3LTMA

Structure of a new family of artificial alpha helicoidal repeat proteins (alpha-rep) based on thermostable heat-like repeats
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
185
structure length
185
Chain Sequence
ADPEKVEMYIKNLQDDSYYVRRAAAYALGKIGDERAVEPLIKALKDEDAWVRRAAADALGQIGDERAVEPLIKALKDEDGWVRQSAAVALGQIGDERAVEPLIKALKDEDWFVRIAAAFALGEIGDERAVEPLIKALKDEDGWVRQSAADALGEIGGERVRAAMEKLAETGTGFARKVAVNYLET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Alpha-Rep4
publication title Design, production and molecular structure of a new family of artificial alpha-helicoidal repeat proteins ( alpha Rep) based on thermostable HEAT-like repeats
pubmed doi rcsb
source organism Synthetic
total genus 69
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 3ltmA00
3WPTA 1F59A 5AEIA 4MZ6E 4MZ5E 4GMOA 5HUWC 3UVUA 2H4MA 3VWAA 1I7XA 4E4VA 4V3RA 4RZPA 3L3FX 3EBBA 3WOYA 4H3HA 4U5SA 3BCTA 4D49A 1I7WA 2VGLB 3NOWA 3C2HA 3FGAA 4OIHA 4D4EA 4ADYA 1M5NS 2NPPA 4JLQA 3K5YA 5FC8E 4YJEA 4IMIA 3FEYC 3UKYB 3UKWB 1BK5A 4DBAA 3K49A 5KL1A 3OPBA 2BAPA 3PSTA 4U5VA 5HUYC 4L7MA 3K4EA 4I2WA 1XQSA 4P6ZG 2Z6GA 3GVOA 1O6OA 4U58A 3AU3A 3ND2A 3K62A 5EKGA 3K7WA 2JKTA 4B8PA 4EV8A 2XA7A 5HHGE 5SW9A 5SWFA 2YNRA 4HTVA 4CV5B 1JDHA 2JKRA 3L3QA 1W9CA 3OBVA 2RU4B 2Z5JA 4B8OA 2QNAA 3ODRA 5K6SA 3GQ2A 4DB8A 3IBVA 4ZDUA 3BSXA 1T08A 4I5LA 3ZHPA 3BTRC 3OUWA 3TJZB 4GMNA 3GB8A 3DW8A 5DN7A 4I2ZA 4O27A 4YJLA 3A6PA 3O2SA 1XM9A 4I5NA 3TJ3A 3VE6A 3K5QA 3OUXA 2QK1A 3UKXB 2Z5MA 1IB2A 4K92A 3ZIOA 3C2GA 2IWHA 2JAKA 2IE3A 2PKGA 1QGKA 1HO8A 3DADA 4RV1A 5J3VA 4U5UA 1G3JA 4IMJA 5CTTA 3TX7A 4PVZA 3ZKVA 4CT7B 3V71A 1BK6A 1W63B 4DB9A 2IW3A 5BZ5A 4FDDA 2OF3A 2Z5KA 5H2XA 2BKUB 1IALA 1LRVA 3TT9A 1M8WA 3GNIA 4XZRB 4UQIA 1PJNB 4RXHB 1TH1A 3QHEA 3TPMA 2RU4A 2NYLA 4UAFB 1EJYI 4QMHA 2C1TA 4BPLA 4CB9A 2P8QA 2NYMA 2X1GF 3O2TA 4HNMA 3UKZB 4WV6A 3BWTA 3QGCA 3L6XA 1M8YA 1U6GC 4LACA 1V18A 4Y5JA 1Z2CB 1JPWA 4EVAA 4K6JA 4PLRA 3LTMA 4G3AA 2Z5NA 3WOZA 3GS3A 5JJAA 3V6YA 1EJLI 1UPLA 2IAEB 3Q0SA 5B56A 3O4XA 4QMJA 3OQSA 2C1MA 2BCTA 4NZWA 4CBAA 1Q1SC 5BZVA 3ZIPA 4U5LA 3FEXC 2DB0A 3Q0MA 3UL1B 2W3CA 4U54A 3NMWA 3O2QA 3Q5UA 4U5NA 3Q0PA 1W63A 1QGRA 2JKTB 3TPOA 1Q1TC 3K64A 3K7VA 2VGLA 4FZDA 1EE5A 1Y2AC 3T7UA 3BSBA 4UADA 4BQKA 4V3QA 4R0ZA 1B3UA 2PF4A 4B18A 5BYMA 5SVZA 4CB8A 3LWWA 5H2WA 1UPKA 2QK2A 3K5ZA 3WYFC 3QGBA 4YI0C 4R10A 4YGXA 2YNSA 4U5OA 1QZ7A 3W3UA 4A0CA 1OYZA 3BX3A 1IQ1C 1M1EA 5E6QB 5BZUA 3PSPA 3H3DX 1PJMB 4NEEA 1WA5B 3QG9A 4PLSA 4QMIA 4DB6A 1EE4A 3Q0LA 5KL8A 1JPPA 4OO6A 4EVPA 