2GA 1Y2AC 3V74A 3WOZA 4QMHA 1UPLA 3PSPA 3T7UA 4D4EA 3Q0LA 2XA7A 4U5UA 5KLRB 3OUXA 4CRUB 4EVTA 5D5KC 1M8WA 3BX2A 5B56A 1W9CA 2NYMA 2BCTA 1U6GC 3EG5B 3ODSA 3GVTA 3QG9A 3Q0OA 4A0CA 4HTVA 3BCTA 2P8QA 1G3JA 3OQSA 3UKZB 3L3QA 5BZUA 1EE5A 3QGCA 2Z5KA 1QGRA 3O4XA 2W3CA 2OT8A 2JKTB 3OBVA 3ZHPA 2QK1A 3O2TA 3FEYC 4UQIA 2Z6GA 2X19B 3Q0QA 2VGLA 2Z6HA 4MZ5E 4YI0C 5BZVA 4CBAA 4V3QA 1OYZA 3GNIA 2FV2A 1XM9A 1WA5C 3K5ZA 4K6JA 5J3VA 3UL0B 3LWWA 3K4EA 3FEXC 3K7VA 4QMIA 3K62A 2IW3A 3ZKVA 1T08A 4CT7B 3Q5UA 4YK6A 4BA3A 2IAEB 4CT6B 2YNRA 1M8YA 1PJMB 5DN7A 1IQ1C 1UN0A 4EV9A 4P6ZB 4G3AA 4L7MA 4PLRA 2PKGA 3ZIPA 4I5NA 5EKFA 1QGKA 5KLAA 2JDQA 4I5LA 4RXHB 3LTMA 4EVAA 3K49A 4B8JA 3ZINA 1IB2A 3L3FX 2C1MA 3ND2A 3TPOA 3V71A 4FZFA 4PLSA 4RV1A 2NYLB 4UADA 4R11A 4U54A 3GS3A 3K7WA 5K6SA 2PF4A 1UKLA 4H3KA 2OF3A 3AU3A 4R0ZA 4DB6A 3RZ9A 1V18A 3DADA 3TX7A 3Q0MA 3ZIOA 1Q1SC 4DZSA 3WYFC 4ADYA 3UKYB 5JJAA 4P6ZG 2IE4A 4FFBC 4B8OA 4DJSA 1O6OA 3BSBA 3QMLC 4H3HA 4MZ6E 5BZ5A 1XQRA 4EV8A 1M8ZA 4GMOA 3KNDA 4DBAA 2IAEA 3VE6A 1QBKB 5E6QB 4TNMA 2Q5DA 4B8PA 1BK6A 3K5YA 3NOWA 1LUJA 1UPKA 5H2XA 2Z5NA 1IALA 4V3RA 3Q0PA 4U5OA 4FZDA 3WPTA 4YJLA 1M8XA 2IE3A 3UKXB 4IMIA 4I2ZA 4V3OA 1EJLI 1JPPA 2X1GF 3LTJA 2NYLA 3C5WA 3L6YA 4Y5JA 3V6YA 2Z5MA 4HM9A
chains in the Genus database with same CATH superfamily
4U58A 1B3UA 3A6PA 1Q1TC 5LSWA 3EBBA 5EKGA 5EWPA 1QZ7A 3JY1A 4JW2B 4B18A 3ZIQA 3SL9A 1PJNB 1I7XA 3IBVA 3GAEA 3W3UA 4DB9A 2RU4B 1EJYI 4HXTA 4OIHA 3ZIRA 1TH1A 3UVUA 2BAPA 1GCJA 4KZGA 3K64A 2Z5OA 5SWFA 4YJEA 3TJ3A 3ODRA 1O6PA 4E4VA 3GQ2A 4FP7A 1BK5A 5HHGE 4FQ3A 2IWHA 3BWTA 4DB8A 3Q0NA 3K5QA 4O27A 2QNAA 4NZWA 4CB9A 2IX3A 3Q0SA 1LRVA 4NEEA 3VWAA 1WA5B 4PVZA 2Z5JA 5HUWC 3C2HA 2YNSA 4GMNA 3VLDA 5CLAA 3FGAA 2WTKA 5BYMA 2JKRA 4R10A 4L4HA 5CTTA 3O2QA 4K92A 1W63B 3RZXA 2BNXA 4HNMA 5FC8E 3Q0RA 3UKWB 3IFQA 4XZRB 3L6XA 3SLAA 1IBRB 3TJZB 5HUYC 1JPWA 4FDDA 3BTRC 5AEIA 4JW2A 2YJYA 4FZAA 4JKQA 1I7WA 4U5NA 3NMWA 4JW3C 2RU4A 5BZ1A 2NPPA 4ZDUA 3TT9A 2GL7A 4PLQA 4CV5B 5KL1A 4DVGB 3O2SA 5KUBA 5CL6A 1XQSA 3OUWA 4YGXA 3H3DX 2XA7B 3DW8A 3FGAB 3QHEA 3GRLA 4U3JC 4D49A 2JKRB 4CB8A 4RZPA 2QK2A 4JLQA 4WV6A 4MFVA 3NMZA 3BSXA 1M5NS 1M1EA 4UAEA 3TPMA 1EE4A 4U5VA 4QMJA 3WOYA 3EA5B 1JDHA 4MFUA 2NYMB 4U5LA 1N4KA 5CL4A 5K9SA 1Z2CB 3UL1B 4BQKA 3NMXA 4I2WA 2H4MA 3PSTA 2JAKA 