3LTMA

Structure of a new family of artificial alpha helicoidal repeat proteins (alpha-rep) based on thermostable heat-like repeats
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
185
structure length
185
Chain Sequence
ADPEKVEMYIKNLQDDSYYVRRAAAYALGKIGDERAVEPLIKALKDEDAWVRRAAADALGQIGDERAVEPLIKALKDEDGWVRQSAAVALGQIGDERAVEPLIKALKDEDWFVRIAAAFALGEIGDERAVEPLIKALKDEDGWVRQSAADALGEIGGERVRAAMEKLAETGTGFARKVAVNYLET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-Rep4
publication title Design, production and molecular structure of a new family of artificial alpha-helicoidal repeat proteins ( alpha Rep) based on thermostable HEAT-like repeats
pubmed doi rcsb
source organism Synthetic
molecule tags Protein binding
total genus 69
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 3ltmA00
2FV2A 3GVTA 5SVZA 3A6PA 3TX7A 1WA5C 3K4EA 2BCTA 2X1GF 3Q5UA 4TNMA 5BZUA 1QZ7A 4H3HA 4DB9A 3ND2A 4RZPA 1PJNB 5HUWC 3DW8A 4IMIA 4P6ZB 2JKTA 3K61A 3Q0NA 3L6YA 3VWAA 3UKWB 3C2HA 3V71A 4CBAA 1U6GC 5SW9A 3NOWA 2IE3A 4FZDA 1BK5A 4RV1A 3KNDA 1JPPA 2Z5NA 4HTVA 1O6OA 3C2GA 4ADYA 3FGAA 4U5LA 1TH1A 4U5VA 2OT8A 4QMIA 1Q1SC 2Z5KA 4L7MA 4CRVB 4CB8A 2Z5MA 4FFBC 3K7WA 3BTRC 1V18A 3WOZA 4QMHA 2PF4A 2P8QA 4V3QA 4LACA 5K6SA 4H3KA 3WYFC 4HNMA 3BSXA 4NEEA 2Z5JA 2W3CA 4EV9A 2C1MA 2NYLB 3QMLC 4UADA 3Q0RA 4CRUB 1UPLA 4FQ3A 4A0CA 3TJ3A 3QGCA 3UL1B 4JLQA 5DN7A 3Q0SA 4XZRB 3K5QA 1M1EA 3PSTA 4GMNA 2IWHA 4FZAA 3RZ9A 4HM9A 4E4VA 3IBVA 2DB0A 3UKZB 4K92A 2QK1A 3OUXA 1W9CA 4NZWA 4JW2B 1I7WA 4YJEA 5AEIA 3TT9A 5KL8A 2XA7B 4U54A 5JJAA 3VE6A 4I2ZA 4V3OA 5BZ1A 2BAPA 4QMJA 3LTJA 4G3AA 3O4XA 3OUWA 4YGXA 2BKUB 4KZGA 5CTTA 4DB6A 4B8JA 4D4EA 1IQ1C 3ZIQA 1LUJA 4R10A 2QNAA 1UPKA 5J3VA 3TPMA 4OIHA 4GMOA 1B3UA 3K5ZA 1UN0A 1Q1TC 4DZSA 3OPBA 5K9SA 2XA7A 4B8PA 2IAEB 1EJYI 3ZHPA 4U5NA 2Q5DA 2NPPA 3IFQA 3GB8A 3K7VA 4PLRA 1BK6A 5BZVA 3OBVA 4OO6A 2JAKA 1OYZA 4B8OA 3T7UA 5B56A 1Z2CB 4HXTA 3TPOA 4UAFB 1XQRA 3GS3A 2H4MA 3GAEA 4U5UA 3UKYB 1PJMB 2JKRB 2PKGA 5EWPA 4YK6A 2JDQA 3K62A 1QGKA 3ZIRA 4CT7B 1QBKB 4FZFA 3Q0LA 3BCTA 3Q0QA 3Q0MA 3Q0PA 3TJZB 4EVAA 2VGLB 4CB9A 3NMZA 1T08A 2Z6HA 4U3JC 1F59A 1M8YA 3ZIPA 4Y5JA 5HUYC 5KLAA 1M8WA 3WOYA 1G3JA 2YJYA 3OQSA 2BNXA 1XQSA 4R11A 1JPWA 4UWXA 1M5NS 4MFVA 2QMRA 3QG9A 3W3UA 3ODRA 3FEXC 2X19B 1JDHA 2NYLA 4DBAA 3UVUA 4I5LA 2C1TA 3EG5B 4I5NA 3GVOA 1WA5B 5D5KC 3BSBA 2GL7A 2VGLA 1IB2A 2Z6GA 3L3FX 1I7XA 3DADA 3V74A 3EBBA 3NMXA 3O2QA 3L3QA 4U5SA 4WV6A 4D49A 4U58A 5EKGA 4BQKA 3FEYC 3QGBA 1UKLA 4I2WA 3ODSA 4CV5B 2F31A 1IBRB 3FGAB 3Q0OA 5BZ5A 3ZINA 