2X19B 2IAEA 5KLRB 4MFVA 1UN0A 2IX3A 3V74A 4KZGA 4UWXA 3NMXA 5K9SA 4YK6A 5EWPA 4V3OA 3L6YA 3ZIRA 5EKFA 1M8ZA 2Q5DA 2F31A 3NMZA 2FV2A 5KLTB 4HM9A 1QBKB 4BA3A 1M8XA 1LUJA 3ZIQA 5KLAA 3Q0QA 2JDQA 4MFUA 2Z6HA 1IBRB 5BZ1A 2OT8A 4FQ3A 4JW2B 4FZFA 3IFQA 2Z5OA 1XQRA 3FGAB 4DZSA 3RZXA 3ODSA 2NPPB 4TNMA 4HXTA 4UQIB 4U3JC 3RZ9A 1GCJA 4PLQA 3C5WA 3K61A 4P6ZB 3Q0OA 4EVTA 4DJSA 4CT6B 2BNXA 2NYLB 3QMLC 1UKLA 2WTKA 4CRVB 4FFBC 3Q0NA 4DVGB 3GRLA 2QMRA 2NYMB 4B8JA 5D5KC 3GVTA 3EA5B 3UL0B 3GAEA 2XA7B 3LTJA 3ZINA 1O6PA 4R11A 3KNDA 4UAEA 3Q0RA 2JKRB 4CRUB 3EG5B 2YJYA 4FZAA 3BX2A 5LSWA 4H3KA 1WA5C 2IE4A 2GL7A 4EV9A
chains in the Genus database with same CATH superfamily
3WPTA 1F59A 5AEIA 4MZ6E 4MZ5E 4GMOA 5HUWC 3UVUA 3UJ0A 2H4MA 3SL9A 3VWAA 1I7XA 3VLFA 4E4VA 4V3RA 4A3TA 4I6IA 4RZPA 5CLAA 3L3FX 3EBBA 3WOYA 4H3HA 4U5SA 3BCTA 4D49A 1I7WA 2VGLB 3NOWA 3C2HA 3FGAA 4OIHA 4D4EA 4ADYA 1M5NS 2NPPA 4JLQA 3K5YA 5FC8E 4YJEA 4IMIA 3FEYC 3UKYB 3UKWB 1BK5A 4DBAA 3K49A 5KL1A 3OPBA 2BAPA 3PSTA 4U5VA 4U2XD 5HUYC 4L7MA 3K4EA 4I2WA 1XQSA 4P6ZG 2Z6GA 3GVOA 1O6OA 4U58A 3AU3A 3ND2A 3K62A 5EKGA 3K7WA 2JKTA 4B8PA 4EV8A 2XA7A 5HHGE 5SW9A 5SWFA 2YNRA 4HTVA 4I1EA 4CV5B 1JDHA 2JKRA 3L3QA 1W9CA 3OBVA 2RU4B 2Z5JA 4B8OA 2QNAA 3ODRA 5CL5A 5CLBA 5K6SA 3GQ2A 4DB8A 3IBVA 4ZDUA 3BSXA 1T08A 4I5LA 3VLEA 3ZHPA 3BTRC 3OUWA 3TJZB 4GMNA 3GB8A 3DW8A 5DN7A 4I2ZA 4L4IA 4O27A 4YJLA 3A6PA 1LSHA 3O2SA 1XM9A 4I5NA 3TJ3A 3VE6A 3K5QA 3OUXA 3JY1A 2QK1A 3UKXB 5CLEA 2Z5MA 3JX7A 3T8SA 1IB2A 4K92A 3UJ4A 3ZIOA 4I8MA 3C2GA 2IWHA 5CLCA 2JAKA 2IE3A 2PKGA 1QGKA 1HO8A 3DADA 4RV1A 5J3VA 4U5UA 1G3JA 4IMJA 5CTTA 3TX7A 4PVZA 3ZKVA 4CT7B 3V71A 1BK6A 1W63B 4DB9A 2IW3A 5BZ5A 4FDDA 4I7IA 4JW2A 2OF3A 2Z5KA 5H2XA 2BKUB 1IALA 1TE4A 1LRVA 3TT9A 1M8WA 3GNIA 4XZRB 4UQIA 1PJNB 4RXHB 3JXYA 1TH1A 3QHEA 3TPMA 2RU4A 4I96A 2NYLA 4UAFB 1EJYI 4QMHA 2C1TA 5CL9A 4BPLA 4CB9A 2P8QA 2NYMA 2X1GF 3O2TA 4HNMA 4I0YA 3UKZB 4WV6A 3BWTA 3QGCA 3L6XA 1M8YA 1U6GC 4LACA 1V18A 4Y5JA 1Z2CB 1JPWA 4EVAA 4K6JA 4PLRA 3LTMA 4G3AA 2Z5NA 3WOZA 3GS3A 5JJAA 3V6YA 1EJLI 1UPLA 2IAEB 3Q0SA 5B56A 3O4XA 4QMJA 3OQSA 2C1MA 2BCTA 4NZWA 4CBAA 1Q1SC 5BZVA 5CL8A 3ZIPA 5CLDA 4L4HA 4U5LA 3FEXC 2DB0A 3Q0MA 3UL1B 5CL3A 2W3CA 4U54A 3NMWA 3O2QA 3Q5UA 4U5NA 3Q0PA 1W63A 1QGRA 2JKTB 4JKQA 3TPOA 1Q1TC 3K64A 3K7VA 2VGLA 4FZDA 1EE5A 1Y2AC 3T7UA 3BSBA 4UADA 4BQKA 4V3QA 4R0ZA 1B3UA 2PF4A 4FP7A 4B18A 5BYMA 5SVZA 4CB8A 3LWWA 5H2WA 1UPKA 2QK2A 5CL6A 3K5ZA 3WYFC 3QGBA 4YI0C 4R10A 4YGXA 2YNSA 4U5OA 1QZ7A 3VLDA 3W3UA 4A0CA 1OYZA 3ZIKA 3BX3A 1IQ1C 1M1EA 5E6QB 