2BKUB 3QGBA 3GB8A 2NPPB 3JXZA 1W63A 3OPBA 4UWXA 4IMJA 4UQIB 3ZIKA 3VLEA 5SW9A 4UAFB 4OO6A 5CL3A 2VGLB 2QMRA 4EVPA 2F31A 3K61A 1HO8A 2DB0A 5KL8A 4BPLA 5H2WA 4CRVB 1F59A 4U5SA 1TE4A 3GVOA 3T8SA 2C1TA 4LACA 2XOAA 5SVZA 5KLTB 2JKTA 3BX3A 3C2GA 1Y2AC 3V74A 3WOZA 4QMHA 1UPLA 3PSPA 3T7UA 4D4EA 3Q0LA 2XA7A 4U5UA 5KLRB 5CLBA 3OUXA 4CRUB 4EVTA 5D5KC 5CL9A 1M8WA 3BX2A 5B56A 1W9CA 2NYMA 2BCTA 1U6GC 3EG5B 3ODSA 3GVTA 3QG9A 3Q0OA 4A0CA 4HTVA 3BCTA 3UJ4A 2P8QA 1G3JA 3OQSA 3UKZB 3L3QA 5CLCA 5BZUA 1EE5A 3QGCA 2Z5KA 1QGRA 3O4XA 2W3CA 2OT8A 2JKTB 3OBVA 4I0YA 3ZHPA 5CL7A 2QK1A 3O2TA 3FEYC 4UQIA 2Z6GA 2X19B 3Q0QA 2VGLA 2Z6HA 3BVSA 4MZ5E 4YI0C 5BZVA 4CBAA 4V3QA 1OYZA 3GNIA 2FV2A 1XM9A 1WA5C 3K5ZA 4K6JA 5J3VA 3UL0B 3LWWA 3K4EA 3FEXC 3K7VA 4QMIA 3K62A 2IW3A 3UJ0A 4L4IA 3ZKVA 1T08A 4CT7B 3Q5UA 4YK6A 4BA3A 2IAEB 4CT6B 2YNRA 1M8YA 1PJMB 5DN7A 1IQ1C 3VLFA 3JX7A 1UN0A 4EV9A 4P6ZB 4G3AA 4L7MA 4PLRA 2PKGA 3ZIPA 4I5NA 5EKFA 1QGKA 5KLAA 2JDQA 4I5LA 4RXHB 3LTMA 4EVAA 3K49A 4B8JA 3ZINA 1IB2A 3L3FX 2C1MA 3ND2A 3TPOA 4I8MA 3V71A 4FZFA 4U2XD 5CL5A 4PLSA 4RV1A 2NYLB 4UADA 4I2SA 4R11A 4I7IA 4A3VA 4U54A 3GS3A 3K7WA 5K6SA 2PF4A 1UKLA 4H3KA 2OF3A 3AU3A 4R0ZA 5CLEA 4DB6A 3RZ9A 1V18A 4I3NA 3DADA 3TX7A 3Q0MA 3ZIOA 1Q1SC 4DZSA 3WYFC 4ADYA 3UKYB 5JJAA 4P6ZG 2IE4A 4FFBC 4B8OA 4DJSA 1O6OA 4A3TA 5CLDA 3BSBA 3QMLC 4H3HA 4MZ6E 5BZ5A 1XQRA 4EV8A 1M8ZA 4GMOA 3KNDA 4DBAA 2IAEA 3JXYA 3VE6A 1QBKB 5E6QB 4TNMA 2Q5DA 4B8PA 3ZILA 1BK6A 4I1EA 3K5YA 3NOWA 1LUJA 4I6IA 4I37A 1UPKA 5H2XA 2Z5NA 1IALA 4V3RA 3Q0PA 1LSHA 4U5OA 4FZDA 3WPTA 4YJLA 1M8XA 2IE3A 3UKXB 4I96A 4IMIA 4I2ZA 4V3OA 1EJLI 1JPPA 2X1GF 3LTJA 2NYLA 3C5WA 3L6YA 5CL8A 4Y5JA 3V6YA 2Z5MA 4HM9A
chains in the Genus database with same CATH topology
4U58A 1B3UA 3A6PA 1Q1TC 5LSWA 3EBBA 5EKGA 5EWPA 1QZ7A 3JY1A 4JW2B 4B18A 3ZIQA 3SL9A 1PJNB 1I7XA 3IBVA 3GAEA 3W3UA 4DB9A 2RU4B 1EJYI 4HXTA 4OIHA 3ZIRA 1TH1A 3UVUA 2BAPA 1GCJA 4KZGA 3K64A 2Z5OA 5SWFA 4YJEA 3TJ3A 3ODRA 1O6PA 4E4VA 3GQ2A 4FP7A 1BK5A 5HHGE 4FQ3A 2IWHA 3BWTA 4DB8A 3Q0NA 3K5QA 4O27A 2QNAA 4NZWA 4CB9A 2IX3A 3Q0SA 1LRVA 4NEEA 3VWAA 1WA5B 4PVZA 2Z5JA 5HUWC 3C2HA 2YNSA 4GMNA 3VLDA 5CLAA 3FGAA 2WTKA 5BYMA 2JKRA 4R10A 4L4HA 5CTTA 3O2QA 4K92A 1W63B 3RZXA 2BNXA 4HNMA 5FC8E 3Q0RA 3UKWB 3IFQA 4XZRB 3L6XA 3SLAA 1IBRB 3TJZB 5HUYC 1JPWA 