5DN7A

Crescerin uses a tog domain array to regulate microtubules in the primary cilium
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
250
structure length
240
Chain Sequence
LKFEIIPQELHARLLDNRTQAVEELKQLLGKFNPSSTPHASLVGFISLLYNLLDDSNFKVVHGTLQVLHLLVIRLGEQVQQFLGPVIAASVKVLADNKLVIKQEYMKIFLKLMKEVGPQRVLSLLLENLKHKHSRVREEVVNICICSLLTYPSEDFDLPKLSFDLAPALVDSKRRVRQAALEAFAVLASSMGSGKTNVLFKAVDTVELGVMNAVQARLARKTLPRLTEQGFVEYAILMPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein FAM179B
publication title Crescerin uses a TOG domain array to regulate microtubules in the primary cilium.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 88
structure length 240
sequence length 250
ec nomenclature
pdb deposition date 2015-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 5dn7A00
5SWFA 3W3UA 1XQSA 1BK6A 4OIHA 4TNMA 3FGAB 4R0ZA 1M8XA 1UKLA 4I2WA 4CRUB 2Z6GA 2Z5OA 4NEEA 4L7MA 4EVTA 2YNSA 3DADA 2IW3A 1B3UA 3OQSA 5BZUA 4UQIB 3C5WA 5HUWC 4V3QA 3UKWB 4U5NA 4K6JA 2JKTA 3K49A 3WOYA 2PKGA 4LACA 4DB6A 3Q0RA 2H4MA 1IALA 4UAFB 1PJNB 3TJ3A 5CTTA 1EE5A 1UN0A 2DB0A 4H3HA 3V6YA 2RU4A 4U5OA 4EVPA 3GQ2A 2BKUB 2Z5JA 1M8ZA 1JDHA 3OUWA 2PF4A 3BX2A 3BCTA 3OUXA 3QMLC 3VE6A 1HO8A 3WPTA 1F59A 2Q5DA 2YJYA 3Q0NA 5KLAA 3ZHPA 2Z6HA 5H2WA 4R10A 4GMOA 4YI0C 5FC8E 3PSTA 4QMJA 3C2HA 5HHGE 1EJLI 1QZ7A 5HUYC 4ZDUA 4HXTA 3GAEA 5EKGA 1V18A 3IBVA 4CRVB 3Q0OA 4BQKA 1IBRB 3O2TA 4UAEA 1O6OA 3EA5B 3AU3A 3KNDA 3UL0B 2BAPA 3GNIA 2IX3A 5EWPA 2BNXA 4DB9A 4QMHA 2QMRA 2JAKA 3TPOA 1GCJA 4E4VA 4D49A 3K7VA 3Q0LA 2C1MA 5BZVA 2JDQA 1TH1A 4U3JC 4HM9A 4YJEA 4EV8A 4B8PA 4DVGB 3FGAA 2JKRB 1Y2AC 2NPPB 3L3QA 5EKFA 3K5ZA 1W9CA 4P6ZG 4EV9A 1IB2A 3V71A 2OF3A 4DJSA 4PLQA 4UADA 4YJLA 4B8OA 5J3VA 4EVAA 3K61A 5H2XA 3L6YA 1G3JA 1Q1SC 4FZFA 4G3AA 4UQIA 3LWWA 4RXHB 2Z5KA 5KLTB 3TX7A 4MFVA 3V74A 3K62A 3Q0SA 4U5SA 1O6PA 3IFQA 2VGLB 1Z2CB 4B18A 1XM9A 2YNRA 3ZKVA 3BSBA 3BTRC 3Q0MA 4D4EA 5BYMA 4YK6A 4PLSA 4V3OA 3RZ9A 2GL7A 2X1GF 4FDDA 3VWAA 3NOWA 4U5LA 4DB8A 5BZ5A 3ZIOA 4RZPA 3L3FX 4Y5JA 3C2GA 4MZ6E 1M5NS 2QK2A 3GVOA 4WV6A 4XZRB 3L6XA 4I5LA 1UPKA 1QBKB 2C1TA 1W63B 1BK5A 5AEIA 5KL8A 5SVZA 2BCTA 4IMJA 3QHEA 3T7UA 2IWHA 1W63A 2F31A 5JJAA 2XA7B 5D5KC 3TT9A 4FZAA 5BZ1A 5KL1A 4HNMA 1EE4A 3NMXA 3PSPA 2XA7A 3K4EA 3WYFC 3Q0PA 3ZINA 2OT8A 4MFUA 3BSXA 3ODSA 4I2ZA 1JPPA 1QGRA 3UKYB 2X19B 3K5QA 5KLRB 4ADYA 3Q5UA 3H3DX 1JPWA 1LUJA 4FZDA 3O4XA 3UKXB 3UKZB 1Q1TC 3GB8A 4A0CA 4V3RA 1IQ1C 3UL1B 1U6GC 5K6SA 2JKRA 4K92A 3A6PA 1OYZA 4U5VA 2NPPA 4QMIA 3UVUA 4BPLA 4BA3A 4P6ZB 5SW9A 1M1EA 1M8YA 