5BZUA 3PSPA 3ZILA 3H3DX 1PJMB 4NEEA 1WA5B 3QG9A 4PLSA 3BVSA 4QMIA 4DB6A 1EE4A 4I3NA 3Q0LA 5KL8A 1JPPA 4OO6A 4EVPA 2XOAA 2X19B 5KUBA 2IAEA 5KLRB 4MFVA 1UN0A 2IX3A 3V74A 4KZGA 4UWXA 3JXZA 3NMXA 5K9SA 5CL7A 4YK6A 5EWPA 4V3OA 3L6YA 3ZIRA 5EKFA 1M8ZA 2Q5DA 2F31A 3NMZA 2FV2A 5KLTB 4HM9A 1QBKB 4BA3A 1M8XA 1LUJA 4JW3C 3ZIQA 5KLAA 3Q0QA 2JDQA 4MFUA 2Z6HA 1N4KA 3SLAA 1IBRB 5BZ1A 2OT8A 4FQ3A 4JW2B 4FZFA 3IFQA 2Z5OA 1XQRA 3FGAB 4DZSA 3RZXA 3ODSA 2NPPB 4TNMA 4HXTA 4UQIB 4U3JC 3RZ9A 1GCJA 4PLQA 3C5WA 3K61A 4P6ZB 3Q0OA 4EVTA 4I2SA 4DJSA 4CT6B 2BNXA 2NYLB 3QMLC 1UKLA 2WTKA 4CRVB 4FFBC 4I37A 3Q0NA 4DVGB 3GRLA 4A3VA 2QMRA 2NYMB 4B8JA 5D5KC 3GVTA 3EA5B 3UL0B 3GAEA 2XA7B 3LTJA 3ZINA 1O6PA 4R11A 3KNDA 5CL4A 4UAEA 3Q0RA 2JKRB 4CRUB 3EG5B 2YJYA 4FZAA 3BX2A 5LSWA 4H3KA 1WA5C 2IE4A 2GL7A 4EV9A
chains in the Genus database with same CATH topology
3WPTA 1F59A 5AEIA 4MZ6E 4MZ5E 4GMOA 5HUWC 3UVUA 2H4MA 3SL9A 3VWAA 1I7XA 3VLFA 4E4VA 4V3RA 4A3TA 4I6IA 4RZPA 5CLAA 3L3FX 3EBBA 3WOYA 4H3HA 4U5SA 3BCTA 4D49A 1I7WA 2VGLB 3NOWA 3C2HA 3FGAA 4OIHA 4D4EA 4ADYA 1M5NS 2NPPA 4JLQA 3K5YA 5FC8E 4YJEA 4IMIA 3FEYC 3UKYB 3UKWB 1BK5A 4DBAA 3K49A 5KL1A 3OPBA 2BAPA 3PSTA 4U5VA 4U2XD 5HUYC 4L7MA 3K4EA 4I2WA 1XQSA 4P6ZG 2Z6GA 3GVOA 1O6OA 4U58A 3AU3A 3ND2A 3K62A 5EKGA 3K7WA 2JKTA 4B8PA 4EV8A 2XA7A 5HHGE 5SW9A 5SWFA 2YNRA 4HTVA 4I1EA 4CV5B 1JDHA 2JKRA 3L3QA 1W9CA 3OBVA 2RU4B 2Z5JA 4B8OA 2QNAA 3ODRA 5CL5A 5CLBA 5K6SA 3GQ2A 4DB8A 3IBVA 4ZDUA 3BSXA 1T08A 4I5LA 3VLEA 3ZHPA 3BTRC 3OUWA 3TJZB 4GMNA 3GB8A 3DW8A 5DN7A 4I2ZA 4L4IA 4O27A 4YJLA 3A6PA 3O2SA 1XM9A 4I5NA 3TJ3A 3VE6A 3K5QA 3OUXA 3JY1A 2QK1A 3UKXB 5CLEA 2Z5MA 3JX7A 1IB2A 4K92A 3ZIOA 4I8MA 3C2GA 2IWHA 5CLCA 2JAKA 2IE3A 2PKGA 1QGKA 1HO8A 3DADA 4RV1A 5J3VA 4U5UA 1G3JA 4IMJA 5CTTA 3TX7A 4PVZA 3ZKVA 4CT7B 3V71A 1BK6A 1W63B 4DB9A 2IW3A 5BZ5A 4FDDA 4I7IA 4JW2A 2OF3A 2Z5KA 5H2XA 2BKUB 1IALA 1TE4A 1LRVA 3TT9A 1M8WA 3GNIA 4XZRB 4UQIA 1PJNB 4RXHB 3JXYA 1TH1A 3QHEA 3TPMA 2RU4A 4I96A 2NYLA 4UAFB 1EJYI 4QMHA 2C1TA 5CL9A 4BPLA 4CB9A 2P8QA 2NYMA 2X1GF 3O2TA 4HNMA 4I0YA 3UKZB 4WV6A 3BWTA 3QGCA 3L6XA 1M8YA 1U6GC 4LACA 1V18A 4Y5JA 1Z2CB 1JPWA 4EVAA 4K6JA 4PLRA 3LTMA 4G3AA 2Z5NA 3WOZA 3GS3A 5JJAA 3V6YA 1EJLI 1UPLA 2IAEB 3Q0SA 5B56A 3O4XA 4QMJA 3OQSA 2C1MA 2BCTA 4NZWA 4CBAA 1Q1SC 5BZVA 5CL8A 3ZIPA 5CLDA 4L4HA 4U5LA 3FEXC 2DB0A 3Q0MA 3UL1B 5CL3A 2W3CA 4U54A 3NMWA 3O2QA 3Q5UA 4U5NA 3Q0PA 1W63A 1QGRA 2JKTB 4JKQA 3TPOA 1Q1TC 3K64A 3K7VA 2VGLA 4FZDA 1EE5A 1Y2AC 3T7UA 3BSBA 4UADA 4BQKA 4V3QA 4R0ZA 1B3UA 2PF4A 4FP7A 4B18A 