1M8XA 5KL1A 4ZDUA 2YNSA 3LWWA 2WTKA 3ZIOA 4RXHB 4IMJA 4UAEA 2YNRA 3NMWA 5HHGE 5BYMA 2IW3A 2NYMB 3UKXB 5H2WA 3C5WA 3BX3A 1GCJA 3EA5B 5KLRB 1EE4A 4DVGB 4R0ZA 2IE4A 5LSWA 4EVPA 5FC8E 1XM9A 4PLQA 4YJLA 4YI0C 2Z5OA 4EVTA 3ZKVA 5E6QB 2IX3A 1HO8A 3BWTA 3RZXA 4CT6B 4EV8A 2IAEA 5EKFA 4V3RA 5KLTB 4FDDA 5H2XA 2NYMA 4BA3A 4DJSA 1EE5A 3GNIA 4UQIB 2RU4B 1Y2AC 1W63B 4MFUA 4MZ6E 3K49A 4DB8A 1EJLI 2JKRA 3BX2A 4PVZA 1IALA 1LRVA 3K64A 4BPLA 3H3DX 1QGRA 4PLSA 3L6XA 3WPTA 3K5YA 3V6YA 4O27A 2JKTB 4P6ZG 3QHEA 3PSPA 4UQIA 3GQ2A 3AU3A 5SWFA 3UL0B 2QK2A 1O6PA 2RU4A 2OF3A 3LTMA 4B18A 1W63A 3O2SA 4U5OA 4K6JA 3GRLA 4MZ5E 3O2TA 1M8ZA 2NPPB
chains in the Genus database with same CATH superfamily
5CL7A 2FV2A 3GVTA 5SVZA 3JX7A 3A6PA 5CL6A 4JKQA 3TX7A 1WA5C 4I37A 3K4EA 2BCTA 2X1GF 3Q5UA 4TNMA 5BZUA 1QZ7A 4FP7A 4H3HA 4DB9A 3ND2A 4RZPA 1PJNB 3SL9A 5CL3A 5HUWC 3DW8A 4IMIA 4P6ZB 2JKTA 3K61A 3Q0NA 3L6YA 3VWAA 3UKWB 3C2HA 3V71A 3VLFA 4CBAA 1U6GC 5SW9A 3NOWA 2IE3A 4FZDA 1BK5A 4RV1A 3KNDA 1JPPA 2Z5NA 3ZILA 4HTVA 1O6OA 5CL5A 3C2GA 4ADYA 3FGAA 4U5LA 1TH1A 3VLEA 4U5VA 2OT8A 2XOAA 4QMIA 1Q1SC 2Z5KA 4L7MA 4CRVB 4CB8A 2Z5MA 5CLAA 4FFBC 3K7WA 3BTRC 1V18A 3WOZA 4QMHA 4I0YA 2PF4A 2P8QA 4V3QA 4LACA 5K6SA 3BVSA 4H3KA 1LSHA 4HNMA 3WYFC 3BSXA 4NEEA 5CLCA 2Z5JA 2W3CA 4EV9A 2C1MA 2NYLB 3QMLC 4UADA 3Q0RA 4CRUB 1UPLA 4FQ3A 4A0CA 4U2XD 3TJ3A 3QGCA 3UL1B 4JLQA 5DN7A 4I6IA 3Q0SA 4XZRB 3K5QA 1M1EA 3PSTA 4JW3C 4GMNA 2IWHA 4FZAA 3RZ9A 4HM9A 4E4VA 3IBVA 2DB0A 3UKZB 4K92A 2QK1A 3OUXA 1W9CA 4NZWA 4JW2B 1I7WA 4YJEA 5AEIA 5KUBA 3TT9A 5KL8A 2XA7B 4U54A 5JJAA 3VE6A 4I2ZA 4V3OA 5BZ1A 1N4KA 2BAPA 4QMJA 3LTJA 4G3AA 3O4XA 3OUWA 4YGXA 2BKUB 4KZGA 5CTTA 4DB6A 4B8JA 4D4EA 1IQ1C 3ZIQA 1LUJA 4R10A 2QNAA 1UPKA 4A3VA 3TPMA 5J3VA 4OIHA 4GMOA 1B3UA 3K5ZA 1UN0A 4JW2A 1Q1TC 4DZSA 3OPBA 5K9SA 2XA7A 4B8PA 2IAEB 1EJYI 3ZHPA 4A3TA 4U5NA 2Q5DA 2NPPA 3IFQA 3GB8A 3K7VA 4PLRA 1BK6A 5BZVA 3OBVA 4OO6A 2JAKA 1OYZA 1TE4A 4B8OA 3T7UA 5B56A 1Z2CB 4HXTA 3TPOA 4UAFB 1XQRA 3GS3A 2H4MA 3GAEA 4U5UA 3UKYB 1PJMB 2JKRB 2PKGA 5EWPA 4YK6A 2JDQA 3K62A 4I8MA 1QGKA 4I1EA 3ZIRA 4CT7B 1QBKB 4FZFA 3Q0LA 3BCTA 3Q0QA 3Q0MA 3Q0PA 3TJZB 4EVAA 2VGLB 4CB9A 3NMZA 1T08A 2Z6HA 4U3JC 1F59A 1M8YA 3ZIPA 3JXZA 4Y5JA 3JXYA 5HUYC 5KLAA 1M8WA 3WOYA 1G3JA 2YJYA 3OQSA 2BNXA 3UJ0A 1XQSA 4R11A 5CLEA 1JPWA 3UJ4A 4UWXA 1M5NS 3T8SA 4MFVA 2QMRA 3QG9A 3W3UA 3ODRA 3FEXC 2X19B 4L4HA 1JDHA 2NYLA 4DBAA 3UVUA 4I5LA 2C1TA 3EG5B 4I5NA 3GVOA 1WA5B 5D5KC 3BSBA 2GL7A 2VGLA 1IB2A 2Z6GA 3L3FX 1I7XA 3DADA 3V74A 3EBBA 3NMXA 3O2QA 3L3QA 4U5SA 4WV6A 