2QNAA 4FFBC 5LSWA 4OO6A 3GS3A 2FV2A 4H3KA 3K7WA 4FQ3A 2IE3A 3EBBA 3O2QA 4UWXA 5E6QB 2JKTB 3ND2A 3TJZB 2QK1A 4DZSA 1PJMB 4CB9A 3Q0QA 3NMWA 2VGLA 4RV1A 3QGBA 2Z5NA 3FEYC 2Z5MA 3ZIQA 4GMNA 3TPMA 3NMZA 2NYMB 4DBAA 4JW2B 4PVZA 3RZXA 1EJYI 3BWTA 2RU4B 4IMIA 4I5NA 4NZWA 3K5YA 2NYMA 4CBAA 1M8WA 1XQRA 4CT7B 5B56A 5K9SA 1T08A 1WA5B 4O27A 4HTVA 3GVTA 2W3CA 2NYLB 2IE4A 3GRLA 1I7WA 5DN7A 2NYLA 3OPBA 3BX3A 4YGXA 3OBVA 3ZIPA 4U5UA 1I7XA 1UPLA 3QG9A 2IAEB 1QGKA 1WA5C 1LRVA 4CB8A 3LTMA 3QGCA 4CT6B 2IAEA 3ODRA 2P8QA 3DW8A 3EG5B 4KZGA 4R11A 3K64A 4MZ5E 3WOZA 3O2SA 4CV5B 3LTJA 4B8JA 2WTKA 4U54A 3FEXC 3ZIRA 4U58A 4PLRA 4JLQA
chains in the Genus database with same CATH superfamily
5SWFA 3W3UA 5CL6A 1XQSA 1BK6A 4OIHA 4TNMA 3FGAB 4R0ZA 1M8XA 1UKLA 4I2WA 4CRUB 2Z6GA 3VLFA 4JKQA 2Z5OA 4NEEA 4I96A 4L7MA 4EVTA 2YNSA 3DADA 2IW3A 1B3UA 3OQSA 5BZUA 5CL3A 4UQIB 3C5WA 4I3NA 5HUWC 4V3QA 3UKWB 4U5NA 4K6JA 2JKTA 3K49A 3WOYA 2PKGA 4LACA 4DB6A 3Q0RA 5CL4A 2H4MA 1IALA 4I0YA 5CLEA 3UJ0A 4UAFB 1PJNB 3TJ3A 5CTTA 4JW2A 1EE5A 1UN0A 2DB0A 4H3HA 3V6YA 2RU4A 4U5OA 4EVPA 3GQ2A 2BKUB 2Z5JA 1M8ZA 1JDHA 3OUWA 3ZILA 2PF4A 3BX2A 3BCTA 3OUXA 3T8SA 3UJ4A 3QMLC 3VE6A 1HO8A 3WPTA 1F59A 2Q5DA 2YJYA 3Q0NA 5KLAA 3ZHPA 2Z6HA 5H2WA 4R10A 4GMOA 4YI0C 5FC8E 3PSTA 1LSHA 4QMJA 3C2HA 5HHGE 1EJLI 1QZ7A 5HUYC 4ZDUA 4HXTA 3GAEA 5EKGA 1V18A 3IBVA 4CRVB 3Q0OA 4BQKA 1IBRB 3O2TA 4UAEA 5CLDA 1O6OA 3EA5B 3AU3A 3KNDA 3UL0B 2BAPA 3GNIA 2IX3A 5EWPA 2BNXA 4DB9A 4QMHA 2QMRA 2JAKA 3TPOA 4I37A 1GCJA 4E4VA 4I2SA 4D49A 3K7VA 3Q0LA 2C1MA 5BZVA 2JDQA 1TH1A 4U3JC 4HM9A 4YJEA 4EV8A 4B8PA 4DVGB 3FGAA 2JKRB 1Y2AC 2NPPB 3L3QA 5EKFA 3K5ZA 1W9CA 4P6ZG 4EV9A 1IB2A 3V71A 2OF3A 4DJSA 4PLQA 4UADA 4YJLA 4I6IA 4B8OA 5J3VA 4EVAA 3K61A 5H2XA 3L6YA 1G3JA 1Q1SC 4FZFA 4G3AA 4UQIA 4I8MA 3LWWA 4RXHB 2Z5KA 5KLTB 3TX7A 4MFVA 3V74A 3K62A 5CL7A 3Q0SA 4U5SA 1O6PA 3IFQA 2VGLB 4FP7A 1Z2CB 4B18A 1XM9A 2YNRA 3ZKVA 3BSBA 3BTRC 1TE4A 3Q0MA 4D4EA 5BYMA 4YK6A 4PLSA 4V3OA 3RZ9A 2GL7A 2X1GF 1N4KA 4FDDA 3VWAA 3NOWA 4U5LA 4DB8A 5BZ5A 3ZIOA 4RZPA 3L3FX 4Y5JA 5CLCA 4JW3C 3C2GA 4MZ6E 1M5NS 5CLAA 4L4IA 2QK2A 3GVOA 4WV6A 4XZRB 3L6XA 4I5LA 1UPKA 1QBKB 2C1TA 1W63B 1BK5A 5AEIA 5KL8A 4I7IA 5SVZA 2BCTA 4IMJA 3QHEA 3T7UA 2IWHA 1W63A 2F31A 5JJAA 2XA7B 5D5KC 3TT9A 4FZAA 3BVSA 5BZ1A 5KL1A 4HNMA 1EE4A 3NMXA 3PSPA 2XA7A 3K4EA 3WYFC 4A3VA 5CLBA 3Q0PA 3ZINA 2OT8A 4MFUA 3BSXA 3ODSA 4I2ZA 1JPPA 1QGRA 5CL5A 3UKYB 2X19B 3K5QA 5KLRB 4ADYA 3Q5UA 3H3DX 1JPWA 1LUJA 4FZDA 3O4XA 5KUBA 3UKXB 3UKZB 1Q1TC 3GB8A 4A3TA 4A0CA 4V3RA 1IQ1C 3UL1B 1U6GC 