5BYMA 5SVZA 4CB8A 3LWWA 5H2WA 1UPKA 2QK2A 5CL6A 3K5ZA 3WYFC 3QGBA 4YI0C 4R10A 4YGXA 2YNSA 4U5OA 1QZ7A 3VLDA 3W3UA 4A0CA 1OYZA 3ZIKA 3BX3A 1IQ1C 1M1EA 5E6QB 5BZUA 3PSPA 3ZILA 3H3DX 1PJMB 4NEEA 1WA5B 3QG9A 4PLSA 3BVSA 4QMIA 4DB6A 1EE4A 4I3NA 3Q0LA 5KL8A 1JPPA 4OO6A 4EVPA 2XOAA 2X19B 5KUBA 2IAEA 5KLRB 4MFVA 1UN0A 2IX3A 3V74A 4KZGA 4UWXA 3JXZA 3NMXA 5K9SA 5CL7A 4YK6A 5EWPA 4V3OA 3L6YA 3ZIRA 5EKFA 1M8ZA 2Q5DA 2F31A 3NMZA 2FV2A 5KLTB 4HM9A 1QBKB 4BA3A 1M8XA 1LUJA 4JW3C 3ZIQA 5KLAA 3Q0QA 2JDQA 4MFUA 2Z6HA 3SLAA 1IBRB 5BZ1A 2OT8A 4FQ3A 4JW2B 4FZFA 3IFQA 2Z5OA 1XQRA 3FGAB 4DZSA 3RZXA 3ODSA 2NPPB 4TNMA 4HXTA 4UQIB 4U3JC 3RZ9A 1GCJA 4PLQA 3C5WA 3K61A 4P6ZB 3Q0OA 4EVTA 4I2SA 4DJSA 4CT6B 2BNXA 2NYLB 3QMLC 1UKLA 2WTKA 4CRVB 4FFBC 4I37A 3Q0NA 4DVGB 3GRLA 4A3VA 2QMRA 2NYMB 4B8JA 5D5KC 3GVTA 3EA5B 3UL0B 3GAEA 2XA7B 3LTJA 3ZINA 1O6PA 4R11A 3KNDA 5CL4A 4UAEA 3Q0RA 2JKRB 4CRUB 3EG5B 2YJYA 4FZAA 3BX2A 5LSWA 4H3KA 1WA5C 2IE4A 2GL7A 4EV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WPT A;  1F59 A;  5AEI A;  4MZ6 E;  4MZ5 E;  4GMO A;  5HUW C;  3UVU A;  2H4M A;  3VWA A;  1I7X A;  4E4V A;  4V3R A;  4RZP A;  3L3F X;  3EBB A;  3WOY A;  4H3H A;  4U5S A;  3BCT A;  4D49 A;  1I7W A;  2VGL B;  3NOW A;  3C2H A;  3FGA A;  4OIH A;  4D4E A;  4ADY A;  1M5N S;  2NPP A;  4JLQ A;  3K5Y A;  5FC8 E;  4YJE A;  4IMI A;  3FEY C;  3UKY B;  3UKW B;  1BK5 A;  4DBA A;  3K49 A;  5KL1 A;  3OPB A;  2BAP A;  3PST A;  4U5V A;  5HUY C;  4L7M A;  3K4E A;  4I2W A;  1XQS A;  4P6Z G;  2Z6G A;  3GVO A;  1O6O A;  4U58 A;  3AU3 A;  3ND2 A;  3K62 A;  5EKG A;  3K7W A;  2JKT A;  4B8P A;  4EV8 A;  2XA7 A;  5HHG E;  5SW9 A;  5SWF A;  2YNR A;  4HTV A;  4CV5 B;  1JDH A;  2JKR A;  3L3Q A;  1W9C A;  3OBV A;  2RU4 B;  2Z5J A;  4B8O A;  2QNA A;  3ODR A;  5K6S A;  3GQ2 A;  4DB8 A;  3IBV A;  4ZDU A;  3BSX A;  1T08 A;  4I5L A;  3ZHP A;  3BTR C;  3OUW A;  3TJZ B;  4GMN A;  3GB8 A;  3DW8 A;  5DN7 A;  4I2Z A;  4O27 A;  4YJL A;  3A6P A;  3O2S A;  1XM9 A;  4I5N A;  3TJ3 A;  3VE6 A;  3K5Q A;  3OUX A;  2QK1 A;  3UKX B;  2Z5M A;  1IB2 A;  4K92 A;  3ZIO A;  3C2G A;  2IWH A;  2JAK A;  2IE3 A;  2PKG A;  1QGK A;  1HO8 A;  3DAD A;  4RV1 A;  5J3V A;  4U5U A;  1G3J A;  4IMJ A;  5CTT A;  3TX7 A;  4PVZ A;  3ZKV A;  4CT7 B;  3V71 A;  1BK6 A;  1W63 B;  4DB9 A;  2IW3 A;  5BZ5 A;  4FDD A;  2OF3 A;  2Z5K A;  5H2X A;  2BKU B;  1IAL A;  1LRV A;  3TT9 A;  1M8W A;  3GNI A;  4XZR B;  4UQI A;  1PJN B;  4RXH B;  1TH1 A;  3QHE A;  3TPM A;  2RU4 A;  2NYL A;  4UAF B;  1EJY I;  4QMH A;  2C1T