4PLRA

Crystal structures of designed armadillo repeat proteins: implications of construct design and crystallization conditions on overall structure.
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
289
structure length
289
Chain Sequence
SHHHHHHGSELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGAEPALEQLQSSPNEKIQKEAQEALEKIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arm00008
publication title Crystal structures of designed armadillo repeat proteins: Implications of construct design and crystallization conditions on overall structure.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Peptide binding protein
total genus 121
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 4plrA00
4XZRB 3QHEA 5LSWA 1BK6A 4TNMA 3K49A 4I5LA 5AEIA 4IMJA 3K7VA 4U5LA 3H3DX 4K6JA 1V18A 1Q1SC 3LTJA 4FDDA 4I5NA 3EG5B 4Y5JA 4G3AA 4EV9A 3V74A 3DW8A 2F31A 1Z2CB 2QMRA 3K62A 4UWXA 4U5SA 3BSXA 4FZDA 3OUXA 2IX3A 3Q5UA 3UL1B 5EKFA 3EA5B 5D5KC 2QK2A 1JPWA 4RXHB 1UPKA 3LWWA 3FGAA 3UL0B 4HM9A 4YI0C 4R0ZA 2DB0A 5FC8E 4PLSA 2C1TA 3Q0PA 1EJLI 2WTKA 5HUYC 1XM9A 3ODSA 3GB8A 3O2SA 4PVZA 2Q5DA 3FEYC 4YJLA 1IB2A 1B3UA 4EV8A 3ZHPA 4CRVB 4IMIA 2IAEA 3K7WA 5KLRB 3GQ2A 4UAEA 1PJMB 2X1GF 2BAPA 3TX7A 2NPPB 2Z6GA 3Q0NA 3WYFC 5DN7A 3PSPA 3PSTA 4EVAA 3ND2A 5KLAA 2Z5JA 2FV2A 4KZGA 1U6GC 2IAEB 1T08A 5HUWC 3W3UA 2IE3A 3RZXA 1QGKA 3WPTA 4CB8A 4U5OA 1GCJA 2RU4A 3NOWA 1M5NS 4U58A 4D4EA 4P6ZG 4QMHA 2QK1A 2NYLA 3TPMA 4BPLA 4DJSA 5SVZA 3K4EA 3L6XA 2XA7A 2YNSA 2JKTA 3ZIQA 3AU3A 3O2QA 1HO8A 2YJYA 2RU4B 2NYMB 4FFBC 3GAEA 4RV1A 1JPPA 3L3QA 4U5NA 4B8PA 3L6YA 4V3QA 2NYLB 3Q0QA 5HHGE 2XA7B 3OUWA 3UKWB 2JKTB 4DVGB 4EVPA 4I2ZA 4E4VA 1WA5B 2JDQA 1M8ZA 4PLQA 1Y2AC 4HNMA 3UKZB 5B56A 1QGRA 3TT9A 4MZ5E 4QMJA 4B8OA 4LACA 4EVTA 3LTMA 3K5ZA 3ODRA 4R10A 5K6SA 2VGLA 2BNXA 5BZ1A 4ZDUA 4O27A 4U5VA 5CTTA 2JAKA 5SW9A 3OPBA 5SWFA 1I7XA 3QG9A 1UN0A 4V3OA 5KL1A 3ZKVA 2VGLB 3BX3A 3T7UA 2BKUB 3Q0OA 2Z5NA 3FGAB 3QGBA 4U5UA 4DB6A 4WV6A 1XQSA 3RZ9A 3DADA 1W63A 4NEEA 4I2WA 4DB8A 4B8JA 2Z6HA 4DZSA 5J3VA 3UKXB 4JW2B 1OYZA 1TH1A 3GVOA 2IWHA 1EE5A 4CRUB 3BSBA 1W63B 2QNAA 3GNIA 4OO6A 3VE6A 1IBRB 3BTRC 4RZPA 2Z5MA 4FQ3A 4H3HA 1IQ1C 5BYMA 3FEXC 5KL8A 3UVUA 4GMNA 4MFUA 4CBAA 4H3KA 3OQSA 4YJEA 2W3CA 1G3JA 2IE4A 3O4XA 4ADYA 1I7WA 1PJNB 1UPLA 3C2HA 3Q0LA 2OT8A 2GL7A 3BWTA 1Q1TC 4DB9A 2P8QA 3GRLA 4L7MA 4BA3A 3Q0MA 4YK6A 3K61A 3ZIRA 3GS3A 3UKYB 4CT7B 1XQRA 3K5YA 3OBVA 