5K6SA 2JKRA 4K92A 3A6PA 1OYZA 4L4HA 4U5VA 2NPPA 4QMIA 3UVUA 3VLDA 4BPLA 4BA3A 3SL9A 4P6ZB 5SW9A 1M1EA 1M8YA 2QNAA 4FFBC 5LSWA 4OO6A 3GS3A 2FV2A 4H3KA 3K7WA 4FQ3A 2IE3A 3EBBA 3O2QA 4UWXA 3JX7A 5E6QB 2JKTB 2XOAA 3ND2A 3TJZB 2QK1A 4DZSA 1PJMB 4CB9A 3Q0QA 3NMWA 2VGLA 4RV1A 3QGBA 2Z5NA 3FEYC 2Z5MA 3ZIQA 4GMNA 3TPMA 3NMZA 2NYMB 4DBAA 4JW2B 4PVZA 3RZXA 3ZIKA 5CL8A 1EJYI 3BWTA 2RU4B 4IMIA 4I5NA 4NZWA 3K5YA 2NYMA 4CBAA 1M8WA 1XQRA 4CT7B 5B56A 5K9SA 1T08A 1WA5B 4O27A 4HTVA 3GVTA 2W3CA 2NYLB 2IE4A 3GRLA 1I7WA 5DN7A 2NYLA 3OPBA 3BX3A 4YGXA 3OBVA 3ZIPA 4U5UA 1I7XA 1UPLA 3QG9A 2IAEB 1QGKA 1WA5C 5CL9A 1LRVA 4CB8A 3VLEA 3LTMA 3QGCA 4CT6B 4I1EA 2IAEA 3JXZA 3ODRA 2P8QA 3SLAA 3DW8A 3EG5B 4KZGA 4R11A 3K64A 4MZ5E 3WOZA 3JXYA 3O2SA 4CV5B 3LTJA 4U2XD 4B8JA 2WTKA 3JY1A 4U54A 3FEXC 3ZIRA 4U58A 4PLRA 4JLQA
chains in the Genus database with same CATH topology
5SWFA 3W3UA 5CL6A 1XQSA 1BK6A 4OIHA 4TNMA 3FGAB 4R0ZA 1M8XA 1UKLA 4I2WA 4CRUB 2Z6GA 3VLFA 4JKQA 2Z5OA 4NEEA 4I96A 4L7MA 4EVTA 2YNSA 3DADA 2IW3A 1B3UA 3OQSA 5BZUA 5CL3A 4UQIB 3C5WA 4I3NA 5HUWC 4V3QA 3UKWB 4U5NA 4K6JA 2JKTA 3K49A 3WOYA 2PKGA 4LACA 4DB6A 3Q0RA 5CL4A 2H4MA 1IALA 4I0YA 5CLEA 4UAFB 1PJNB 3TJ3A 5CTTA 4JW2A 1EE5A 1UN0A 2DB0A 4H3HA 3V6YA 2RU4A 4U5OA 4EVPA 3GQ2A 2BKUB 2Z5JA 1M8ZA 1JDHA 3OUWA 3ZILA 2PF4A 3BX2A 3BCTA 3OUXA 3QMLC 3VE6A 1HO8A 3WPTA 1F59A 2Q5DA 2YJYA 3Q0NA 5KLAA 3ZHPA 2Z6HA 5H2WA 4R10A 4GMOA 4YI0C 5FC8E 3PSTA 4QMJA 3C2HA 5HHGE 1EJLI 1QZ7A 5HUYC 4ZDUA 4HXTA 3GAEA 5EKGA 1V18A 3IBVA 4CRVB 3Q0OA 4BQKA 1IBRB 3O2TA 4UAEA 5CLDA 1O6OA 3EA5B 3AU3A 3KNDA 3UL0B 2BAPA 3GNIA 2IX3A 5EWPA 2BNXA 4DB9A 4QMHA 2QMRA 2JAKA 3TPOA 4I37A 1GCJA 4E4VA 4I2SA 4D49A 3K7VA 3Q0LA 2C1MA 5BZVA 2JDQA 1TH1A 4U3JC 4HM9A 4YJEA 4EV8A 4B8PA 4DVGB 3FGAA 2JKRB 1Y2AC 2NPPB 3L3QA 5EKFA 3K5ZA 1W9CA 4P6ZG 4EV9A 1IB2A 3V71A 2OF3A 4DJSA 4PLQA 4UADA 4YJLA 4I6IA 4B8OA 5J3VA 4EVAA 3K61A 5H2XA 3L6YA 1G3JA 1Q1SC 4FZFA 4G3AA 4UQIA 4I8MA 3LWWA 4RXHB 2Z5KA 5KLTB 3TX7A 4MFVA 3V74A 3K62A 5CL7A 3Q0SA 4U5SA 1O6PA 3IFQA 2VGLB 4FP7A 1Z2CB 4B18A 1XM9A 2YNRA 3ZKVA 3BSBA 3BTRC 1TE4A 3Q0MA 4D4EA 5BYMA 4YK6A 4PLSA 4V3OA 3RZ9A 2GL7A 2X1GF 4FDDA 3VWAA 3NOWA 4U5LA 4DB8A 5BZ5A 3ZIOA 4RZPA 3L3FX 4Y5JA 5CLCA 4JW3C 3C2GA 4MZ6E 1M5NS 5CLAA 4L4IA 2QK2A 3GVOA 4WV6A 4XZRB 3L6XA 4I5LA 1UPKA 1QBKB 2C1TA 1W63B 1BK5A 5AEIA 5KL8A 4I7IA 5SVZA 2BCTA 4IMJA 3QHEA 3T7UA 2IWHA 1W63A 2F31A 5JJAA 2XA7B 5D5KC 3TT9A 4FZAA 3BVSA 5BZ1A 5KL1A 4HNMA 1EE4A 3NMXA 3PSPA 2XA7A 3K4EA 3WYFC 4A3VA 5CLBA 3Q0PA 3ZINA 2OT8A 4MFUA 3BSXA 3ODSA 4I2ZA 