4D49A 4I7IA 4U58A 5EKGA 4BQKA 3FEYC 3QGBA 1UKLA 4I2WA 3ODSA 4CV5B 2F31A 1IBRB 3FGAB 3Q0OA 5BZ5A 3ZINA 1M8XA 5KL1A 4ZDUA 2YNSA 3LWWA 2WTKA 4I3NA 3ZIOA 4RXHB 4IMJA 4UAEA 2YNRA 3NMWA 5HHGE 5BYMA 2IW3A 2NYMB 3UKXB 5H2WA 3C5WA 3SLAA 4I96A 3BX3A 1GCJA 3EA5B 5KLRB 1EE4A 4DVGB 4R0ZA 2IE4A 5LSWA 4EVPA 5FC8E 5CLBA 1XM9A 4PLQA 4YJLA 4YI0C 2Z5OA 5CL9A 4EVTA 3ZKVA 5E6QB 2IX3A 1HO8A 3BWTA 3RZXA 4CT6B 4EV8A 2IAEA 5EKFA 4V3RA 3ZIKA 3JY1A 5KLTB 4FDDA 5H2XA 2NYMA 4BA3A 4DJSA 1EE5A 3GNIA 4UQIB 5CL4A 2RU4B 1Y2AC 1W63B 4MFUA 4MZ6E 3K49A 4DB8A 1EJLI 2JKRA 3BX2A 4PVZA 1IALA 1LRVA 3K64A 3VLDA 5CL8A 4BPLA 3H3DX 1QGRA 5CLDA 4PLSA 3L6XA 3WPTA 3K5YA 3V6YA 4O27A 2JKTB 4P6ZG 3QHEA 3PSPA 4UQIA 3GQ2A 3AU3A 5SWFA 3UL0B 2QK2A 1O6PA 2RU4A 2OF3A 3LTMA 4B18A 4L4IA 1W63A 3O2SA 4U5OA 4K6JA 3GRLA 4MZ5E 3O2TA 1M8ZA 2NPPB 4I2SA
chains in the Genus database with same CATH topology
5CL7A 2FV2A 3GVTA 5SVZA 3JX7A 3A6PA 5CL6A 4JKQA 3TX7A 1WA5C 4I37A 3K4EA 2BCTA 2X1GF 3Q5UA 4TNMA 5BZUA 1QZ7A 4FP7A 4H3HA 4DB9A 3ND2A 4RZPA 1PJNB 3SL9A 5CL3A 5HUWC 3DW8A 4IMIA 4P6ZB 2JKTA 3K61A 3Q0NA 3L6YA 3VWAA 3UKWB 3C2HA 3V71A 3VLFA 4CBAA 1U6GC 5SW9A 3NOWA 2IE3A 4FZDA 1BK5A 4RV1A 3KNDA 1JPPA 2Z5NA 3ZILA 4HTVA 1O6OA 5CL5A 3C2GA 4ADYA 3FGAA 4U5LA 1TH1A 3VLEA 4U5VA 2OT8A 2XOAA 4QMIA 1Q1SC 2Z5KA 4L7MA 4CRVB 4CB8A 2Z5MA 5CLAA 4FFBC 3K7WA 3BTRC 1V18A 3WOZA 4QMHA 4I0YA 2PF4A 2P8QA 4V3QA 4LACA 5K6SA 3BVSA 4H3KA 3WYFC 4HNMA 3BSXA 4NEEA 5CLCA 2Z5JA 2W3CA 4EV9A 2C1MA 2NYLB 3QMLC 4UADA 3Q0RA 4CRUB 1UPLA 4FQ3A 4A0CA 4U2XD 3TJ3A 3QGCA 3UL1B 4JLQA 5DN7A 4I6IA 3Q0SA 4XZRB 3K5QA 1M1EA 3PSTA 4JW3C 4GMNA 2IWHA 4FZAA 3RZ9A 4HM9A 4E4VA 3IBVA 2DB0A 3UKZB 4K92A 2QK1A 3OUXA 1W9CA 4NZWA 4JW2B 1I7WA 4YJEA 5AEIA 5KUBA 3TT9A 5KL8A 2XA7B 4U54A 5JJAA 3VE6A 4I2ZA 4V3OA 5BZ1A 2BAPA 4QMJA 3LTJA 4G3AA 3O4XA 3OUWA 4YGXA 2BKUB 4KZGA 5CTTA 4DB6A 4B8JA 4D4EA 1IQ1C 3ZIQA 1LUJA 4R10A 2QNAA 1UPKA 4A3VA 3TPMA 5J3VA 4OIHA 4GMOA 1B3UA 3K5ZA 1UN0A 4JW2A 1Q1TC 4DZSA 3OPBA 5K9SA 2XA7A 4B8PA 2IAEB 1EJYI 3ZHPA 4A3TA 4U5NA 2Q5DA 2NPPA 3IFQA 3GB8A 3K7VA 4PLRA 1BK6A 5BZVA 3OBVA 4OO6A 2JAKA 1OYZA 1TE4A 4B8OA 3T7UA 5B56A 1Z2CB 4HXTA 3TPOA 4UAFB 1XQRA 3GS3A 2H4MA 3GAEA 4U5UA 3UKYB 1PJMB 2JKRB 2PKGA 5EWPA 4YK6A 2JDQA 3K62A 4I8MA 1QGKA 4I1EA 3ZIRA 4CT7B 1QBKB 4FZFA 3Q0LA 3BCTA 3Q0QA 3Q0MA 3Q0PA 3TJZB 4EVAA 2VGLB 4CB9A 3NMZA 1T08A 2Z6HA 4U3JC 1F59A 1M8YA 3ZIPA 3JXZA 4Y5JA 3JXYA 5HUYC 5KLAA 1M8WA 3WOYA 1G3JA 2YJYA 3OQSA 2BNXA 1XQSA 4R11A 5CLEA 1JPWA 4UWXA 1M5NS 4MFVA 2QMRA 3QG9A 3W3UA 3ODRA 3FEXC 2X19B 4L4HA 1JDHA 