3TPOA 2Z5OA 1LUJA 5EWPA 4P6ZB 4A0CA 3IFQA 4JLQA 4UAFB 3IBVA 1F59A 5E6QB 4FZFA 2IW3A 3Q0RA 3C5WA 3KNDA 1M1EA 3O2TA 3VWAA 1EE4A 5K9SA 1M8WA 4U54A 4HXTA 2PKGA 4CT6B 4MFVA 4BQKA 1M8YA 2YNRA 3ZINA 1EJYI 2PF4A 2C1MA 3L3FX 4CB9A 5EKGA 4CV5B 1O6PA 4YGXA 3V71A 3K5QA 4OIHA 5BZ5A 2Z5KA 5H2WA 2X19B 2H4MA 3EBBA 4UQIA 2NPPA 1O6OA 1WA5C 3K64A 3C2GA 2JKRA 1JDHA 1QZ7A 4V3RA 1LRVA 3QMLC 3ZIPA 3Q0SA 3NMWA 4B18A 3QGCA 5KLTB 4QMIA 3TJ3A 2BCTA 4NZWA 4PLRA 4UQIB 4DBAA 5BZUA 3BCTA 5BZVA 1UKLA 2JKRB 4HTVA 3A6PA 3BX2A 4UADA 4D49A 5JJAA 3WOZA 4MZ6E 4U3JC 1M8XA 2OF3A 3TJZB 3V6YA 3ZIOA 2NYMA 4K92A 4R11A 5H2XA 1BK5A 4FZAA 3WOYA 1IALA 3NMXA 1QBKB 3NMZA 3GVTA 4GMOA 1W9CA
chains in the Genus database with same CATH superfamily
4XZRB 4L4IA 3QHEA 5LSWA 1BK6A 4TNMA 3K49A 4I5LA 5AEIA 4IMJA 3K7VA 3SL9A 4U5LA 3H3DX 4K6JA 1V18A 1Q1SC 3LTJA 4FDDA 4I5NA 3EG5B 4Y5JA 4G3AA 4EV9A 3V74A 5CLEA 4JW3C 3DW8A 2F31A 1Z2CB 2QMRA 3K62A 4UWXA 4U5SA 3BSXA 4FZDA 3OUXA 2IX3A 3UJ0A 5CL7A 3Q5UA 3UL1B 5EKFA 3EA5B 5D5KC 2QK2A 3UJ4A 1JPWA 4RXHB 1UPKA 3LWWA 3FGAA 3UL0B 4HM9A 4YI0C 4R0ZA 2DB0A 5CL5A 5FC8E 4PLSA 2C1TA 3Q0PA 1EJLI 2WTKA 5HUYC 1XM9A 3ODSA 3GB8A 3O2SA 5CL4A 4PVZA 2Q5DA 3FEYC 4YJLA 1IB2A 3JX7A 1B3UA 4EV8A 3ZHPA 4CRVB 4IMIA 2IAEA 3K7WA 5KLRB 3GQ2A 4UAEA 1PJMB 2X1GF 2BAPA 3TX7A 4I2SA 2NPPB 5CLAA 2Z6GA 3Q0NA 3VLEA 3WYFC 5DN7A 3PSPA 3PSTA 4EVAA 3ND2A 5KLAA 2Z5JA 4I3NA 2FV2A 4KZGA 1U6GC 2IAEB 1T08A 5HUWC 3W3UA 2IE3A 3RZXA 1QGKA 3WPTA 4CB8A 4U5OA 1GCJA 2RU4A 3NOWA 1M5NS 4U58A 4D4EA 4P6ZG 4QMHA 2QK1A 2NYLA 3TPMA 4BPLA 4DJSA 5SVZA 3K4EA 3L6XA 4I8MA 2XA7A 2YNSA 2JKTA 3ZIQA 3AU3A 3O2QA 1HO8A 2YJYA 2RU4B 2NYMB 4FFBC 3GAEA 4RV1A 1JPPA 3L3QA 4U5NA 4B8PA 4I0YA 3L6YA 3JY1A 5KUBA 4V3QA 2NYLB 3Q0QA 5HHGE 2XA7B 3OUWA 3UKWB 2JKTB 4DVGB 4EVPA 4I2ZA 4E4VA 1N4KA 1WA5B 2JDQA 1M8ZA 4PLQA 1Y2AC 4HNMA 3UKZB 5B56A 1QGRA 3ZILA 3TT9A 4MZ5E 4QMJA 4B8OA 4LACA 4EVTA 3LTMA 3K5ZA 3ODRA 4R10A 5K6SA 2VGLA 2BNXA 5BZ1A 4ZDUA 4O27A 4U5VA 5CTTA 2JAKA 5SW9A 3OPBA 5SWFA 1I7XA 3QG9A 1UN0A 4V3OA 5KL1A 5CL8A 3ZKVA 4JW2A 2VGLB 3JXZA 3BX3A 3T7UA 2BKUB 3Q0OA 5CLBA 2Z5NA 3FGAB 3QGBA 4U5UA 4DB6A 4WV6A 1XQSA 3RZ9A 3DADA 1W63A 4NEEA 4I2WA 4DB8A 4B8JA 2Z6HA 4DZSA 5J3VA 3UKXB 4JW2B 1OYZA 1TH1A 3GVOA 2IWHA 3VLDA 1EE5A 4CRUB 3BSBA 1TE4A 1W63B 1LSHA 2QNAA 3GNIA 4OO6A 3VE6A 1IBRB 2XOAA 3BTRC 4RZPA 2Z5MA 4FQ3A 3VLFA 4H3HA 1IQ1C 5BYMA 3BVSA 3FEXC 5KL8A 3UVUA 4GMNA 4MFUA 4CBAA 4H3KA 3OQSA 4YJEA 