1JPPA 1QGRA 5CL5A 3UKYB 2X19B 3K5QA 5KLRB 4ADYA 3Q5UA 3H3DX 1JPWA 1LUJA 4FZDA 3O4XA 5KUBA 3UKXB 3UKZB 1Q1TC 3GB8A 4A3TA 4A0CA 4V3RA 1IQ1C 3UL1B 1U6GC 5K6SA 2JKRA 4K92A 3A6PA 1OYZA 4L4HA 4U5VA 2NPPA 4QMIA 3UVUA 3VLDA 4BPLA 4BA3A 3SL9A 4P6ZB 5SW9A 1M1EA 1M8YA 2QNAA 4FFBC 5LSWA 4OO6A 3GS3A 2FV2A 4H3KA 3K7WA 4FQ3A 2IE3A 3EBBA 3O2QA 4UWXA 3JX7A 5E6QB 2JKTB 2XOAA 3ND2A 3TJZB 2QK1A 4DZSA 1PJMB 4CB9A 3Q0QA 3NMWA 2VGLA 4RV1A 3QGBA 2Z5NA 3FEYC 2Z5MA 3ZIQA 4GMNA 3TPMA 3NMZA 2NYMB 4DBAA 4JW2B 4PVZA 3RZXA 3ZIKA 5CL8A 1EJYI 3BWTA 2RU4B 4IMIA 4I5NA 4NZWA 3K5YA 2NYMA 4CBAA 1M8WA 1XQRA 4CT7B 5B56A 5K9SA 1T08A 1WA5B 4O27A 4HTVA 3GVTA 2W3CA 2NYLB 2IE4A 3GRLA 1I7WA 5DN7A 2NYLA 3OPBA 3BX3A 4YGXA 3OBVA 3ZIPA 4U5UA 1I7XA 1UPLA 3QG9A 2IAEB 1QGKA 1WA5C 5CL9A 1LRVA 4CB8A 3VLEA 3LTMA 3QGCA 4CT6B 4I1EA 2IAEA 3JXZA 3ODRA 2P8QA 3SLAA 3DW8A 3EG5B 4KZGA 4R11A 3K64A 4MZ5E 3WOZA 3JXYA 3O2SA 4CV5B 3LTJA 4U2XD 4B8JA 2WTKA 3JY1A 4U54A 3FEXC 3ZIRA 4U58A 4PLRA 4JLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5SWF A;  3W3U A;  1XQS A;  1BK6 A;  4OIH A;  4TNM A;  3FGA B;  4R0Z A;  1M8X A;  1UKL A;  4I2W A;  4CRU B;  2Z6G A;  2Z5O A;  4NEE A;  4L7M A;  4EVT A;  2YNS A;  3DAD A;  2IW3 A;  1B3U A;  3OQS A;  5BZU A;  4UQI B;  3C5W A;  5HUW C;  4V3Q A;  3UKW B;  4U5N A;  4K6J A;  2JKT A;  3K49 A;  3WOY A;  2PKG A;  4LAC A;  4DB6 A;  3Q0R A;  2H4M A;  1IAL A;  4UAF B;  1PJN B;  3TJ3 A;  5CTT A;  1EE5 A;  1UN0 A;  2DB0 A;  4H3H A;  3V6Y A;  2RU4 A;  4U5O A;  4EVP A;  3GQ2 A;  2BKU B;  2Z5J A;  1M8Z A;  1JDH A;  3OUW A;  2PF4 A;  3BX2 A;  3BCT A;  3OUX A;  3QML C;  3VE6 A;  1HO8 A;  3WPT A;  1F59 A;  2Q5D A;  2YJY A;  3Q0N A;  5KLA A;  3ZHP A;  2Z6H A;  5H2W A;  4R10 A;  4GMO A;  4YI0 C;  5FC8 E;  3PST A;  4QMJ A;  3C2H A;  5HHG E;  1EJL I;  1QZ7 A;  5HUY C;  4ZDU A;  4HXT A;  3GAE A;  5EKG A;  1V18 A;  3IBV A;  4CRV B;  3Q0O A;  4BQK A;  1IBR B;  3O2T A;  4UAE A;  1O6O A;  3EA5 B;  3AU3 A;  3KND A;  3UL0 B;  2BAP A;  3GNI A;  2IX3 A;  5EWP A;  2BNX A;  4DB9 A;  4QMH A;  2QMR A;  2JAK A;  3TPO A;  1GCJ A;  4E4V A;  4D49 A;  3K7V A;  3Q0L A;  2C1M A;  5BZV A;  2JDQ A;  1TH1 A;  4U3J C;  4HM9 A;  4YJE A;  4EV8 A;  4B8P A;  4DVG B;  3FGA A;  2JKR B;  1Y2A C;  2NPP B;  3L3Q A;  5EKF A;  3K5Z A;  1W9C A;  4P6Z G;  4EV9 A;  1IB2 A;  3V71 A;  2OF3 A;  4DJS A;  4PLQ A;  4UAD A;  4YJL A;  4B8O A;  5J3V A;  4EVA A;  3K61 A;  5H2X A;  3L6Y A;  1G3J A;  1Q1S C;  4FZF A;  4G3A A;  4UQI A;  3LWW A;  4RXH B;  2Z5K A;  5KLT B;  3TX7 A;  4MFV A;  3V74 