4FDDA 3BTRC 5AEIA 4JW2A 2YJYA 4FZAA 4JKQA 1I7WA 4U5NA 3NMWA 4JW3C 2RU4A 5BZ1A 2NPPA 4ZDUA 3TT9A 2GL7A 4PLQA 4CV5B 5KL1A 4DVGB 3O2SA 5KUBA 5CL6A 1XQSA 3OUWA 4YGXA 3H3DX 2XA7B 3DW8A 3FGAB 3QHEA 3GRLA 4U3JC 4D49A 2JKRB 4CB8A 4RZPA 2QK2A 4JLQA 4WV6A 4MFVA 3NMZA 3BSXA 1M5NS 1M1EA 4UAEA 3TPMA 1EE4A 4U5VA 4QMJA 3WOYA 3EA5B 1JDHA 4MFUA 2NYMB 4U5LA 5K9SA 5CL4A 1Z2CB 3UL1B 4BQKA 3NMXA 4I2WA 2H4MA 3PSTA 2JAKA 2BKUB 3QGBA 3GB8A 2NPPB 3JXZA 1W63A 3OPBA 4UWXA 4IMJA 4UQIB 3ZIKA 3VLEA 5SW9A 4UAFB 4OO6A 5CL3A 2VGLB 2QMRA 4EVPA 2F31A 3K61A 1HO8A 2DB0A 5KL8A 4BPLA 5H2WA 4CRVB 1F59A 4U5SA 1TE4A 3GVOA 2C1TA 4LACA 2XOAA 5SVZA 5KLTB 2JKTA 3BX3A 3C2GA 1Y2AC 3V74A 3WOZA 4QMHA 1UPLA 3PSPA 3T7UA 4D4EA 3Q0LA 2XA7A 4U5UA 5KLRB 5CLBA 3OUXA 4CRUB 4EVTA 5D5KC 5CL9A 1M8WA 3BX2A 5B56A 1W9CA 2NYMA 2BCTA 1U6GC 3EG5B 3ODSA 3GVTA 3QG9A 3Q0OA 4A0CA 4HTVA 3BCTA 2P8QA 1G3JA 3OQSA 3UKZB 3L3QA 5CLCA 5BZUA 1EE5A 3QGCA 2Z5KA 1QGRA 3O4XA 2W3CA 2OT8A 2JKTB 3OBVA 4I0YA 3ZHPA 5CL7A 2QK1A 3O2TA 3FEYC 4UQIA 2Z6GA 2X19B 3Q0QA 2VGLA 2Z6HA 3BVSA 4MZ5E 4YI0C 5BZVA 4CBAA 4V3QA 1OYZA 3GNIA 2FV2A 1XM9A 1WA5C 3K5ZA 4K6JA 5J3VA 3UL0B 3LWWA 3K4EA 3FEXC 3K7VA 4QMIA 3K62A 2IW3A 4L4IA 3ZKVA 1T08A 4CT7B 3Q5UA 4YK6A 4BA3A 2IAEB 4CT6B 2YNRA 1M8YA 1PJMB 5DN7A 1IQ1C 3VLFA 3JX7A 1UN0A 4EV9A 4P6ZB 4G3AA 4L7MA 4PLRA 2PKGA 3ZIPA 4I5NA 5EKFA 1QGKA 5KLAA 2JDQA 4I5LA 4RXHB 3LTMA 4EVAA 3K49A 4B8JA 3ZINA 1IB2A 3L3FX 2C1MA 3ND2A 3TPOA 4I8MA 3V71A 4FZFA 4U2XD 5CL5A 4PLSA 4RV1A 2NYLB 4UADA 4I2SA 4R11A 4I7IA 4A3VA 4U54A 3GS3A 3K7WA 5K6SA 2PF4A 1UKLA 4H3KA 2OF3A 3AU3A 4R0ZA 5CLEA 4DB6A 3RZ9A 1V18A 4I3NA 3DADA 3TX7A 3Q0MA 3ZIOA 1Q1SC 4DZSA 3WYFC 4ADYA 3UKYB 5JJAA 4P6ZG 2IE4A 4FFBC 4B8OA 4DJSA 1O6OA 4A3TA 5CLDA 3BSBA 3QMLC 4H3HA 4MZ6E 5BZ5A 1XQRA 4EV8A 1M8ZA 4GMOA 3KNDA 4DBAA 2IAEA 3JXYA 3VE6A 1QBKB 5E6QB 4TNMA 2Q5DA 4B8PA 3ZILA 1BK6A 4I1EA 3K5YA 3NOWA 1LUJA 4I6IA 4I37A 1UPKA 5H2XA 2Z5NA 1IALA 4V3RA 3Q0PA 4U5OA 4FZDA 3WPTA 4YJLA 1M8XA 2IE3A 3UKXB 4I96A 4IMIA 4I2ZA 4V3OA 1EJLI 1JPPA 2X1GF 3LTJA 2NYLA 3C5WA 3L6YA 5CL8A 4Y5JA 3V6YA 2Z5MA 4HM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U58 A;  1B3U A;  3A6P A;  1Q1T C;  5LSW A;  3EBB A;  5EKG A;  5EWP A;  1QZ7 A;  4JW2 B;  4B18 A;  3ZIQ A;  1PJN B;  1I7X A;  3IBV A;  3GAE A;  3W3U A;  4DB9 A;  