2W3CA 1G3JA 2IE4A 3O4XA 4ADYA 4U2XD 1I7WA 5CL3A 1PJNB 1UPLA 3C2HA 3Q0LA 2OT8A 2GL7A 3BWTA 3T8SA 3ZIKA 1Q1TC 4DB9A 2P8QA 3GRLA 4L7MA 4BA3A 3Q0MA 4YK6A 3K61A 3ZIRA 3GS3A 3UKYB 4CT7B 1XQRA 3K5YA 3OBVA 3TPOA 2Z5OA 4I7IA 1LUJA 5EWPA 4P6ZB 4A0CA 3IFQA 4JLQA 5CLCA 4UAFB 3IBVA 1F59A 5E6QB 4FZFA 2IW3A 3Q0RA 3C5WA 3KNDA 1M1EA 3O2TA 5CL9A 3VWAA 1EE4A 5K9SA 4FP7A 1M8WA 4U54A 4HXTA 2PKGA 4CT6B 4L4HA 4MFVA 4BQKA 1M8YA 2YNRA 3ZINA 1EJYI 4I37A 2PF4A 2C1MA 3L3FX 4CB9A 5EKGA 4CV5B 1O6PA 4YGXA 3V71A 3K5QA 4OIHA 5BZ5A 2Z5KA 5H2WA 2X19B 2H4MA 5CLDA 3EBBA 4UQIA 2NPPA 1O6OA 1WA5C 3K64A 3C2GA 2JKRA 1JDHA 5CL6A 1QZ7A 4V3RA 1LRVA 3QMLC 3ZIPA 3Q0SA 3NMWA 4B18A 3QGCA 5KLTB 4QMIA 3TJ3A 2BCTA 4NZWA 4PLRA 4UQIB 4DBAA 5BZUA 3BCTA 4I96A 5BZVA 1UKLA 2JKRB 4A3VA 4HTVA 3A6PA 4A3TA 4I6IA 3BX2A 4UADA 4D49A 5JJAA 3WOZA 4JKQA 4MZ6E 4U3JC 4I1EA 1M8XA 2OF3A 3TJZB 3JXYA 3V6YA 3ZIOA 2NYMA 4K92A 4R11A 5H2XA 1BK5A 4FZAA 3WOYA 3SLAA 1IALA 3NMXA 1QBKB 3NMZA 3GVTA 4GMOA 1W9CA
chains in the Genus database with same CATH topology
4XZRB 4L4IA 3QHEA 5LSWA 1BK6A 4TNMA 3K49A 4I5LA 5AEIA 4IMJA 3K7VA 3SL9A 4U5LA 3H3DX 4K6JA 1V18A 1Q1SC 3LTJA 4FDDA 4I5NA 3EG5B 4Y5JA 4G3AA 4EV9A 3V74A 5CLEA 4JW3C 3DW8A 2F31A 1Z2CB 2QMRA 3K62A 4UWXA 4U5SA 3BSXA 4FZDA 3OUXA 2IX3A 5CL7A 3Q5UA 3UL1B 5EKFA 3EA5B 5D5KC 2QK2A 1JPWA 4RXHB 1UPKA 3LWWA 3FGAA 3UL0B 4HM9A 4YI0C 4R0ZA 2DB0A 5CL5A 5FC8E 4PLSA 2C1TA 3Q0PA 1EJLI 2WTKA 5HUYC 1XM9A 3ODSA 3GB8A 3O2SA 5CL4A 4PVZA 2Q5DA 3FEYC 4YJLA 1IB2A 3JX7A 1B3UA 4EV8A 3ZHPA 4CRVB 4IMIA 2IAEA 3K7WA 5KLRB 3GQ2A 4UAEA 1PJMB 2X1GF 2BAPA 3TX7A 4I2SA 2NPPB 5CLAA 2Z6GA 3Q0NA 3VLEA 3WYFC 5DN7A 3PSPA 3PSTA 4EVAA 3ND2A 5KLAA 2Z5JA 4I3NA 2FV2A 4KZGA 1U6GC 2IAEB 1T08A 5HUWC 3W3UA 2IE3A 3RZXA 1QGKA 3WPTA 4CB8A 4U5OA 1GCJA 2RU4A 3NOWA 1M5NS 4U58A 4D4EA 4P6ZG 4QMHA 2QK1A 2NYLA 3TPMA 4BPLA 4DJSA 5SVZA 3K4EA 3L6XA 4I8MA 2XA7A 2YNSA 2JKTA 3ZIQA 3AU3A 3O2QA 1HO8A 2YJYA 2RU4B 2NYMB 4FFBC 3GAEA 4RV1A 1JPPA 3L3QA 4U5NA 4B8PA 4I0YA 3L6YA 3JY1A 5KUBA 4V3QA 2NYLB 3Q0QA 5HHGE 2XA7B 3OUWA 3UKWB 2JKTB 4DVGB 4EVPA 4I2ZA 4E4VA 1WA5B 2JDQA 1M8ZA 4PLQA 1Y2AC 4HNMA 3UKZB 5B56A 1QGRA 3ZILA 3TT9A 4MZ5E 4QMJA 4B8OA 4LACA 4EVTA 3LTMA 3K5ZA 3ODRA 4R10A 5K6SA 2VGLA 2BNXA 5BZ1A 4ZDUA 4O27A 4U5VA 5CTTA 2JAKA 5SW9A 3OPBA 5SWFA 1I7XA 3QG9A 1UN0A 4V3OA 5KL1A 5CL8A 3ZKVA 4JW2A 2VGLB 3JXZA 3BX3A 3T7UA 2BKUB 3Q0OA 5CLBA 2Z5NA 3FGAB 3QGBA 4U5UA 4DB6A 4WV6A 1XQSA 3RZ9A 3DADA 