A;  3K62 A;  3Q0S A;  4U5S A;  1O6P A;  3IFQ A;  2VGL B;  1Z2C B;  4B18 A;  1XM9 A;  2YNR A;  3ZKV A;  3BSB A;  3BTR C;  3Q0M A;  4D4E A;  5BYM A;  4YK6 A;  4PLS A;  4V3O A;  3RZ9 A;  2GL7 A;  2X1G F;  4FDD A;  3VWA A;  3NOW A;  4U5L A;  4DB8 A;  5BZ5 A;  3ZIO A;  4RZP A;  3L3F X;  4Y5J A;  3C2G A;  4MZ6 E;  1M5N S;  2QK2 A;  3GVO A;  4WV6 A;  4XZR B;  3L6X A;  4I5L A;  1UPK A;  1QBK B;  2C1T A;  1W63 B;  1BK5 A;  5AEI A;  5KL8 A;  5SVZ A;  2BCT A;  4IMJ A;  3QHE A;  3T7U A;  2IWH A;  1W63 A;  2F31 A;  5JJA A;  2XA7 B;  5D5K C;  3TT9 A;  4FZA A;  5BZ1 A;  5KL1 A;  4HNM A;  1EE4 A;  3NMX A;  3PSP A;  2XA7 A;  3K4E A;  3WYF C;  3Q0P A;  3ZIN A;  2OT8 A;  4MFU A;  3BSX A;  3ODS A;  4I2Z A;  1JPP A;  1QGR A;  3UKY B;  2X19 B;  3K5Q A;  5KLR B;  4ADY A;  3Q5U A;  3H3D X;  1JPW A;  1LUJ A;  4FZD A;  3O4X A;  3UKX B;  3UKZ B;  1Q1T C;  3GB8 A;  4A0C A;  4V3R A;  1IQ1 C;  3UL1 B;  1U6G C;  5K6S A;  2JKR A;  4K92 A;  3A6P A;  1OYZ A;  4U5V A;  2NPP A;  4QMI A;  3UVU A;  4BPL A;  4BA3 A;  4P6Z B;  5SW9 A;  1M1E A;  1M8Y A;  2QNA A;  4FFB C;  5LSW A;  4OO6 A;  3GS3 A;  2FV2 A;  4H3K A;  3K7W A;  4FQ3 A;  2IE3 A;  3EBB A;  3O2Q A;  4UWX A;  5E6Q B;  2JKT B;  3ND2 A;  3TJZ B;  2QK1 A;  4DZS A;  1PJM B;  4CB9 A;  3Q0Q A;  3NMW A;  2VGL A;  4RV1 A;  3QGB A;  2Z5N A;  3FEY C;  2Z5M A;  3ZIQ A;  4GMN A;  3TPM A;  3NMZ A;  2NYM B;  4DBA A;  4JW2 B;  4PVZ A;  3RZX A;  1EJY I;  3BWT A;  2RU4 B;  4IMI A;  4I5N A;  4NZW A;  3K5Y A;  2NYM A;  4CBA A;  1M8W A;  1XQR A;  4CT7 B;  5B56 A;  5K9S A;  1T08 A;  1WA5 B;  4O27 A;  4HTV A;  3GVT A;  2W3C A;  2NYL B;  2IE4 A;  3GRL A;  1I7W A;  5DN7 A;  2NYL A;  3OPB A;  3BX3 A;  4YGX A;  3OBV A;  3ZIP A;  4U5U A;  1I7X A;  1UPL A;  3QG9 A;  2IAE B;  1QGK A;  1WA5 C;  1LRV A;  4CB8 A;  3LTM A;  3QGC A;  4CT6 B;  2IAE A;  3ODR A;  2P8Q A;  3DW8 A;  3EG5 B;  4KZG A;  4R11 A;  3K64 A;  4MZ5 E;  3WOZ A;  3O2S A;  4CV5 B;  3LTJ A;  4B8J A;  2WTK A;  4U54 A;  3FEX C;  3ZIR A;  4U58 A;  4PLR A;  4JLQ A; 
#chains in the Genus database with same CATH topology
 5SWF A;  3W3U A;  5CL6 A;  1XQS A;  1BK6 A;  4OIH A;  4TNM A;  3FGA B;  4R0Z A;  1M8X A;  1UKL A;  4I2W A;  4CRU B;  2Z6G A;  3VLF A;  4JKQ A;  2Z5O A;  4NEE A;  4I96 A;  4L7M A;  4EVT A;  2YNS A;  3DAD A;  2IW3 A;  1B3U A;  3OQS A;  5BZU A;  5CL3 A;  4UQI B;  3C5W A;  4I3N A;  5HUW C;  4V3Q A;  3UKW B;  4U5N A;  4K6J A;  2JKT A;  3K49 A;  3WOY A;  2PKG A;  4LAC A;  4DB6 A;  3Q0R A;  5CL4 A;  2H4M A;  1IAL A;  4I0Y A;  5CLE A;  3UJ0 