A;  4BPL A;  4CB9 A;  2P8Q A;  2NYM A;  2X1G F;  3O2T A;  4HNM A;  3UKZ B;  4WV6 A;  3BWT A;  3QGC A;  3L6X A;  1M8Y A;  1U6G C;  4LAC A;  1V18 A;  4Y5J A;  1Z2C B;  1JPW A;  4EVA A;  4K6J A;  4PLR A;  3LTM A;  4G3A A;  2Z5N A;  3WOZ A;  3GS3 A;  5JJA A;  3V6Y A;  1EJL I;  1UPL A;  2IAE B;  3Q0S A;  5B56 A;  3O4X A;  4QMJ A;  3OQS A;  2C1M A;  2BCT A;  4NZW A;  4CBA A;  1Q1S C;  5BZV A;  3ZIP A;  4U5L A;  3FEX C;  2DB0 A;  3Q0M A;  3UL1 B;  2W3C A;  4U54 A;  3NMW A;  3O2Q A;  3Q5U A;  4U5N A;  3Q0P A;  1W63 A;  1QGR A;  2JKT B;  3TPO A;  1Q1T C;  3K64 A;  3K7V A;  2VGL A;  4FZD A;  1EE5 A;  1Y2A C;  3T7U A;  3BSB A;  4UAD A;  4BQK A;  4V3Q A;  4R0Z A;  1B3U A;  2PF4 A;  4B18 A;  5BYM A;  5SVZ A;  4CB8 A;  3LWW A;  5H2W A;  1UPK A;  2QK2 A;  3K5Z A;  3WYF C;  3QGB A;  4YI0 C;  4R10 A;  4YGX A;  2YNS A;  4U5O A;  1QZ7 A;  3W3U A;  4A0C A;  1OYZ A;  3BX3 A;  1IQ1 C;  1M1E A;  5E6Q B;  5BZU A;  3PSP A;  3H3D X;  1PJM B;  4NEE A;  1WA5 B;  3QG9 A;  4PLS A;  4QMI A;  4DB6 A;  1EE4 A;  3Q0L A;  5KL8 A;  1JPP A;  4OO6 A;  4EVP A;  2X19 B;  2IAE A;  5KLR B;  4MFV A;  1UN0 A;  2IX3 A;  3V74 A;  4KZG A;  4UWX A;  3NMX A;  5K9S A;  4YK6 A;  5EWP A;  4V3O A;  3L6Y A;  3ZIR A;  5EKF A;  1M8Z A;  2Q5D A;  2F31 A;  3NMZ A;  2FV2 A;  5KLT B;  4HM9 A;  1QBK B;  4BA3 A;  1M8X A;  1LUJ A;  3ZIQ A;  5KLA A;  3Q0Q A;  2JDQ A;  4MFU A;  2Z6H A;  1IBR B;  5BZ1 A;  2OT8 A;  4FQ3 A;  4JW2 B;  4FZF A;  3IFQ A;  2Z5O A;  1XQR A;  3FGA B;  4DZS A;  3RZX A;  3ODS A;  2NPP B;  4TNM A;  4HXT A;  4UQI B;  4U3J C;  3RZ9 A;  1GCJ A;  4PLQ A;  3C5W A;  3K61 A;  4P6Z B;  3Q0O A;  4EVT A;  4DJS A;  4CT6 B;  2BNX A;  2NYL B;  3QML C;  1UKL A;  2WTK A;  4CRV B;  4FFB C;  3Q0N A;  4DVG B;  3GRL A;  2QMR A;  2NYM B;  4B8J A;  5D5K C;  3GVT A;  3EA5 B;  3UL0 B;  3GAE A;  2XA7 B;  3LTJ A;  3ZIN A;  1O6P A;  4R11 A;  3KND A;  4UAE A;  3Q0R A;  2JKR B;  4CRU B;  3EG5 B;  2YJY A;  4FZA A;  3BX2 A;  5LSW A;  4H3K A;  1WA5 C;  2IE4 A;  2GL7 A;  4EV9 A; 
#chains in the Genus database with same CATH topology
 3WPT A;  1F59 A;  5AEI A;  4MZ6 E;  4MZ5 E;  4GMO A;  5HUW C;  3UVU A;  3UJ0 A;  2H4M A;  3SL9 A;  3VWA A;  1I7X A;  3VLF A;  4E4V A;  4V3R A;  4A3T A;  4I6I A;  4RZP A;  5CLA A;  3L3F X;  3EBB A;  3WOY A;  4H3H A;  4U5S A;  3BCT A;  4D49 A;  1I7W A;  2VGL B;  3NOW A;  3C2H A;  3FGA A;  4OIH A;  4D4E A;  4ADY A;  1M5N S;  2NPP A;  4JLQ A;  3K5Y A;  5FC8 E;  4YJE A;  4IMI A;  3FEY C;  3UKY B;  3UKW B;  1BK5 A;  4DBA A;  3K49 A;  5KL1 A;  