2NYLA 4DBAA 3UVUA 4I5LA 2C1TA 3EG5B 4I5NA 3GVOA 1WA5B 5D5KC 3BSBA 2GL7A 2VGLA 1IB2A 2Z6GA 3L3FX 1I7XA 3DADA 3V74A 3EBBA 3NMXA 3O2QA 3L3QA 4U5SA 4WV6A 4D49A 4I7IA 4U58A 5EKGA 4BQKA 3FEYC 3QGBA 1UKLA 4I2WA 3ODSA 4CV5B 2F31A 1IBRB 3FGAB 3Q0OA 5BZ5A 3ZINA 1M8XA 5KL1A 4ZDUA 2YNSA 3LWWA 2WTKA 4I3NA 3ZIOA 4RXHB 4IMJA 4UAEA 2YNRA 3NMWA 5HHGE 5BYMA 2IW3A 2NYMB 3UKXB 5H2WA 3C5WA 3SLAA 4I96A 3BX3A 1GCJA 3EA5B 5KLRB 1EE4A 4DVGB 4R0ZA 2IE4A 5LSWA 4EVPA 5FC8E 5CLBA 1XM9A 4PLQA 4YJLA 4YI0C 2Z5OA 5CL9A 4EVTA 3ZKVA 5E6QB 2IX3A 1HO8A 3BWTA 3RZXA 4CT6B 4EV8A 2IAEA 5EKFA 4V3RA 3ZIKA 3JY1A 5KLTB 4FDDA 5H2XA 2NYMA 4BA3A 4DJSA 1EE5A 3GNIA 4UQIB 5CL4A 2RU4B 1Y2AC 1W63B 4MFUA 4MZ6E 3K49A 4DB8A 1EJLI 2JKRA 3BX2A 4PVZA 1IALA 1LRVA 3K64A 3VLDA 5CL8A 4BPLA 3H3DX 1QGRA 5CLDA 4PLSA 3L6XA 3WPTA 3K5YA 3V6YA 4O27A 2JKTB 4P6ZG 3QHEA 3PSPA 4UQIA 3GQ2A 3AU3A 5SWFA 3UL0B 2QK2A 1O6PA 2RU4A 2OF3A 3LTMA 4B18A 4L4IA 1W63A 3O2SA 4U5OA 4K6JA 3GRLA 4MZ5E 3O2TA 1M8ZA 2NPPB 4I2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FV2 A;  3GVT A;  5SVZ A;  3A6P A;  3TX7 A;  1WA5 C;  3K4E A;  2BCT A;  2X1G F;  3Q5U A;  4TNM A;  5BZU A;  1QZ7 A;  4H3H A;  4DB9 A;  3ND2 A;  4RZP A;  1PJN B;  5HUW C;  3DW8 A;  4IMI A;  4P6Z B;  2JKT A;  3K61 A;  3Q0N A;  3L6Y A;  3VWA A;  3UKW B;  3C2H A;  3V71 A;  4CBA A;  1U6G C;  5SW9 A;  3NOW A;  2IE3 A;  4FZD A;  1BK5 A;  4RV1 A;  3KND A;  1JPP A;  2Z5N A;  4HTV A;  1O6O A;  3C2G A;  4ADY A;  3FGA A;  4U5L A;  1TH1 A;  4U5V A;  2OT8 A;  4QMI A;  1Q1S C;  2Z5K A;  4L7M A;  4CRV B;  4CB8 A;  2Z5M A;  4FFB C;  3K7W A;  3BTR C;  1V18 A;  3WOZ A;  4QMH A;  2PF4 A;  2P8Q A;  4V3Q A;  4LAC A;  5K6S A;  4H3K A;  3WYF C;  4HNM A;  3BSX A;  4NEE A;  2Z5J A;  2W3C A;  4EV9 A;  2C1M A;  2NYL B;  3QML C;  4UAD A;  3Q0R A;  4CRU B;  1UPL A;  4FQ3 A;  4A0C A;  3TJ3 A;  3QGC A;  3UL1 B;  4JLQ A;  5DN7 A;  3Q0S A;  4XZR B;  3K5Q A;  1M1E A;  3PST A;  4GMN A;  2IWH A;  4FZA A;  3RZ9 A;  4HM9 A;  4E4V A;  3IBV A;  2DB0 A;  3UKZ B;  4K92 A;  2QK1 A;  3OUX A;  1W9C A;  4NZW A;  4JW2 B;  1I7W A;  4YJE A;  5AEI A;  3TT9 A;  5KL8 A;  2XA7 B;  4U54 A;  5JJA A;  3VE6 A;  4I2Z A;  4V3O A;  5BZ1 A;  2BAP A;  4QMJ A;  3LTJ A;  4G3A A;  3O4X A;  3OUW A;  4YGX A;  2BKU B;  4KZG A;  5CTT A;  4DB6 A;  4B8J A;  4D4E A;  1IQ1 C;  3ZIQ A;  1LUJ A;  4R10 A;  2QNA A;  1UPK A;  5J3V A;  3TPM A;  4OIH A;  4GMO A;  1B3U A;  3K5Z A;  1UN0 A;  1Q1T C;  4DZS A;  3OPB A;  5K9S A;  2XA7 A;  4B8P A;  2IAE B;  1EJY I;  3ZHP A;  4U5N A;  2Q5D A;  2NPP A;  