2RU4 B;  1EJY I;  4HXT A;  4OIH A;  3ZIR A;  1TH1 A;  3UVU A;  2BAP A;  1GCJ A;  4KZG A;  3K64 A;  2Z5O A;  5SWF A;  4YJE A;  3TJ3 A;  3ODR A;  1O6P A;  4E4V A;  3GQ2 A;  1BK5 A;  5HHG E;  4FQ3 A;  2IWH A;  3BWT A;  4DB8 A;  3Q0N A;  3K5Q A;  4O27 A;  2QNA A;  4NZW A;  4CB9 A;  2IX3 A;  3Q0S A;  1LRV A;  4NEE A;  3VWA A;  1WA5 B;  4PVZ A;  2Z5J A;  5HUW C;  3C2H A;  2YNS A;  4GMN A;  3FGA A;  2WTK A;  5BYM A;  2JKR A;  4R10 A;  5CTT A;  3O2Q A;  4K92 A;  1W63 B;  3RZX A;  2BNX A;  4HNM A;  5FC8 E;  3Q0R A;  3UKW B;  3IFQ A;  4XZR B;  3L6X A;  1IBR B;  3TJZ B;  5HUY C;  1JPW A;  4FDD A;  3BTR C;  5AEI A;  2YJY A;  4FZA A;  1I7W A;  4U5N A;  3NMW A;  2RU4 A;  5BZ1 A;  2NPP A;  4ZDU A;  3TT9 A;  2GL7 A;  4PLQ A;  4CV5 B;  5KL1 A;  4DVG B;  3O2S A;  1XQS A;  3OUW A;  4YGX A;  3H3D X;  2XA7 B;  3DW8 A;  3FGA B;  3QHE A;  3GRL A;  4U3J C;  4D49 A;  2JKR B;  4CB8 A;  4RZP A;  2QK2 A;  4JLQ A;  4WV6 A;  4MFV A;  3NMZ A;  3BSX A;  1M5N S;  1M1E A;  4UAE A;  3TPM A;  1EE4 A;  4U5V A;  4QMJ A;  3WOY A;  3EA5 B;  1JDH A;  4MFU A;  2NYM B;  4U5L A;  5K9S A;  1Z2C B;  3UL1 B;  4BQK A;  3NMX A;  4I2W A;  2H4M A;  3PST A;  2JAK A;  2BKU B;  3QGB A;  3GB8 A;  2NPP B;  1W63 A;  3OPB A;  4UWX A;  4IMJ A;  4UQI B;  5SW9 A;  4UAF B;  4OO6 A;  2VGL B;  2QMR A;  4EVP A;  2F31 A;  3K61 A;  1HO8 A;  2DB0 A;  5KL8 A;  4BPL A;  5H2W A;  4CRV B;  1F59 A;  4U5S A;  3GVO A;  2C1T A;  4LAC A;  5SVZ A;  5KLT B;  2JKT A;  3BX3 A;  3C2G A;  1Y2A C;  3V74 A;  3WOZ A;  4QMH A;  1UPL A;  3PSP A;  3T7U A;  4D4E A;  3Q0L A;  2XA7 A;  4U5U A;  5KLR B;  3OUX A;  4CRU B;  4EVT A;  5D5K C;  1M8W A;  3BX2 A;  5B56 A;  1W9C A;  2NYM A;  2BCT A;  1U6G C;  3EG5 B;  3ODS A;  3GVT A;  3QG9 A;  3Q0O A;  4A0C A;  4HTV A;  3BCT A;  2P8Q A;  1G3J A;  3OQS A;  3UKZ B;  3L3Q A;  5BZU A;  1EE5 A;  3QGC A;  2Z5K A;  1QGR A;  3O4X A;  2W3C A;  2OT8 A;  2JKT B;  3OBV A;  3ZHP A;  2QK1 A;  3O2T A;  3FEY C;  4UQI A;  2Z6G A;  2X19 B;  3Q0Q A;  2VGL A;  2Z6H A;  4MZ5 E;  4YI0 C;  5BZV A;  4CBA A;  4V3Q A;  1OYZ A;  3GNI A;  2FV2 A;  1XM9 A;  1WA5 C;  3K5Z A;  4K6J A;  5J3V A;  3UL0 B;  3LWW A;  3K4E A;  3FEX C;  3K7V A;  4QMI A;  3K62 A;  2IW3 A;  3ZKV A;  1T08 A;  4CT7 B;  3Q5U A;  4YK6 A;  4BA3 A;  2IAE B;  4CT6 B;  2YNR A;  