3OPB A;  2BAP A;  3PST A;  4U5V A;  4U2X D;  5HUY C;  4L7M A;  3K4E A;  4I2W A;  1XQS A;  4P6Z G;  2Z6G A;  3GVO A;  1O6O A;  4U58 A;  3AU3 A;  3ND2 A;  3K62 A;  5EKG A;  3K7W A;  2JKT A;  4B8P A;  4EV8 A;  2XA7 A;  5HHG E;  5SW9 A;  5SWF A;  2YNR A;  4HTV A;  4I1E A;  4CV5 B;  1JDH A;  2JKR A;  3L3Q A;  1W9C A;  3OBV A;  2RU4 B;  2Z5J A;  4B8O A;  2QNA A;  3ODR A;  5CL5 A;  5CLB A;  5K6S A;  3GQ2 A;  4DB8 A;  3IBV A;  4ZDU A;  3BSX A;  1T08 A;  4I5L A;  3VLE A;  3ZHP A;  3BTR C;  3OUW A;  3TJZ B;  4GMN A;  3GB8 A;  3DW8 A;  5DN7 A;  4I2Z A;  4L4I A;  4O27 A;  4YJL A;  3A6P A;  1LSH A;  3O2S A;  1XM9 A;  4I5N A;  3TJ3 A;  3VE6 A;  3K5Q A;  3OUX A;  3JY1 A;  2QK1 A;  3UKX B;  5CLE A;  2Z5M A;  3JX7 A;  3T8S A;  1IB2 A;  4K92 A;  3UJ4 A;  3ZIO A;  4I8M A;  3C2G A;  2IWH A;  5CLC A;  2JAK A;  2IE3 A;  2PKG A;  1QGK A;  1HO8 A;  3DAD A;  4RV1 A;  5J3V A;  4U5U A;  1G3J A;  4IMJ A;  5CTT A;  3TX7 A;  4PVZ A;  3ZKV A;  4CT7 B;  3V71 A;  1BK6 A;  1W63 B;  4DB9 A;  2IW3 A;  5BZ5 A;  4FDD A;  4I7I A;  4JW2 A;  2OF3 A;  2Z5K A;  5H2X A;  2BKU B;  1IAL A;  1TE4 A;  1LRV A;  3TT9 A;  1M8W A;  3GNI A;  4XZR B;  4UQI A;  1PJN B;  4RXH B;  3JXY A;  1TH1 A;  3QHE A;  3TPM A;  2RU4 A;  4I96 A;  2NYL A;  4UAF B;  1EJY I;  4QMH A;  2C1T A;  5CL9 A;  4BPL A;  4CB9 A;  2P8Q A;  2NYM A;  2X1G F;  3O2T A;  4HNM A;  4I0Y A;  3UKZ B;  4WV6 A;  3BWT A;  3QGC A;  3L6X A;  1M8Y A;  1U6G C;  4LAC A;  1V18 A;  4Y5J A;  1Z2C B;  1JPW A;  4EVA A;  4K6J A;  4PLR A;  3LTM A;  4G3A A;  2Z5N A;  3WOZ A;  3GS3 A;  5JJA A;  3V6Y A;  1EJL I;  1UPL A;  2IAE B;  3Q0S A;  5B56 A;  3O4X A;  4QMJ A;  3OQS A;  2C1M A;  2BCT A;  4NZW A;  4CBA A;  1Q1S C;  5BZV A;  5CL8 A;  3ZIP A;  5CLD A;  4L4H A;  4U5L A;  3FEX C;  2DB0 A;  3Q0M A;  3UL1 B;  5CL3 A;  2W3C A;  4U54 A;  3NMW A;  3O2Q A;  3Q5U A;  4U5N A;  3Q0P A;  1W63 A;  1QGR A;  2JKT B;  4JKQ A;  3TPO A;  1Q1T C;  3K64 A;  3K7V A;  2VGL A;  4FZD A;  1EE5 A;  1Y2A C;  3T7U A;  3BSB A;  4UAD A;  4BQK A;  4V3Q A;  4R0Z A;  1B3U A;  2PF4 A;  4FP7 A;  4B18 A;  5BYM A;  5SVZ A;  4CB8 A;  3LWW A;  5H2W A;  1UPK A;  2QK2 A;  5CL6 A;  3K5Z A;  3WYF C;  3QGB A;  4YI0 C;  4R10 A;  4YGX A;  2YNS A;  4U5O A;  1QZ7 A;  3VLD A;  3W3U A;  4A0C A;  1OYZ A;  3ZIK A;  3BX3 A;  1IQ1 C;  1M1E A;  5E6Q B;  5BZU A;  3PSP A;  3ZIL A;  3H3D X;  1PJM B;  4NEE A;  1WA5 B;  3QG9 A;  4PLS A;  3BVS A;  4QMI A;  4DB6 A;  1EE4 A;  4I3N A;  3Q0L A;  5KL8 A;  1JPP A;  4OO6 A;  4EVP A;  2XOA A;  2X19 B;  5KUB A;  2IAE