3IFQ A;  3GB8 A;  3K7V A;  4PLR A;  1BK6 A;  5BZV A;  3OBV A;  4OO6 A;  2JAK A;  1OYZ A;  4B8O A;  3T7U A;  5B56 A;  1Z2C B;  4HXT A;  3TPO A;  4UAF B;  1XQR A;  3GS3 A;  2H4M A;  3GAE A;  4U5U A;  3UKY B;  1PJM B;  2JKR B;  2PKG A;  5EWP A;  4YK6 A;  2JDQ A;  3K62 A;  1QGK A;  3ZIR A;  4CT7 B;  1QBK B;  4FZF A;  3Q0L A;  3BCT A;  3Q0Q A;  3Q0M A;  3Q0P A;  3TJZ B;  4EVA A;  2VGL B;  4CB9 A;  3NMZ A;  1T08 A;  2Z6H A;  4U3J C;  1F59 A;  1M8Y A;  3ZIP A;  4Y5J A;  5HUY C;  5KLA A;  1M8W A;  3WOY A;  1G3J A;  2YJY A;  3OQS A;  2BNX A;  1XQS A;  4R11 A;  1JPW A;  4UWX A;  1M5N S;  4MFV A;  2QMR A;  3QG9 A;  3W3U A;  3ODR A;  3FEX C;  2X19 B;  1JDH A;  2NYL A;  4DBA A;  3UVU A;  4I5L A;  2C1T A;  3EG5 B;  4I5N A;  3GVO A;  1WA5 B;  5D5K C;  3BSB A;  2GL7 A;  2VGL A;  1IB2 A;  2Z6G A;  3L3F X;  1I7X A;  3DAD A;  3V74 A;  3EBB A;  3NMX A;  3O2Q A;  3L3Q A;  4U5S A;  4WV6 A;  4D49 A;  4U58 A;  5EKG A;  4BQK A;  3FEY C;  3QGB A;  1UKL A;  4I2W A;  3ODS A;  4CV5 B;  2F31 A;  1IBR B;  3FGA B;  3Q0O A;  5BZ5 A;  3ZIN A;  1M8X A;  5KL1 A;  4ZDU A;  2YNS A;  3LWW A;  2WTK A;  3ZIO A;  4RXH B;  4IMJ A;  4UAE A;  2YNR A;  3NMW A;  5HHG E;  5BYM A;  2IW3 A;  2NYM B;  3UKX B;  5H2W A;  3C5W A;  3BX3 A;  1GCJ A;  3EA5 B;  5KLR B;  1EE4 A;  4DVG B;  4R0Z A;  2IE4 A;  5LSW A;  4EVP A;  5FC8 E;  1XM9 A;  4PLQ A;  4YJL A;  4YI0 C;  2Z5O A;  4EVT A;  3ZKV A;  5E6Q B;  2IX3 A;  1HO8 A;  3BWT A;  3RZX A;  4CT6 B;  4EV8 A;  2IAE A;  5EKF A;  4V3R A;  5KLT B;  4FDD A;  5H2X A;  2NYM A;  4BA3 A;  4DJS A;  1EE5 A;  3GNI A;  4UQI B;  2RU4 B;  1Y2A C;  1W63 B;  4MFU A;  4MZ6 E;  3K49 A;  4DB8 A;  1EJL I;  2JKR A;  3BX2 A;  4PVZ A;  1IAL A;  1LRV A;  3K64 A;  4BPL A;  3H3D X;  1QGR A;  4PLS A;  3L6X A;  3WPT A;  3K5Y A;  3V6Y A;  4O27 A;  2JKT B;  4P6Z G;  3QHE A;  3PSP A;  4UQI A;  3GQ2 A;  3AU3 A;  5SWF A;  3UL0 B;  2QK2 A;  1O6P A;  2RU4 A;  2OF3 A;  3LTM A;  4B18 A;  1W63 A;  3O2S A;  4U5O A;  4K6J A;  3GRL A;  4MZ5 E;  3O2T A;  1M8Z A;  2NPP B; 
#chains in the Genus database with same CATH topology
 5CL7 A;  2FV2 A;  3GVT A;  5SVZ A;  3JX7 A;  3A6P A;  5CL6 A;  4JKQ A;  3TX7 A;  1WA5 C;  4I37 A;  3K4E A;  2BCT A;  2X1G F;  3Q5U A;  4TNM A;  5BZU A;  1QZ7 A;  4FP7 A;  4H3H A;  4DB9 A;  3ND2 A;  4RZP A;  1PJN B;  3SL9 A;  5CL3 A;  5HUW C;  3DW8 A;  4IMI A;  4P6Z B;  2JKT A;  3K61 A;  3Q0N A;  3L6Y A;  3VWA A;  3UKW B;  3C2H A;  3V71 A;  3VLF A;  4CBA A;  1U6G C;  5SW9 A;  3NOW A;  2IE3 A;  4FZD A;  1BK5 A;  4RV1 A;  3KND A;  