1W63A 4NEEA 4I2WA 4DB8A 4B8JA 2Z6HA 4DZSA 5J3VA 3UKXB 4JW2B 1OYZA 1TH1A 3GVOA 2IWHA 3VLDA 1EE5A 4CRUB 3BSBA 1TE4A 1W63B 2QNAA 3GNIA 4OO6A 3VE6A 1IBRB 2XOAA 3BTRC 4RZPA 2Z5MA 4FQ3A 3VLFA 4H3HA 1IQ1C 5BYMA 3BVSA 3FEXC 5KL8A 3UVUA 4GMNA 4MFUA 4CBAA 4H3KA 3OQSA 4YJEA 2W3CA 1G3JA 2IE4A 3O4XA 4ADYA 4U2XD 1I7WA 5CL3A 1PJNB 1UPLA 3C2HA 3Q0LA 2OT8A 2GL7A 3BWTA 3ZIKA 1Q1TC 4DB9A 2P8QA 3GRLA 4L7MA 4BA3A 3Q0MA 4YK6A 3K61A 3ZIRA 3GS3A 3UKYB 4CT7B 1XQRA 3K5YA 3OBVA 3TPOA 2Z5OA 4I7IA 1LUJA 5EWPA 4P6ZB 4A0CA 3IFQA 4JLQA 5CLCA 4UAFB 3IBVA 1F59A 5E6QB 4FZFA 2IW3A 3Q0RA 3C5WA 3KNDA 1M1EA 3O2TA 5CL9A 3VWAA 1EE4A 5K9SA 4FP7A 1M8WA 4U54A 4HXTA 2PKGA 4CT6B 4L4HA 4MFVA 4BQKA 1M8YA 2YNRA 3ZINA 1EJYI 4I37A 2PF4A 2C1MA 3L3FX 4CB9A 5EKGA 4CV5B 1O6PA 4YGXA 3V71A 3K5QA 4OIHA 5BZ5A 2Z5KA 5H2WA 2X19B 2H4MA 5CLDA 3EBBA 4UQIA 2NPPA 1O6OA 1WA5C 3K64A 3C2GA 2JKRA 1JDHA 5CL6A 1QZ7A 4V3RA 1LRVA 3QMLC 3ZIPA 3Q0SA 3NMWA 4B18A 3QGCA 5KLTB 4QMIA 3TJ3A 2BCTA 4NZWA 4PLRA 4UQIB 4DBAA 5BZUA 3BCTA 4I96A 5BZVA 1UKLA 2JKRB 4A3VA 4HTVA 3A6PA 4A3TA 4I6IA 3BX2A 4UADA 4D49A 5JJAA 3WOZA 4JKQA 4MZ6E 4U3JC 4I1EA 1M8XA 2OF3A 3TJZB 3JXYA 3V6YA 3ZIOA 2NYMA 4K92A 4R11A 5H2XA 1BK5A 4FZAA 3WOYA 3SLAA 1IALA 3NMXA 1QBKB 3NMZA 3GVTA 4GMOA 1W9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XZR B;  3QHE A;  5LSW A;  1BK6 A;  4TNM A;  3K49 A;  4I5L A;  5AEI A;  4IMJ A;  3K7V A;  4U5L A;  3H3D X;  4K6J A;  1V18 A;  1Q1S C;  3LTJ A;  4FDD A;  4I5N A;  3EG5 B;  4Y5J A;  4G3A A;  4EV9 A;  3V74 A;  3DW8 A;  2F31 A;  1Z2C B;  2QMR A;  3K62 A;  4UWX A;  4U5S A;  3BSX A;  4FZD A;  3OUX A;  2IX3 A;  3Q5U A;  3UL1 B;  5EKF A;  3EA5 B;  5D5K C;  2QK2 A;  1JPW A;  4RXH B;  1UPK A;  3LWW A;  3FGA A;  3UL0 B;  4HM9 A;  4YI0 C;  4R0Z A;  2DB0 A;  5FC8 E;  4PLS A;  2C1T A;  3Q0P A;  1EJL I;  2WTK A;  5HUY C;  1XM9 A;  3ODS A;  3GB8 A;  3O2S A;  4PVZ A;  2Q5D A;  3FEY C;  4YJL A;  1IB2 A;  1B3U A;  4EV8 A;  3ZHP A;  4CRV B;  4IMI A;  2IAE A;  3K7W A;  5KLR B;  3GQ2 A;  4UAE A;  1PJM B;  2X1G F;  2BAP A;  3TX7 A;  2NPP B;  2Z6G A;  3Q0N A;  3WYF C;  5DN7 A;  3PSP A;  3PST A;  4EVA A;  3ND2 A;  5KLA A;  2Z5J A;  2FV2 A;  4KZG A;  1U6G C;  2IAE B;  1T08 A;  5HUW C;  3W3U A;  2IE3 A;  3RZX A;  1QGK A;  3WPT A;  4CB8 A;  4U5O A;  1GCJ A;  2RU4 A;  3NOW A;  1M5N S;  4U58 A;  4D4E A;  4P6Z G;  4QMH A;  2QK1 A;  2NYL A;  3TPM A;  4BPL A;  4DJS A;  5SVZ A;  3K4E A;  3L6X A;  