A;  4UAF B;  1PJN B;  3TJ3 A;  5CTT A;  4JW2 A;  1EE5 A;  1UN0 A;  2DB0 A;  4H3H A;  3V6Y A;  2RU4 A;  4U5O A;  4EVP A;  3GQ2 A;  2BKU B;  2Z5J A;  1M8Z A;  1JDH A;  3OUW A;  3ZIL A;  2PF4 A;  3BX2 A;  3BCT A;  3OUX A;  3T8S A;  3UJ4 A;  3QML C;  3VE6 A;  1HO8 A;  3WPT A;  1F59 A;  2Q5D A;  2YJY A;  3Q0N A;  5KLA A;  3ZHP A;  2Z6H A;  5H2W A;  4R10 A;  4GMO A;  4YI0 C;  5FC8 E;  3PST A;  1LSH A;  4QMJ A;  3C2H A;  5HHG E;  1EJL I;  1QZ7 A;  5HUY C;  4ZDU A;  4HXT A;  3GAE A;  5EKG A;  1V18 A;  3IBV A;  4CRV B;  3Q0O A;  4BQK A;  1IBR B;  3O2T A;  4UAE A;  5CLD A;  1O6O A;  3EA5 B;  3AU3 A;  3KND A;  3UL0 B;  2BAP A;  3GNI A;  2IX3 A;  5EWP A;  2BNX A;  4DB9 A;  4QMH A;  2QMR A;  2JAK A;  3TPO A;  4I37 A;  1GCJ A;  4E4V A;  4I2S A;  4D49 A;  3K7V A;  3Q0L A;  2C1M A;  5BZV A;  2JDQ A;  1TH1 A;  4U3J C;  4HM9 A;  4YJE A;  4EV8 A;  4B8P A;  4DVG B;  3FGA A;  2JKR B;  1Y2A C;  2NPP B;  3L3Q A;  5EKF A;  3K5Z A;  1W9C A;  4P6Z G;  4EV9 A;  1IB2 A;  3V71 A;  2OF3 A;  4DJS A;  4PLQ A;  4UAD A;  4YJL A;  4I6I A;  4B8O A;  5J3V A;  4EVA A;  3K61 A;  5H2X A;  3L6Y A;  1G3J A;  1Q1S C;  4FZF A;  4G3A A;  4UQI A;  4I8M A;  3LWW A;  4RXH B;  2Z5K A;  5KLT B;  3TX7 A;  4MFV A;  3V74 A;  3K62 A;  5CL7 A;  3Q0S A;  4U5S A;  1O6P A;  3IFQ A;  2VGL B;  4FP7 A;  1Z2C B;  4B18 A;  1XM9 A;  2YNR A;  3ZKV A;  3BSB A;  3BTR C;  1TE4 A;  3Q0M A;  4D4E A;  5BYM A;  4YK6 A;  4PLS A;  4V3O A;  3RZ9 A;  2GL7 A;  2X1G F;  1N4K A;  4FDD A;  3VWA A;  3NOW A;  4U5L A;  4DB8 A;  5BZ5 A;  3ZIO A;  4RZP A;  3L3F X;  4Y5J A;  5CLC A;  4JW3 C;  3C2G A;  4MZ6 E;  1M5N S;  5CLA A;  4L4I A;  2QK2 A;  3GVO A;  4WV6 A;  4XZR B;  3L6X A;  4I5L A;  1UPK A;  1QBK B;  2C1T A;  1W63 B;  1BK5 A;  5AEI A;  5KL8 A;  4I7I A;  5SVZ A;  2BCT A;  4IMJ A;  3QHE A;  3T7U A;  2IWH A;  1W63 A;  2F31 A;  5JJA A;  2XA7 B;  5D5K C;  3TT9 A;  4FZA A;  3BVS A;  5BZ1 A;  5KL1 A;  4HNM A;  1EE4 A;  3NMX A;  3PSP A;  2XA7 A;  3K4E A;  3WYF C;  4A3V A;  5CLB A;  3Q0P A;  3ZIN A;  2OT8 A;  4MFU A;  3BSX A;  3ODS A;  4I2Z A;  1JPP A;  1QGR A;  5CL5 A;  3UKY B;  2X19 B;  3K5Q A;  5KLR B;  4ADY A;  3Q5U A;  3H3D X;  1JPW A;  1LUJ A;  4FZD A;  3O4X A;  5KUB A;  3UKX B;  3UKZ B;  1Q1T C;  3GB8 A;  4A3T A;  4A0C A;  4V3R A;  1IQ1 C;  3UL1 B;  1U6G C;  5K6S A;  2JKR A;  4K92 A;  3A6P A;  1OYZ A;  4L4H A;  4U5V A;  2NPP A;  4QMI A;  3UVU A;  3VLD A;  4BPL A;  4BA3 A;  3SL9 A;  4P6Z B;  5SW9 A;  1M1E A;  1M8Y A;  2QNA A;  4FFB C;  5LSW A;  4OO6 A;  3GS3 A;  2FV2 A;  