A;  5KLR B;  4MFV A;  1UN0 A;  2IX3 A;  3V74 A;  4KZG A;  4UWX A;  3JXZ A;  3NMX A;  5K9S A;  5CL7 A;  4YK6 A;  5EWP A;  4V3O A;  3L6Y A;  3ZIR A;  5EKF A;  1M8Z A;  2Q5D A;  2F31 A;  3NMZ A;  2FV2 A;  5KLT B;  4HM9 A;  1QBK B;  4BA3 A;  1M8X A;  1LUJ A;  4JW3 C;  3ZIQ A;  5KLA A;  3Q0Q A;  2JDQ A;  4MFU A;  2Z6H A;  1N4K A;  3SLA A;  1IBR B;  5BZ1 A;  2OT8 A;  4FQ3 A;  4JW2 B;  4FZF A;  3IFQ A;  2Z5O A;  1XQR A;  3FGA B;  4DZS A;  3RZX A;  3ODS A;  2NPP B;  4TNM A;  4HXT A;  4UQI B;  4U3J C;  3RZ9 A;  1GCJ A;  4PLQ A;  3C5W A;  3K61 A;  4P6Z B;  3Q0O A;  4EVT A;  4I2S A;  4DJS A;  4CT6 B;  2BNX A;  2NYL B;  3QML C;  1UKL A;  2WTK A;  4CRV B;  4FFB C;  4I37 A;  3Q0N A;  4DVG B;  3GRL A;  4A3V A;  2QMR A;  2NYM B;  4B8J A;  5D5K C;  3GVT A;  3EA5 B;  3UL0 B;  3GAE A;  2XA7 B;  3LTJ A;  3ZIN A;  1O6P A;  4R11 A;  3KND A;  5CL4 A;  4UAE A;  3Q0R A;  2JKR B;  4CRU B;  3EG5 B;  2YJY A;  4FZA A;  3BX2 A;  5LSW A;  4H3K A;  1WA5 C;  2IE4 A;  2GL7 A;  4EV9 A; 
#chains in the Genus database with same CATH homology
 3WPT A;  1F59 A;  5AEI A;  4MZ6 E;  4MZ5 E;  4GMO A;  5HUW C;  3UVU A;  2H4M A;  3SL9 A;  3VWA A;  1I7X A;  3VLF A;  4E4V A;  4V3R A;  4A3T A;  4I6I A;  4RZP A;  5CLA A;  3L3F X;  3EBB A;  3WOY A;  4H3H A;  4U5S A;  3BCT A;  4D49 A;  1I7W A;  2VGL B;  3NOW A;  3C2H A;  3FGA A;  4OIH A;  4D4E A;  4ADY A;  1M5N S;  2NPP A;  4JLQ A;  3K5Y A;  5FC8 E;  4YJE A;  4IMI A;  3FEY C;  3UKY B;  3UKW B;  1BK5 A;  4DBA A;  3K49 A;  5KL1 A;  3OPB A;  2BAP A;  3PST A;  4U5V A;  4U2X D;  5HUY C;  4L7M A;  3K4E A;  4I2W A;  1XQS A;  4P6Z G;  2Z6G A;  3GVO A;  1O6O A;  4U58 A;  3AU3 A;  3ND2 A;  3K62 A;  5EKG A;  3K7W A;  2JKT A;  4B8P A;  4EV8 A;  2XA7 A;  5HHG E;  5SW9 A;  5SWF A;  2YNR A;  4HTV A;  4I1E A;  4CV5 B;  1JDH A;  2JKR A;  3L3Q A;  1W9C A;  3OBV A;  2RU4 B;  2Z5J A;  4B8O A;  2QNA A;  3ODR A;  5CL5 A;  5CLB A;  5K6S A;  3GQ2 A;  4DB8 A;  3IBV A;  4ZDU A;  3BSX A;  1T08 A;  4I5L A;  3VLE A;  3ZHP A;  3BTR C;  3OUW A;  3TJZ B;  4GMN A;  3GB8 A;  3DW8 A;  5DN7 A;  4I2Z A;  4L4I A;  4O27 A;  4YJL A;  3A6P A;  3O2S A;  1XM9 A;  4I5N A;  3TJ3 A;  3VE6 A;  3K5Q A;  3OUX A;  3JY1 A;  2QK1 A;  3UKX B;  5CLE A;  2Z5M A;  3JX7 A;  1IB2 A;  4K92 A;  3ZIO A;  4I8M A;  3C2G A;  2IWH A;  5CLC A;  2JAK A;  2IE3 A;  2PKG A;  1QGK A;  1HO8 A;  3DAD A;  4RV1 A;  5J3V A;  4U5U A;  1G3J A;  4IMJ A;  5CTT A;  3TX7 A;  4PVZ A;  3ZKV A;  4CT7 B;  3V71 A;  1BK6 A;  1W63 B;  4DB9 A;  2IW3 A;  5BZ5 A;  4FDD A;  4I7I A;  