2XA7 A;  2YNS A;  2JKT A;  3ZIQ A;  3AU3 A;  3O2Q A;  1HO8 A;  2YJY A;  2RU4 B;  2NYM B;  4FFB C;  3GAE A;  4RV1 A;  1JPP A;  3L3Q A;  4U5N A;  4B8P A;  3L6Y A;  4V3Q A;  2NYL B;  3Q0Q A;  5HHG E;  2XA7 B;  3OUW A;  3UKW B;  2JKT B;  4DVG B;  4EVP A;  4I2Z A;  4E4V A;  1WA5 B;  2JDQ A;  1M8Z A;  4PLQ A;  1Y2A C;  4HNM A;  3UKZ B;  5B56 A;  1QGR A;  3TT9 A;  4MZ5 E;  4QMJ A;  4B8O A;  4LAC A;  4EVT A;  3LTM A;  3K5Z A;  3ODR A;  4R10 A;  5K6S A;  2VGL A;  2BNX A;  5BZ1 A;  4ZDU A;  4O27 A;  4U5V A;  5CTT A;  2JAK A;  5SW9 A;  3OPB A;  5SWF A;  1I7X A;  3QG9 A;  1UN0 A;  4V3O A;  5KL1 A;  3ZKV A;  2VGL B;  3BX3 A;  3T7U A;  2BKU B;  3Q0O A;  2Z5N A;  3FGA B;  3QGB A;  4U5U A;  4DB6 A;  4WV6 A;  1XQS A;  3RZ9 A;  3DAD A;  1W63 A;  4NEE A;  4I2W A;  4DB8 A;  4B8J A;  2Z6H A;  4DZS A;  5J3V A;  3UKX B;  4JW2 B;  1OYZ A;  1TH1 A;  3GVO A;  2IWH A;  1EE5 A;  4CRU B;  3BSB A;  1W63 B;  2QNA A;  3GNI A;  4OO6 A;  3VE6 A;  1IBR B;  3BTR C;  4RZP A;  2Z5M A;  4FQ3 A;  4H3H A;  1IQ1 C;  5BYM A;  3FEX C;  5KL8 A;  3UVU A;  4GMN A;  4MFU A;  4CBA A;  4H3K A;  3OQS A;  4YJE A;  2W3C A;  1G3J A;  2IE4 A;  3O4X A;  4ADY A;  1I7W A;  1PJN B;  1UPL A;  3C2H A;  3Q0L A;  2OT8 A;  2GL7 A;  3BWT A;  1Q1T C;  4DB9 A;  2P8Q A;  3GRL A;  4L7M A;  4BA3 A;  3Q0M A;  4YK6 A;  3K61 A;  3ZIR A;  3GS3 A;  3UKY B;  4CT7 B;  1XQR A;  3K5Y A;  3OBV A;  3TPO A;  2Z5O A;  1LUJ A;  5EWP A;  4P6Z B;  4A0C A;  3IFQ A;  4JLQ A;  4UAF B;  3IBV A;  1F59 A;  5E6Q B;  4FZF A;  2IW3 A;  3Q0R A;  3C5W A;  3KND A;  1M1E A;  3O2T A;  3VWA A;  1EE4 A;  5K9S A;  1M8W A;  4U54 A;  4HXT A;  2PKG A;  4CT6 B;  4MFV A;  4BQK A;  1M8Y A;  2YNR A;  3ZIN A;  1EJY I;  2PF4 A;  2C1M A;  3L3F X;  4CB9 A;  5EKG A;  4CV5 B;  1O6P A;  4YGX A;  3V71 A;  3K5Q A;  4OIH A;  5BZ5 A;  2Z5K A;  5H2W A;  2X19 B;  2H4M A;  3EBB A;  4UQI A;  2NPP A;  1O6O A;  1WA5 C;  3K64 A;  3C2G A;  2JKR A;  1JDH A;  1QZ7 A;  4V3R A;  1LRV A;  3QML C;  3ZIP A;  3Q0S A;  3NMW A;  4B18 A;  3QGC A;  5KLT B;  4QMI A;  3TJ3 A;  2BCT A;  4NZW A;  4PLR A;  4UQI B;  4DBA A;  5BZU A;  3BCT A;  5BZV A;  1UKL A;  2JKR B;  4HTV A;  3A6P A;  3BX2 A;  4UAD A;  4D49 A;  5JJA A;  3WOZ A;  4MZ6 E;  4U3J C;  1M8X A;  2OF3 A;  3TJZ B;  3V6Y A;  3ZIO A;  2NYM A;  4K92 A;  4R11 A;  5H2X A;  1BK5 A;  4FZA A;  3WOY A;  1IAL A;  3NMX A;  1QBK B;  3NMZ A;  3GVT A;  4GMO A;  1W9C A; 