1M8Y A;  1PJM B;  5DN7 A;  1IQ1 C;  1UN0 A;  4EV9 A;  4P6Z B;  4G3A A;  4L7M A;  4PLR A;  2PKG A;  3ZIP A;  4I5N A;  5EKF A;  1QGK A;  5KLA A;  2JDQ A;  4I5L A;  4RXH B;  3LTM A;  4EVA A;  3K49 A;  4B8J A;  3ZIN A;  1IB2 A;  3L3F X;  2C1M A;  3ND2 A;  3TPO A;  3V71 A;  4FZF A;  4PLS A;  4RV1 A;  2NYL B;  4UAD A;  4R11 A;  4U54 A;  3GS3 A;  3K7W A;  5K6S A;  2PF4 A;  1UKL A;  4H3K A;  2OF3 A;  3AU3 A;  4R0Z A;  4DB6 A;  3RZ9 A;  1V18 A;  3DAD A;  3TX7 A;  3Q0M A;  3ZIO A;  1Q1S C;  4DZS A;  3WYF C;  4ADY A;  3UKY B;  5JJA A;  4P6Z G;  2IE4 A;  4FFB C;  4B8O A;  4DJS A;  1O6O A;  3BSB A;  3QML C;  4H3H A;  4MZ6 E;  5BZ5 A;  1XQR A;  4EV8 A;  1M8Z A;  4GMO A;  3KND A;  4DBA A;  2IAE A;  3VE6 A;  1QBK B;  5E6Q B;  4TNM A;  2Q5D A;  4B8P A;  1BK6 A;  3K5Y A;  3NOW A;  1LUJ A;  1UPK A;  5H2X A;  2Z5N A;  1IAL A;  4V3R A;  3Q0P A;  4U5O A;  4FZD A;  3WPT A;  4YJL A;  1M8X A;  2IE3 A;  3UKX B;  4IMI A;  4I2Z A;  4V3O A;  1EJL I;  1JPP A;  2X1G F;  3LTJ A;  2NYL A;  3C5W A;  3L6Y A;  4Y5J A;  3V6Y A;  2Z5M A;  4HM9 A; 
#chains in the Genus database with same CATH topology
 4U58 A;  1B3U A;  3A6P A;  1Q1T C;  5LSW A;  3EBB A;  5EKG A;  5EWP A;  1QZ7 A;  3JY1 A;  4JW2 B;  4B18 A;  3ZIQ A;  3SL9 A;  1PJN B;  1I7X A;  3IBV A;  3GAE A;  3W3U A;  4DB9 A;  2RU4 B;  1EJY I;  4HXT A;  4OIH A;  3ZIR A;  1TH1 A;  3UVU A;  2BAP A;  1GCJ A;  4KZG A;  3K64 A;  2Z5O A;  5SWF A;  4YJE A;  3TJ3 A;  3ODR A;  1O6P A;  4E4V A;  3GQ2 A;  4FP7 A;  1BK5 A;  5HHG E;  4FQ3 A;  2IWH A;  3BWT A;  4DB8 A;  3Q0N A;  3K5Q A;  4O27 A;  2QNA A;  4NZW A;  4CB9 A;  2IX3 A;  3Q0S A;  1LRV A;  4NEE A;  3VWA A;  1WA5 B;  4PVZ A;  2Z5J A;  5HUW C;  3C2H A;  2YNS A;  4GMN A;  3VLD A;  5CLA A;  3FGA A;  2WTK A;  5BYM A;  2JKR A;  4R10 A;  4L4H A;  5CTT A;  3O2Q A;  4K92 A;  1W63 B;  3RZX A;  2BNX A;  4HNM A;  5FC8 E;  3Q0R A;  3UKW B;  3IFQ A;  4XZR B;  3L6X A;  3SLA A;  1IBR B;  3TJZ B;  5HUY C;  1JPW A;  4FDD A;  3BTR C;  5AEI A;  4JW2 A;  2YJY A;  4FZA A;  4JKQ A;  1I7W A;  4U5N A;  3NMW A;  4JW3 C;  2RU4 A;  5BZ1 A;  2NPP A;  4ZDU A;  3TT9 A;  2GL7 A;  4PLQ A;  4CV5 B;  5KL1 A;  4DVG B;  3O2S A;  5KUB A;  5CL6 A;  1XQS A;  3OUW A;  4YGX A;  3H3D X;  2XA7 B;  3DW8 A;  3FGA B;  3QHE A;  3GRL A;  4U3J C;  4D49 A;  