4H3K A;  3K7W A;  4FQ3 A;  2IE3 A;  3EBB A;  3O2Q A;  4UWX A;  3JX7 A;  5E6Q B;  2JKT B;  2XOA A;  3ND2 A;  3TJZ B;  2QK1 A;  4DZS A;  1PJM B;  4CB9 A;  3Q0Q A;  3NMW A;  2VGL A;  4RV1 A;  3QGB A;  2Z5N A;  3FEY C;  2Z5M A;  3ZIQ A;  4GMN A;  3TPM A;  3NMZ A;  2NYM B;  4DBA A;  4JW2 B;  4PVZ A;  3RZX A;  3ZIK A;  5CL8 A;  1EJY I;  3BWT A;  2RU4 B;  4IMI A;  4I5N A;  4NZW A;  3K5Y A;  2NYM A;  4CBA A;  1M8W A;  1XQR A;  4CT7 B;  5B56 A;  5K9S A;  1T08 A;  1WA5 B;  4O27 A;  4HTV A;  3GVT A;  2W3C A;  2NYL B;  2IE4 A;  3GRL A;  1I7W A;  5DN7 A;  2NYL A;  3OPB A;  3BX3 A;  4YGX A;  3OBV A;  3ZIP A;  4U5U A;  1I7X A;  1UPL A;  3QG9 A;  2IAE B;  1QGK A;  1WA5 C;  5CL9 A;  1LRV A;  4CB8 A;  3VLE A;  3LTM A;  3QGC A;  4CT6 B;  4I1E A;  2IAE A;  3JXZ A;  3ODR A;  2P8Q A;  3SLA A;  3DW8 A;  3EG5 B;  4KZG A;  4R11 A;  3K64 A;  4MZ5 E;  3WOZ A;  3JXY A;  3O2S A;  4CV5 B;  3LTJ A;  4U2X D;  4B8J A;  2WTK A;  3JY1 A;  4U54 A;  3FEX C;  3ZIR A;  4U58 A;  4PLR A;  4JLQ A; 
#chains in the Genus database with same CATH homology
 5SWF A;  3W3U A;  5CL6 A;  1XQS A;  1BK6 A;  4OIH A;  4TNM A;  3FGA B;  4R0Z A;  1M8X A;  1UKL A;  4I2W A;  4CRU B;  2Z6G A;  3VLF A;  4JKQ A;  2Z5O A;  4NEE A;  4I96 A;  4L7M A;  4EVT A;  2YNS A;  3DAD A;  2IW3 A;  1B3U A;  3OQS A;  5BZU A;  5CL3 A;  4UQI B;  3C5W A;  4I3N A;  5HUW C;  4V3Q A;  3UKW B;  4U5N A;  4K6J A;  2JKT A;  3K49 A;  3WOY A;  2PKG A;  4LAC A;  4DB6 A;  3Q0R A;  5CL4 A;  2H4M A;  1IAL A;  4I0Y A;  5CLE A;  4UAF B;  1PJN B;  3TJ3 A;  5CTT A;  4JW2 A;  1EE5 A;  1UN0 A;  2DB0 A;  4H3H A;  3V6Y A;  2RU4 A;  4U5O A;  4EVP A;  3GQ2 A;  2BKU B;  2Z5J A;  1M8Z A;  1JDH A;  3OUW A;  3ZIL A;  2PF4 A;  3BX2 A;  3BCT A;  3OUX A;  3QML C;  3VE6 A;  1HO8 A;  3WPT A;  1F59 A;  2Q5D A;  2YJY A;  3Q0N A;  5KLA A;  3ZHP A;  2Z6H A;  5H2W A;  4R10 A;  4GMO A;  4YI0 C;  5FC8 E;  3PST A;  4QMJ A;  3C2H A;  5HHG E;  1EJL I;  1QZ7 A;  5HUY C;  4ZDU A;  4HXT A;  3GAE A;  5EKG A;  1V18 A;  3IBV A;  4CRV B;  3Q0O A;  4BQK A;  1IBR B;  3O2T A;  4UAE A;  5CLD A;  1O6O A;  3EA5 B;  3AU3 A;  3KND A;  3UL0 B;  2BAP A;  3GNI A;  2IX3 A;  5EWP A;  2BNX A;  4DB9 A;  4QMH A;  2QMR A;  2JAK A;  3TPO A;  4I37 A;  1GCJ A;  4E4V A;  4I2S A;  4D49 A;  3K7V A;  3Q0L A;  2C1M A;  5BZV A;  2JDQ A;  1TH1 A;  4U3J C;  4HM9 A;  4YJE A;  4EV8 A;  4B8P A;  4DVG B;  3FGA A;  2JKR B;  1Y2A C;  2NPP B;  3L3Q A;  5EKF A;  3K5Z A;  1W9C A;  4P6Z G;  4EV9 A;  1IB2 A;  3V71 A;  2OF3 A;  4DJS A;  4PLQ A;  4UAD A;  4YJL A;  