#chains in the Genus database with same CATH topology
 4XZR B;  4L4I A;  3QHE A;  5LSW A;  1BK6 A;  4TNM A;  3K49 A;  4I5L A;  5AEI A;  4IMJ A;  3K7V A;  3SL9 A;  4U5L A;  3H3D X;  4K6J A;  1V18 A;  1Q1S C;  3LTJ A;  4FDD A;  4I5N A;  3EG5 B;  4Y5J A;  4G3A A;  4EV9 A;  3V74 A;  5CLE A;  4JW3 C;  3DW8 A;  2F31 A;  1Z2C B;  2QMR A;  3K62 A;  4UWX A;  4U5S A;  3BSX A;  4FZD A;  3OUX A;  2IX3 A;  3UJ0 A;  5CL7 A;  3Q5U A;  3UL1 B;  5EKF A;  3EA5 B;  5D5K C;  2QK2 A;  3UJ4 A;  1JPW A;  4RXH B;  1UPK A;  3LWW A;  3FGA A;  3UL0 B;  4HM9 A;  4YI0 C;  4R0Z A;  2DB0 A;  5CL5 A;  5FC8 E;  4PLS A;  2C1T A;  3Q0P A;  1EJL I;  2WTK A;  5HUY C;  1XM9 A;  3ODS A;  3GB8 A;  3O2S A;  5CL4 A;  4PVZ A;  2Q5D A;  3FEY C;  4YJL A;  1IB2 A;  3JX7 A;  1B3U A;  4EV8 A;  3ZHP A;  4CRV B;  4IMI A;  2IAE A;  3K7W A;  5KLR B;  3GQ2 A;  4UAE A;  1PJM B;  2X1G F;  2BAP A;  3TX7 A;  4I2S A;  2NPP B;  5CLA A;  2Z6G A;  3Q0N A;  3VLE A;  3WYF C;  5DN7 A;  3PSP A;  3PST A;  4EVA A;  3ND2 A;  5KLA A;  2Z5J A;  4I3N A;  2FV2 A;  4KZG A;  1U6G C;  2IAE B;  1T08 A;  5HUW C;  3W3U A;  2IE3 A;  3RZX A;  1QGK A;  3WPT A;  4CB8 A;  4U5O A;  1GCJ A;  2RU4 A;  3NOW A;  1M5N S;  4U58 A;  4D4E A;  4P6Z G;  4QMH A;  2QK1 A;  2NYL A;  3TPM A;  4BPL A;  4DJS A;  5SVZ A;  3K4E A;  3L6X A;  4I8M A;  2XA7 A;  2YNS A;  2JKT A;  3ZIQ A;  3AU3 A;  3O2Q A;  1HO8 A;  2YJY A;  2RU4 B;  2NYM B;  4FFB C;  3GAE A;  4RV1 A;  1JPP A;  3L3Q A;  4U5N A;  4B8P A;  4I0Y A;  3L6Y A;  3JY1 A;  5KUB A;  4V3Q A;  2NYL B;  3Q0Q A;  5HHG E;  2XA7 B;  3OUW A;  3UKW B;  2JKT B;  4DVG B;  4EVP A;  4I2Z A;  4E4V A;  1N4K A;  1WA5 B;  2JDQ A;  1M8Z A;  4PLQ A;  1Y2A C;  4HNM A;  3UKZ B;  5B56 A;  1QGR A;  3ZIL A;  3TT9 A;  4MZ5 E;  4QMJ A;  4B8O A;  4LAC A;  4EVT A;  3LTM A;  3K5Z A;  3ODR A;  4R10 A;  5K6S A;  2VGL A;  2BNX A;  5BZ1 A;  4ZDU A;  4O27 A;  4U5V A;  5CTT A;  2JAK A;  5SW9 A;  3OPB A;  5SWF A;  1I7X A;  3QG9 A;  1UN0 A;  4V3O A;  5KL1 A;  5CL8 A;  3ZKV A;  4JW2 A;  2VGL B;  3JXZ A;  3BX3 A;  3T7U A;  2BKU B;  3Q0O A;  5CLB A;  2Z5N A;  3FGA B;  3QGB A;  4U5U A;  4DB6 A;  4WV6 A;  1XQS A;  3RZ9 A;  3DAD A;  1W63 A;  4NEE A;  4I2W A;  4DB8 A;  4B8J A;  2Z6H A;  4DZS A;  5J3V A;  3UKX B;  4JW2 B;  1OYZ A;  1TH1 A;  3GVO A;  2IWH A;  3VLD A;  1EE5 A;  4CRU B;  3BSB A;  1TE4 A;  1W63 B;  1LSH A;  2QNA A;  3GNI A;  4OO6 A;  3VE6 A;  1IBR B;  2XOA A;  3BTR C;  4RZP A;  2Z5M