1JPP A;  2Z5N A;  3ZIL A;  4HTV A;  1O6O A;  5CL5 A;  3C2G A;  4ADY A;  3FGA A;  4U5L A;  1TH1 A;  3VLE A;  4U5V A;  2OT8 A;  2XOA A;  4QMI A;  1Q1S C;  2Z5K A;  4L7M A;  4CRV B;  4CB8 A;  2Z5M A;  5CLA A;  4FFB C;  3K7W A;  3BTR C;  1V18 A;  3WOZ A;  4QMH A;  4I0Y A;  2PF4 A;  2P8Q A;  4V3Q A;  4LAC A;  5K6S A;  3BVS A;  4H3K A;  1LSH A;  4HNM A;  3WYF C;  3BSX A;  4NEE A;  5CLC A;  2Z5J A;  2W3C A;  4EV9 A;  2C1M A;  2NYL B;  3QML C;  4UAD A;  3Q0R A;  4CRU B;  1UPL A;  4FQ3 A;  4A0C A;  4U2X D;  3TJ3 A;  3QGC A;  3UL1 B;  4JLQ A;  5DN7 A;  4I6I A;  3Q0S A;  4XZR B;  3K5Q A;  1M1E A;  3PST A;  4JW3 C;  4GMN A;  2IWH A;  4FZA A;  3RZ9 A;  4HM9 A;  4E4V A;  3IBV A;  2DB0 A;  3UKZ B;  4K92 A;  2QK1 A;  3OUX A;  1W9C A;  4NZW A;  4JW2 B;  1I7W A;  4YJE A;  5AEI A;  5KUB A;  3TT9 A;  5KL8 A;  2XA7 B;  4U54 A;  5JJA A;  3VE6 A;  4I2Z A;  4V3O A;  5BZ1 A;  1N4K A;  2BAP A;  4QMJ A;  3LTJ A;  4G3A A;  3O4X A;  3OUW A;  4YGX A;  2BKU B;  4KZG A;  5CTT A;  4DB6 A;  4B8J A;  4D4E A;  1IQ1 C;  3ZIQ A;  1LUJ A;  4R10 A;  2QNA A;  1UPK A;  4A3V A;  3TPM A;  5J3V A;  4OIH A;  4GMO A;  1B3U A;  3K5Z A;  1UN0 A;  4JW2 A;  1Q1T C;  4DZS A;  3OPB A;  5K9S A;  2XA7 A;  4B8P A;  2IAE B;  1EJY I;  3ZHP A;  4A3T A;  4U5N A;  2Q5D A;  2NPP A;  3IFQ A;  3GB8 A;  3K7V A;  4PLR A;  1BK6 A;  5BZV A;  3OBV A;  4OO6 A;  2JAK A;  1OYZ A;  1TE4 A;  4B8O A;  3T7U A;  5B56 A;  1Z2C B;  4HXT A;  3TPO A;  4UAF B;  1XQR A;  3GS3 A;  2H4M A;  3GAE A;  4U5U A;  3UKY B;  1PJM B;  2JKR B;  2PKG A;  5EWP A;  4YK6 A;  2JDQ A;  3K62 A;  4I8M A;  1QGK A;  4I1E A;  3ZIR A;  4CT7 B;  1QBK B;  4FZF A;  3Q0L A;  3BCT A;  3Q0Q A;  3Q0M A;  3Q0P A;  3TJZ B;  4EVA A;  2VGL B;  4CB9 A;  3NMZ A;  1T08 A;  2Z6H A;  4U3J C;  1F59 A;  1M8Y A;  3ZIP A;  3JXZ A;  4Y5J A;  3JXY A;  5HUY C;  5KLA A;  1M8W A;  3WOY A;  1G3J A;  2YJY A;  3OQS A;  2BNX A;  3UJ0 A;  1XQS A;  4R11 A;  5CLE A;  1JPW A;  3UJ4 A;  4UWX A;  1M5N S;  3T8S A;  4MFV A;  2QMR A;  3QG9 A;  3W3U A;  3ODR A;  3FEX C;  2X19 B;  4L4H A;  1JDH A;  2NYL A;  4DBA A;  3UVU A;  4I5L A;  2C1T A;  3EG5 B;  4I5N A;  3GVO A;  1WA5 B;  5D5K C;  3BSB A;  2GL7 A;  2VGL A;  1IB2 A;  2Z6G A;  3L3F X;  1I7X A;  3DAD A;  3V74 A;  3EBB A;  3NMX A;  3O2Q A;  3L3Q A;  4U5S A;  4WV6 A;  4D49 A;  4I7I A;  4U58 A;  5EKG A;  4BQK A;  3FEY C;  3QGB A;  1UKL A;  4I2W A;  3ODS A;  4CV5 B;  2F31 A;  1IBR B;  3FGA B;  3Q0O A;  5BZ5 A;  3ZIN A;  1M8X A;  5KL1 A;  4ZDU A;  2YNS A;  3LWW A;  2WTK A;  4I3N A;  3ZIO A;  