2JKR B;  4CB8 A;  4RZP A;  2QK2 A;  4JLQ A;  4WV6 A;  4MFV A;  3NMZ A;  3BSX A;  1M5N S;  1M1E A;  4UAE A;  3TPM A;  1EE4 A;  4U5V A;  4QMJ A;  3WOY A;  3EA5 B;  1JDH A;  4MFU A;  2NYM B;  4U5L A;  1N4K A;  5CL4 A;  5K9S A;  1Z2C B;  3UL1 B;  4BQK A;  3NMX A;  4I2W A;  2H4M A;  3PST A;  2JAK A;  2BKU B;  3QGB A;  3GB8 A;  2NPP B;  3JXZ A;  1W63 A;  3OPB A;  4UWX A;  4IMJ A;  4UQI B;  3ZIK A;  3VLE A;  5SW9 A;  4UAF B;  4OO6 A;  5CL3 A;  2VGL B;  2QMR A;  4EVP A;  2F31 A;  3K61 A;  1HO8 A;  2DB0 A;  5KL8 A;  4BPL A;  5H2W A;  4CRV B;  1F59 A;  4U5S A;  1TE4 A;  3GVO A;  3T8S A;  2C1T A;  4LAC A;  2XOA A;  5SVZ A;  5KLT B;  2JKT A;  3BX3 A;  3C2G A;  1Y2A C;  3V74 A;  3WOZ A;  4QMH A;  1UPL A;  3PSP A;  3T7U A;  4D4E A;  3Q0L A;  2XA7 A;  4U5U A;  5KLR B;  5CLB A;  3OUX A;  4CRU B;  4EVT A;  5D5K C;  5CL9 A;  1M8W A;  3BX2 A;  5B56 A;  1W9C A;  2NYM A;  2BCT A;  1U6G C;  3EG5 B;  3ODS A;  3GVT A;  3QG9 A;  3Q0O A;  4A0C A;  4HTV A;  3BCT A;  3UJ4 A;  2P8Q A;  1G3J A;  3OQS A;  3UKZ B;  3L3Q A;  5CLC A;  5BZU A;  1EE5 A;  3QGC A;  2Z5K A;  1QGR A;  3O4X A;  2W3C A;  2OT8 A;  2JKT B;  3OBV A;  4I0Y A;  3ZHP A;  5CL7 A;  2QK1 A;  3O2T A;  3FEY C;  4UQI A;  2Z6G A;  2X19 B;  3Q0Q A;  2VGL A;  2Z6H A;  3BVS A;  4MZ5 E;  4YI0 C;  5BZV A;  4CBA A;  4V3Q A;  1OYZ A;  3GNI A;  2FV2 A;  1XM9 A;  1WA5 C;  3K5Z A;  4K6J A;  5J3V A;  3UL0 B;  3LWW A;  3K4E A;  3FEX C;  3K7V A;  4QMI A;  3K62 A;  2IW3 A;  3UJ0 A;  4L4I A;  3ZKV A;  1T08 A;  4CT7 B;  3Q5U A;  4YK6 A;  4BA3 A;  2IAE B;  4CT6 B;  2YNR A;  1M8Y A;  1PJM B;  5DN7 A;  1IQ1 C;  3VLF A;  3JX7 A;  1UN0 A;  4EV9 A;  4P6Z B;  4G3A A;  4L7M A;  4PLR A;  2PKG A;  3ZIP A;  4I5N A;  5EKF A;  1QGK A;  5KLA A;  2JDQ A;  4I5L A;  4RXH B;  3LTM A;  4EVA A;  3K49 A;  4B8J A;  3ZIN A;  1IB2 A;  3L3F X;  2C1M A;  3ND2 A;  3TPO A;  4I8M A;  3V71 A;  4FZF A;  4U2X D;  5CL5 A;  4PLS A;  4RV1 A;  2NYL B;  4UAD A;  4I2S A;  4R11 A;  4I7I A;  4A3V A;  4U54 A;  3GS3 A;  3K7W A;  5K6S A;  2PF4 A;  1UKL A;  4H3K A;  2OF3 A;  3AU3 A;  4R0Z A;  5CLE A;  4DB6 A;  3RZ9 A;  1V18 A;  4I3N A;  3DAD A;  3TX7 A;  3Q0M A;  3ZIO A;  1Q1S C;  4DZS A;  3WYF C;  4ADY A;  3UKY B;  5JJA A;  4P6Z G;  2IE4 A;  4FFB C;  4B8O A;  4DJS A;  1O6O A;  4A3T A;  5CLD A;  3BSB