A;  4FQ3 A;  3VLF A;  4H3H A;  1IQ1 C;  5BYM A;  3BVS A;  3FEX C;  5KL8 A;  3UVU A;  4GMN A;  4MFU A;  4CBA A;  4H3K A;  3OQS A;  4YJE A;  2W3C A;  1G3J A;  2IE4 A;  3O4X A;  4ADY A;  4U2X D;  1I7W A;  5CL3 A;  1PJN B;  1UPL A;  3C2H A;  3Q0L A;  2OT8 A;  2GL7 A;  3BWT A;  3T8S A;  3ZIK A;  1Q1T C;  4DB9 A;  2P8Q A;  3GRL A;  4L7M A;  4BA3 A;  3Q0M A;  4YK6 A;  3K61 A;  3ZIR A;  3GS3 A;  3UKY B;  4CT7 B;  1XQR A;  3K5Y A;  3OBV A;  3TPO A;  2Z5O A;  4I7I A;  1LUJ A;  5EWP A;  4P6Z B;  4A0C A;  3IFQ A;  4JLQ A;  5CLC A;  4UAF B;  3IBV A;  1F59 A;  5E6Q B;  4FZF A;  2IW3 A;  3Q0R A;  3C5W A;  3KND A;  1M1E A;  3O2T A;  5CL9 A;  3VWA A;  1EE4 A;  5K9S A;  4FP7 A;  1M8W A;  4U54 A;  4HXT A;  2PKG A;  4CT6 B;  4L4H A;  4MFV A;  4BQK A;  1M8Y A;  2YNR A;  3ZIN A;  1EJY I;  4I37 A;  2PF4 A;  2C1M A;  3L3F X;  4CB9 A;  5EKG A;  4CV5 B;  1O6P A;  4YGX A;  3V71 A;  3K5Q A;  4OIH A;  5BZ5 A;  2Z5K A;  5H2W A;  2X19 B;  2H4M A;  5CLD A;  3EBB A;  4UQI A;  2NPP A;  1O6O A;  1WA5 C;  3K64 A;  3C2G A;  2JKR A;  1JDH A;  5CL6 A;  1QZ7 A;  4V3R A;  1LRV A;  3QML C;  3ZIP A;  3Q0S A;  3NMW A;  4B18 A;  3QGC A;  5KLT B;  4QMI A;  3TJ3 A;  2BCT A;  4NZW A;  4PLR A;  4UQI B;  4DBA A;  5BZU A;  3BCT A;  4I96 A;  5BZV A;  1UKL A;  2JKR B;  4A3V A;  4HTV A;  3A6P A;  4A3T A;  4I6I A;  3BX2 A;  4UAD A;  4D49 A;  5JJA A;  3WOZ A;  4JKQ A;  4MZ6 E;  4U3J C;  4I1E A;  1M8X A;  2OF3 A;  3TJZ B;  3JXY A;  3V6Y A;  3ZIO A;  2NYM A;  4K92 A;  4R11 A;  5H2X A;  1BK5 A;  4FZA A;  3WOY A;  3SLA A;  1IAL A;  3NMX A;  1QBK B;  3NMZ A;  3GVT A;  4GMO A;  1W9C A; 
#chains in the Genus database with same CATH homology
 4XZR B;  4L4I A;  3QHE A;  5LSW A;  1BK6 A;  4TNM A;  3K49 A;  4I5L A;  5AEI A;  4IMJ A;  3K7V A;  3SL9 A;  4U5L A;  3H3D X;  4K6J A;  1V18 A;  1Q1S C;  3LTJ A;  4FDD A;  4I5N A;  3EG5 B;  4Y5J A;  4G3A A;  4EV9 A;  3V74 A;  5CLE A;  4JW3 C;  3DW8 A;  2F31 A;  1Z2C B;  2QMR A;  3K62 A;  4UWX A;  4U5S A;  3BSX A;  4FZD A;  3OUX A;  2IX3 A;  5CL7 A;  3Q5U A;  3UL1 B;  5EKF A;  3EA5 B;  5D5K C;  2QK2 A;  1JPW A;  4RXH B;  1UPK A;  3LWW A;  3FGA A;  3UL0 B;  4HM9 A;  4YI0 C;  4R0Z A;  2DB0 A;  5CL5 A;  5FC8 E;  4PLS A;  2C1T A;  3Q0P A;  1EJL I;  2WTK A;  5HUY C;  1XM9 A;  3ODS A;  3GB8 A;  3O2S A;  5CL4 A;  4PVZ A;  2Q5D A;  3FEY C;  4YJL A;  1IB2 A;  3JX7 A;  1B3U A;  4EV8 A;  3ZHP A;  4CRV B;  4IMI A;  2IAE A;  