4RXH B;  4IMJ A;  4UAE A;  2YNR A;  3NMW A;  5HHG E;  5BYM A;  2IW3 A;  2NYM B;  3UKX B;  5H2W A;  3C5W A;  3SLA A;  4I96 A;  3BX3 A;  1GCJ A;  3EA5 B;  5KLR B;  1EE4 A;  4DVG B;  4R0Z A;  2IE4 A;  5LSW A;  4EVP A;  5FC8 E;  5CLB A;  1XM9 A;  4PLQ A;  4YJL A;  4YI0 C;  2Z5O A;  5CL9 A;  4EVT A;  3ZKV A;  5E6Q B;  2IX3 A;  1HO8 A;  3BWT A;  3RZX A;  4CT6 B;  4EV8 A;  2IAE A;  5EKF A;  4V3R A;  3ZIK A;  3JY1 A;  5KLT B;  4FDD A;  5H2X A;  2NYM A;  4BA3 A;  4DJS A;  1EE5 A;  3GNI A;  4UQI B;  5CL4 A;  2RU4 B;  1Y2A C;  1W63 B;  4MFU A;  4MZ6 E;  3K49 A;  4DB8 A;  1EJL I;  2JKR A;  3BX2 A;  4PVZ A;  1IAL A;  1LRV A;  3K64 A;  3VLD A;  5CL8 A;  4BPL A;  3H3D X;  1QGR A;  5CLD A;  4PLS A;  3L6X A;  3WPT A;  3K5Y A;  3V6Y A;  4O27 A;  2JKT B;  4P6Z G;  3QHE A;  3PSP A;  4UQI A;  3GQ2 A;  3AU3 A;  5SWF A;  3UL0 B;  2QK2 A;  1O6P A;  2RU4 A;  2OF3 A;  3LTM A;  4B18 A;  4L4I A;  1W63 A;  3O2S A;  4U5O A;  4K6J A;  3GRL A;  4MZ5 E;  3O2T A;  1M8Z A;  2NPP B;  4I2S A; 
#chains in the Genus database with same CATH homology
 5CL7 A;  2FV2 A;  3GVT A;  5SVZ A;  3JX7 A;  3A6P A;  5CL6 A;  4JKQ A;  3TX7 A;  1WA5 C;  4I37 A;  3K4E A;  2BCT A;  2X1G F;  3Q5U A;  4TNM A;  5BZU A;  1QZ7 A;  4FP7 A;  4H3H A;  4DB9 A;  3ND2 A;  4RZP A;  1PJN B;  3SL9 A;  5CL3 A;  5HUW C;  3DW8 A;  4IMI A;  4P6Z B;  2JKT A;  3K61 A;  3Q0N A;  3L6Y A;  3VWA A;  3UKW B;  3C2H A;  3V71 A;  3VLF A;  4CBA A;  1U6G C;  5SW9 A;  3NOW A;  2IE3 A;  4FZD A;  1BK5 A;  4RV1 A;  3KND A;  1JPP A;  2Z5N A;  3ZIL A;  4HTV A;  1O6O A;  5CL5 A;  3C2G A;  4ADY A;  3FGA A;  4U5L A;  1TH1 A;  3VLE A;  4U5V A;  2OT8 A;  2XOA A;  4QMI A;  1Q1S C;  2Z5K A;  4L7M A;  4CRV B;  4CB8 A;  2Z5M A;  5CLA A;  4FFB C;  3K7W A;  3BTR C;  1V18 A;  3WOZ A;  4QMH A;  4I0Y A;  2PF4 A;  2P8Q A;  4V3Q A;  4LAC A;  5K6S A;  3BVS A;  4H3K A;  3WYF C;  4HNM A;  3BSX A;  4NEE A;  5CLC A;  2Z5J A;  2W3C A;  4EV9 A;  2C1M A;  2NYL B;  3QML C;  4UAD A;  3Q0R A;  4CRU B;  1UPL A;  4FQ3 A;  4A0C A;  4U2X D;  3TJ3 A;  3QGC A;  3UL1 B;  4JLQ A;  5DN7 A;  4I6I A;  3Q0S A;  4XZR B;  3K5Q A;  1M1E A;  3PST A;  4JW3 C;  4GMN A;  2IWH A;  4FZA A;  3RZ9 A;  4HM9 A;  4E4V A;  3IBV A;  2DB0 A;  3UKZ B;  4K92 A;  2QK1 A;  3OUX A;  1W9C A;  4NZW A;  4JW2 B;  1I7W A;  4YJE A;  5AEI A;  5KUB A;  3TT9 A;  5KL8 A;  2XA7 B;  4U54 A;  5JJA A;  3VE6 A;  4I2Z A;  4V3O A;  5BZ1 A;  2BAP A;  4QMJ A;  3LTJ A;  4G3A A;  3O4X A;  3OUW A;  4YGX A;  2BKU B;  4KZG A;  5CTT A;  4DB6 A;  4B8J A;  4D4E A;  1IQ1 