A;  3QML C;  4H3H A;  4MZ6 E;  5BZ5 A;  1XQR A;  4EV8 A;  1M8Z A;  4GMO A;  3KND A;  4DBA A;  2IAE A;  3JXY A;  3VE6 A;  1QBK B;  5E6Q B;  4TNM A;  2Q5D A;  4B8P A;  3ZIL A;  1BK6 A;  4I1E A;  3K5Y A;  3NOW A;  1LUJ A;  4I6I A;  4I37 A;  1UPK A;  5H2X A;  2Z5N A;  1IAL A;  4V3R A;  3Q0P A;  1LSH A;  4U5O A;  4FZD A;  3WPT A;  4YJL A;  1M8X A;  2IE3 A;  3UKX B;  4I96 A;  4IMI A;  4I2Z A;  4V3O A;  1EJL I;  1JPP A;  2X1G F;  3LTJ A;  2NYL A;  3C5W A;  3L6Y A;  5CL8 A;  4Y5J A;  3V6Y A;  2Z5M A;  4HM9 A; 
#chains in the Genus database with same CATH homology
 4U58 A;  1B3U A;  3A6P A;  1Q1T C;  5LSW A;  3EBB A;  5EKG A;  5EWP A;  1QZ7 A;  3JY1 A;  4JW2 B;  4B18 A;  3ZIQ A;  3SL9 A;  1PJN B;  1I7X A;  3IBV A;  3GAE A;  3W3U A;  4DB9 A;  2RU4 B;  1EJY I;  4HXT A;  4OIH A;  3ZIR A;  1TH1 A;  3UVU A;  2BAP A;  1GCJ A;  4KZG A;  3K64 A;  2Z5O A;  5SWF A;  4YJE A;  3TJ3 A;  3ODR A;  1O6P A;  4E4V A;  3GQ2 A;  4FP7 A;  1BK5 A;  5HHG E;  4FQ3 A;  2IWH A;  3BWT A;  4DB8 A;  3Q0N A;  3K5Q A;  4O27 A;  2QNA A;  4NZW A;  4CB9 A;  2IX3 A;  3Q0S A;  1LRV A;  4NEE A;  3VWA A;  1WA5 B;  4PVZ A;  2Z5J A;  5HUW C;  3C2H A;  2YNS A;  4GMN A;  3VLD A;  5CLA A;  3FGA A;  2WTK A;  5BYM A;  2JKR A;  4R10 A;  4L4H A;  5CTT A;  3O2Q A;  4K92 A;  1W63 B;  3RZX A;  2BNX A;  4HNM A;  5FC8 E;  3Q0R A;  3UKW B;  3IFQ A;  4XZR B;  3L6X A;  3SLA A;  1IBR B;  3TJZ B;  5HUY C;  1JPW A;  4FDD A;  3BTR C;  5AEI A;  4JW2 A;  2YJY A;  4FZA A;  4JKQ A;  1I7W A;  4U5N A;  3NMW A;  4JW3 C;  2RU4 A;  5BZ1 A;  2NPP A;  4ZDU A;  3TT9 A;  2GL7 A;  4PLQ A;  4CV5 B;  5KL1 A;  4DVG B;  3O2S A;  5KUB A;  5CL6 A;  1XQS A;  3OUW A;  4YGX A;  3H3D X;  2XA7 B;  3DW8 A;  3FGA B;  3QHE A;  3GRL A;  4U3J C;  4D49 A;  2JKR B;  4CB8 A;  4RZP A;  2QK2 A;  4JLQ A;  4WV6 A;  4MFV A;  3NMZ A;  3BSX A;  1M5N S;  1M1E A;  4UAE A;  3TPM A;  1EE4 A;  4U5V A;  4QMJ A;  3WOY A;  3EA5 B;  1JDH A;  4MFU A;  2NYM B;  4U5L A;  5K9S A;  5CL4 A;  1Z2C B;  3UL1 B;  4BQK A;  3NMX A;  4I2W A;  2H4M A;  3PST A;  2JAK A;  2BKU B;  3QGB A;  3GB8 A;  2NPP B;  3JXZ A;  1W63 A;  3OPB A;  4UWX A;  4IMJ A;  4UQI B;  3ZIK A;  3VLE A;  5SW9 A;  4UAF B;  4OO6 A;  5CL3 A;  2VGL B;  2QMR A;  4EVP A;  2F31 A;  3K61 A;  1HO8 A;  2DB0 A;  5KL8 A;  4BPL A;  5H2W