4JW2 A;  2OF3 A;  2Z5K A;  5H2X A;  2BKU B;  1IAL A;  1TE4 A;  1LRV A;  3TT9 A;  1M8W A;  3GNI A;  4XZR B;  4UQI A;  1PJN B;  4RXH B;  3JXY A;  1TH1 A;  3QHE A;  3TPM A;  2RU4 A;  4I96 A;  2NYL A;  4UAF B;  1EJY I;  4QMH A;  2C1T A;  5CL9 A;  4BPL A;  4CB9 A;  2P8Q A;  2NYM A;  2X1G F;  3O2T A;  4HNM A;  4I0Y A;  3UKZ B;  4WV6 A;  3BWT A;  3QGC A;  3L6X A;  1M8Y A;  1U6G C;  4LAC A;  1V18 A;  4Y5J A;  1Z2C B;  1JPW A;  4EVA A;  4K6J A;  4PLR A;  3LTM A;  4G3A A;  2Z5N A;  3WOZ A;  3GS3 A;  5JJA A;  3V6Y A;  1EJL I;  1UPL A;  2IAE B;  3Q0S A;  5B56 A;  3O4X A;  4QMJ A;  3OQS A;  2C1M A;  2BCT A;  4NZW A;  4CBA A;  1Q1S C;  5BZV A;  5CL8 A;  3ZIP A;  5CLD A;  4L4H A;  4U5L A;  3FEX C;  2DB0 A;  3Q0M A;  3UL1 B;  5CL3 A;  2W3C A;  4U54 A;  3NMW A;  3O2Q A;  3Q5U A;  4U5N A;  3Q0P A;  1W63 A;  1QGR A;  2JKT B;  4JKQ A;  3TPO A;  1Q1T C;  3K64 A;  3K7V A;  2VGL A;  4FZD A;  1EE5 A;  1Y2A C;  3T7U A;  3BSB A;  4UAD A;  4BQK A;  4V3Q A;  4R0Z A;  1B3U A;  2PF4 A;  4FP7 A;  4B18 A;  5BYM A;  5SVZ A;  4CB8 A;  3LWW A;  5H2W A;  1UPK A;  2QK2 A;  5CL6 A;  3K5Z A;  3WYF C;  3QGB A;  4YI0 C;  4R10 A;  4YGX A;  2YNS A;  4U5O A;  1QZ7 A;  3VLD A;  3W3U A;  4A0C A;  1OYZ A;  3ZIK A;  3BX3 A;  1IQ1 C;  1M1E A;  5E6Q B;  5BZU A;  3PSP A;  3ZIL A;  3H3D X;  1PJM B;  4NEE A;  1WA5 B;  3QG9 A;  4PLS A;  3BVS A;  4QMI A;  4DB6 A;  1EE4 A;  4I3N A;  3Q0L A;  5KL8 A;  1JPP A;  4OO6 A;  4EVP A;  2XOA A;  2X19 B;  5KUB A;  2IAE A;  5KLR B;  4MFV A;  1UN0 A;  2IX3 A;  3V74 A;  4KZG A;  4UWX A;  3JXZ A;  3NMX A;  5K9S A;  5CL7 A;  4YK6 A;  5EWP A;  4V3O A;  3L6Y A;  3ZIR A;  5EKF A;  1M8Z A;  2Q5D A;  2F31 A;  3NMZ A;  2FV2 A;  5KLT B;  4HM9 A;  1QBK B;  4BA3 A;  1M8X A;  1LUJ A;  4JW3 C;  3ZIQ A;  5KLA A;  3Q0Q A;  2JDQ A;  4MFU A;  2Z6H A;  3SLA A;  1IBR B;  5BZ1 A;  2OT8 A;  4FQ3 A;  4JW2 B;  4FZF A;  3IFQ A;  2Z5O A;  1XQR A;  3FGA B;  4DZS A;  3RZX A;  3ODS A;  2NPP B;  4TNM A;  4HXT A;  4UQI B;  4U3J C;  3RZ9 A;  1GCJ A;  4PLQ A;  3C5W A;  3K61 A;  4P6Z B;  3Q0O A;  4EVT A;  4I2S A;  4DJS A;  4CT6 B;  2BNX A;  2NYL B;  3QML C;  1UKL A;  2WTK A;  4CRV B;  4FFB C;  4I37 A;  3Q0N A;  4DVG B;  3GRL A;  4A3V A;  2QMR A;  2NYM B;  4B8J A;  5D5K C;  3GVT A;  3EA5 B;  3UL0 B;  3GAE A;  2XA7 B;  3LTJ A;  3ZIN A;  1O6P A;  4R11 A;  3KND A;  5CL4 A;  4UAE A;  3Q0R A;  2JKR B;  4CRU B;  3EG5 B;  2YJY A;  4FZA A;  3BX2 A;  5LSW A;  4H3K A;  1WA5 C;  2IE4 A;  2GL7 A;  4EV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...