C;  3ZIQ A;  1LUJ A;  4R10 A;  2QNA A;  1UPK A;  4A3V A;  3TPM A;  5J3V A;  4OIH A;  4GMO A;  1B3U A;  3K5Z A;  1UN0 A;  4JW2 A;  1Q1T C;  4DZS A;  3OPB A;  5K9S A;  2XA7 A;  4B8P A;  2IAE B;  1EJY I;  3ZHP A;  4A3T A;  4U5N A;  2Q5D A;  2NPP A;  3IFQ A;  3GB8 A;  3K7V A;  4PLR A;  1BK6 A;  5BZV A;  3OBV A;  4OO6 A;  2JAK A;  1OYZ A;  1TE4 A;  4B8O A;  3T7U A;  5B56 A;  1Z2C B;  4HXT A;  3TPO A;  4UAF B;  1XQR A;  3GS3 A;  2H4M A;  3GAE A;  4U5U A;  3UKY B;  1PJM B;  2JKR B;  2PKG A;  5EWP A;  4YK6 A;  2JDQ A;  3K62 A;  4I8M A;  1QGK A;  4I1E A;  3ZIR A;  4CT7 B;  1QBK B;  4FZF A;  3Q0L A;  3BCT A;  3Q0Q A;  3Q0M A;  3Q0P A;  3TJZ B;  4EVA A;  2VGL B;  4CB9 A;  3NMZ A;  1T08 A;  2Z6H A;  4U3J C;  1F59 A;  1M8Y A;  3ZIP A;  3JXZ A;  4Y5J A;  3JXY A;  5HUY C;  5KLA A;  1M8W A;  3WOY A;  1G3J A;  2YJY A;  3OQS A;  2BNX A;  1XQS A;  4R11 A;  5CLE A;  1JPW A;  4UWX A;  1M5N S;  4MFV A;  2QMR A;  3QG9 A;  3W3U A;  3ODR A;  3FEX C;  2X19 B;  4L4H A;  1JDH A;  2NYL A;  4DBA A;  3UVU A;  4I5L A;  2C1T A;  3EG5 B;  4I5N A;  3GVO A;  1WA5 B;  5D5K C;  3BSB A;  2GL7 A;  2VGL A;  1IB2 A;  2Z6G A;  3L3F X;  1I7X A;  3DAD A;  3V74 A;  3EBB A;  3NMX A;  3O2Q A;  3L3Q A;  4U5S A;  4WV6 A;  4D49 A;  4I7I A;  4U58 A;  5EKG A;  4BQK A;  3FEY C;  3QGB A;  1UKL A;  4I2W A;  3ODS A;  4CV5 B;  2F31 A;  1IBR B;  3FGA B;  3Q0O A;  5BZ5 A;  3ZIN A;  1M8X A;  5KL1 A;  4ZDU A;  2YNS A;  3LWW A;  2WTK A;  4I3N A;  3ZIO A;  4RXH B;  4IMJ A;  4UAE A;  2YNR A;  3NMW A;  5HHG E;  5BYM A;  2IW3 A;  2NYM B;  3UKX B;  5H2W A;  3C5W A;  3SLA A;  4I96 A;  3BX3 A;  1GCJ A;  3EA5 B;  5KLR B;  1EE4 A;  4DVG B;  4R0Z A;  2IE4 A;  5LSW A;  4EVP A;  5FC8 E;  5CLB A;  1XM9 A;  4PLQ A;  4YJL A;  4YI0 C;  2Z5O A;  5CL9 A;  4EVT A;  3ZKV A;  5E6Q B;  2IX3 A;  1HO8 A;  3BWT A;  3RZX A;  4CT6 B;  4EV8 A;  2IAE A;  5EKF A;  4V3R A;  3ZIK A;  3JY1 A;  5KLT B;  4FDD A;  5H2X A;  2NYM A;  4BA3 A;  4DJS A;  1EE5 A;  3GNI A;  4UQI B;  5CL4 A;  2RU4 B;  1Y2A C;  1W63 B;  4MFU A;  4MZ6 E;  3K49 A;  4DB8 A;  1EJL I;  2JKR A;  3BX2 A;  4PVZ A;  1IAL A;  1LRV A;  3K64 A;  3VLD A;  5CL8 A;  4BPL A;  3H3D X;  1QGR A;  5CLD A;  4PLS A;  3L6X A;  3WPT A;  3K5Y A;  3V6Y A;  4O27 A;  2JKT B;  4P6Z G;  3QHE A;  3PSP A;  4UQI A;  3GQ2 A;  3AU3 A;  5SWF A;  3UL0 B;  2QK2 A;  1O6P A;  2RU4 A;  2OF3 A;  3LTM A;  4B18 A;  4L4I A;  1W63 A;  3O2S A;  4U5O A;  4K6J A;  3GRL A;  4MZ5 E;  3O2T A;  1M8Z A;  2NPP B;  4I2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...