4I6I A;  4B8O A;  5J3V A;  4EVA A;  3K61 A;  5H2X A;  3L6Y A;  1G3J A;  1Q1S C;  4FZF A;  4G3A A;  4UQI A;  4I8M A;  3LWW A;  4RXH B;  2Z5K A;  5KLT B;  3TX7 A;  4MFV A;  3V74 A;  3K62 A;  5CL7 A;  3Q0S A;  4U5S A;  1O6P A;  3IFQ A;  2VGL B;  4FP7 A;  1Z2C B;  4B18 A;  1XM9 A;  2YNR A;  3ZKV A;  3BSB A;  3BTR C;  1TE4 A;  3Q0M A;  4D4E A;  5BYM A;  4YK6 A;  4PLS A;  4V3O A;  3RZ9 A;  2GL7 A;  2X1G F;  4FDD A;  3VWA A;  3NOW A;  4U5L A;  4DB8 A;  5BZ5 A;  3ZIO A;  4RZP A;  3L3F X;  4Y5J A;  5CLC A;  4JW3 C;  3C2G A;  4MZ6 E;  1M5N S;  5CLA A;  4L4I A;  2QK2 A;  3GVO A;  4WV6 A;  4XZR B;  3L6X A;  4I5L A;  1UPK A;  1QBK B;  2C1T A;  1W63 B;  1BK5 A;  5AEI A;  5KL8 A;  4I7I A;  5SVZ A;  2BCT A;  4IMJ A;  3QHE A;  3T7U A;  2IWH A;  1W63 A;  2F31 A;  5JJA A;  2XA7 B;  5D5K C;  3TT9 A;  4FZA A;  3BVS A;  5BZ1 A;  5KL1 A;  4HNM A;  1EE4 A;  3NMX A;  3PSP A;  2XA7 A;  3K4E A;  3WYF C;  4A3V A;  5CLB A;  3Q0P A;  3ZIN A;  2OT8 A;  4MFU A;  3BSX A;  3ODS A;  4I2Z A;  1JPP A;  1QGR A;  5CL5 A;  3UKY B;  2X19 B;  3K5Q A;  5KLR B;  4ADY A;  3Q5U A;  3H3D X;  1JPW A;  1LUJ A;  4FZD A;  3O4X A;  5KUB A;  3UKX B;  3UKZ B;  1Q1T C;  3GB8 A;  4A3T A;  4A0C A;  4V3R A;  1IQ1 C;  3UL1 B;  1U6G C;  5K6S A;  2JKR A;  4K92 A;  3A6P A;  1OYZ A;  4L4H A;  4U5V A;  2NPP A;  4QMI A;  3UVU A;  3VLD A;  4BPL A;  4BA3 A;  3SL9 A;  4P6Z B;  5SW9 A;  1M1E A;  1M8Y A;  2QNA A;  4FFB C;  5LSW A;  4OO6 A;  3GS3 A;  2FV2 A;  4H3K A;  3K7W A;  4FQ3 A;  2IE3 A;  3EBB A;  3O2Q A;  4UWX A;  3JX7 A;  5E6Q B;  2JKT B;  2XOA A;  3ND2 A;  3TJZ B;  2QK1 A;  4DZS A;  1PJM B;  4CB9 A;  3Q0Q A;  3NMW A;  2VGL A;  4RV1 A;  3QGB A;  2Z5N A;  3FEY C;  2Z5M A;  3ZIQ A;  4GMN A;  3TPM A;  3NMZ A;  2NYM B;  4DBA A;  4JW2 B;  4PVZ A;  3RZX A;  3ZIK A;  5CL8 A;  1EJY I;  3BWT A;  2RU4 B;  4IMI A;  4I5N A;  4NZW A;  3K5Y A;  2NYM A;  4CBA A;  1M8W A;  1XQR A;  4CT7 B;  5B56 A;  5K9S A;  1T08 A;  1WA5 B;  4O27 A;  4HTV A;  3GVT A;  2W3C A;  2NYL B;  2IE4 A;  3GRL A;  1I7W A;  5DN7 A;  2NYL A;  3OPB A;  3BX3 A;  4YGX A;  3OBV A;  3ZIP A;  4U5U A;  1I7X A;  1UPL A;  3QG9 A;  2IAE B;  1QGK A;  1WA5 C;  5CL9 A;  1LRV A;  4CB8 A;  3VLE A;  3LTM A;  3QGC A;  4CT6 B;  4I1E A;  2IAE A;  3JXZ A;  3ODR A;  2P8Q A;  3SLA A;  3DW8 A;  3EG5 B;  4KZG A;  4R11 A;  3K64 A;  4MZ5 E;  3WOZ A;  3JXY A;  3O2S A;  4CV5 B;  3LTJ A;  4U2X D;  4B8J A;  2WTK A;  3JY1 A;  4U54 A;  3FEX C;  3ZIR A;  4U58 A;  4PLR A;  4JLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...