A;  4CRV B;  1F59 A;  4U5S A;  1TE4 A;  3GVO A;  2C1T A;  4LAC A;  2XOA A;  5SVZ A;  5KLT B;  2JKT A;  3BX3 A;  3C2G A;  1Y2A C;  3V74 A;  3WOZ A;  4QMH A;  1UPL A;  3PSP A;  3T7U A;  4D4E A;  3Q0L A;  2XA7 A;  4U5U A;  5KLR B;  5CLB A;  3OUX A;  4CRU B;  4EVT A;  5D5K C;  5CL9 A;  1M8W A;  3BX2 A;  5B56 A;  1W9C A;  2NYM A;  2BCT A;  1U6G C;  3EG5 B;  3ODS A;  3GVT A;  3QG9 A;  3Q0O A;  4A0C A;  4HTV A;  3BCT A;  2P8Q A;  1G3J A;  3OQS A;  3UKZ B;  3L3Q A;  5CLC A;  5BZU A;  1EE5 A;  3QGC A;  2Z5K A;  1QGR A;  3O4X A;  2W3C A;  2OT8 A;  2JKT B;  3OBV A;  4I0Y A;  3ZHP A;  5CL7 A;  2QK1 A;  3O2T A;  3FEY C;  4UQI A;  2Z6G A;  2X19 B;  3Q0Q A;  2VGL A;  2Z6H A;  3BVS A;  4MZ5 E;  4YI0 C;  5BZV A;  4CBA A;  4V3Q A;  1OYZ A;  3GNI A;  2FV2 A;  1XM9 A;  1WA5 C;  3K5Z A;  4K6J A;  5J3V A;  3UL0 B;  3LWW A;  3K4E A;  3FEX C;  3K7V A;  4QMI A;  3K62 A;  2IW3 A;  4L4I A;  3ZKV A;  1T08 A;  4CT7 B;  3Q5U A;  4YK6 A;  4BA3 A;  2IAE B;  4CT6 B;  2YNR A;  1M8Y A;  1PJM B;  5DN7 A;  1IQ1 C;  3VLF A;  3JX7 A;  1UN0 A;  4EV9 A;  4P6Z B;  4G3A A;  4L7M A;  4PLR A;  2PKG A;  3ZIP A;  4I5N A;  5EKF A;  1QGK A;  5KLA A;  2JDQ A;  4I5L A;  4RXH B;  3LTM A;  4EVA A;  3K49 A;  4B8J A;  3ZIN A;  1IB2 A;  3L3F X;  2C1M A;  3ND2 A;  3TPO A;  4I8M A;  3V71 A;  4FZF A;  4U2X D;  5CL5 A;  4PLS A;  4RV1 A;  2NYL B;  4UAD A;  4I2S A;  4R11 A;  4I7I A;  4A3V A;  4U54 A;  3GS3 A;  3K7W A;  5K6S A;  2PF4 A;  1UKL A;  4H3K A;  2OF3 A;  3AU3 A;  4R0Z A;  5CLE A;  4DB6 A;  3RZ9 A;  1V18 A;  4I3N A;  3DAD A;  3TX7 A;  3Q0M A;  3ZIO A;  1Q1S C;  4DZS A;  3WYF C;  4ADY A;  3UKY B;  5JJA A;  4P6Z G;  2IE4 A;  4FFB C;  4B8O A;  4DJS A;  1O6O A;  4A3T A;  5CLD A;  3BSB A;  3QML C;  4H3H A;  4MZ6 E;  5BZ5 A;  1XQR A;  4EV8 A;  1M8Z A;  4GMO A;  3KND A;  4DBA A;  2IAE A;  3JXY A;  3VE6 A;  1QBK B;  5E6Q B;  4TNM A;  2Q5D A;  4B8P A;  3ZIL A;  1BK6 A;  4I1E A;  3K5Y A;  3NOW A;  1LUJ A;  4I6I A;  4I37 A;  1UPK A;  5H2X A;  2Z5N A;  1IAL A;  4V3R A;  3Q0P A;  4U5O A;  4FZD A;  3WPT A;  4YJL A;  1M8X A;  2IE3 A;  3UKX B;  4I96 A;  4IMI A;  4I2Z A;  4V3O A;  1EJL I;  1JPP A;  2X1G F;  3LTJ A;  2NYL A;  3C5W A;  3L6Y A;  5CL8 A;  4Y5J A;  3V6Y A;  2Z5M A;  4HM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...