3K7W A;  5KLR B;  3GQ2 A;  4UAE A;  1PJM B;  2X1G F;  2BAP A;  3TX7 A;  4I2S A;  2NPP B;  5CLA A;  2Z6G A;  3Q0N A;  3VLE A;  3WYF C;  5DN7 A;  3PSP A;  3PST A;  4EVA A;  3ND2 A;  5KLA A;  2Z5J A;  4I3N A;  2FV2 A;  4KZG A;  1U6G C;  2IAE B;  1T08 A;  5HUW C;  3W3U A;  2IE3 A;  3RZX A;  1QGK A;  3WPT A;  4CB8 A;  4U5O A;  1GCJ A;  2RU4 A;  3NOW A;  1M5N S;  4U58 A;  4D4E A;  4P6Z G;  4QMH A;  2QK1 A;  2NYL A;  3TPM A;  4BPL A;  4DJS A;  5SVZ A;  3K4E A;  3L6X A;  4I8M A;  2XA7 A;  2YNS A;  2JKT A;  3ZIQ A;  3AU3 A;  3O2Q A;  1HO8 A;  2YJY A;  2RU4 B;  2NYM B;  4FFB C;  3GAE A;  4RV1 A;  1JPP A;  3L3Q A;  4U5N A;  4B8P A;  4I0Y A;  3L6Y A;  3JY1 A;  5KUB A;  4V3Q A;  2NYL B;  3Q0Q A;  5HHG E;  2XA7 B;  3OUW A;  3UKW B;  2JKT B;  4DVG B;  4EVP A;  4I2Z A;  4E4V A;  1WA5 B;  2JDQ A;  1M8Z A;  4PLQ A;  1Y2A C;  4HNM A;  3UKZ B;  5B56 A;  1QGR A;  3ZIL A;  3TT9 A;  4MZ5 E;  4QMJ A;  4B8O A;  4LAC A;  4EVT A;  3LTM A;  3K5Z A;  3ODR A;  4R10 A;  5K6S A;  2VGL A;  2BNX A;  5BZ1 A;  4ZDU A;  4O27 A;  4U5V A;  5CTT A;  2JAK A;  5SW9 A;  3OPB A;  5SWF A;  1I7X A;  3QG9 A;  1UN0 A;  4V3O A;  5KL1 A;  5CL8 A;  3ZKV A;  4JW2 A;  2VGL B;  3JXZ A;  3BX3 A;  3T7U A;  2BKU B;  3Q0O A;  5CLB A;  2Z5N A;  3FGA B;  3QGB A;  4U5U A;  4DB6 A;  4WV6 A;  1XQS A;  3RZ9 A;  3DAD A;  1W63 A;  4NEE A;  4I2W A;  4DB8 A;  4B8J A;  2Z6H A;  4DZS A;  5J3V A;  3UKX B;  4JW2 B;  1OYZ A;  1TH1 A;  3GVO A;  2IWH A;  3VLD A;  1EE5 A;  4CRU B;  3BSB A;  1TE4 A;  1W63 B;  2QNA A;  3GNI A;  4OO6 A;  3VE6 A;  1IBR B;  2XOA A;  3BTR C;  4RZP A;  2Z5M A;  4FQ3 A;  3VLF A;  4H3H A;  1IQ1 C;  5BYM A;  3BVS A;  3FEX C;  5KL8 A;  3UVU A;  4GMN A;  4MFU A;  4CBA A;  4H3K A;  3OQS A;  4YJE A;  2W3C A;  1G3J A;  2IE4 A;  3O4X A;  4ADY A;  4U2X D;  1I7W A;  5CL3 A;  1PJN B;  1UPL A;  3C2H A;  3Q0L A;  2OT8 A;  2GL7 A;  3BWT A;  3ZIK A;  1Q1T C;  4DB9 A;  2P8Q A;  3GRL A;  4L7M A;  4BA3 A;  3Q0M A;  4YK6 A;  3K61 A;  3ZIR A;  3GS3 A;  3UKY B;  4CT7 B;  1XQR A;  3K5Y A;  3OBV A;  3TPO A;  2Z5O A;  4I7I A;  1LUJ A;  5EWP A;  4P6Z B;  4A0C A;  3IFQ A;  4JLQ A;  5CLC A;  4UAF B;  3IBV A;  1F59 A;  5E6Q B;  4FZF A;  2IW3 A;  3Q0R A;  3C5W A;  3KND A;  1M1E A;  3O2T A;  5CL9 A;  3VWA A;  1EE4 A;  5K9S A;  4FP7 A;  1M8W A;  4U54 A;  4HXT A;  2PKG A;  4CT6 B;  4L4H A;  4MFV A;  4BQK A;  1M8Y A;  2YNR A;  3ZIN A;  1EJY I;  4I37 A;  2PF4 A;  2C1M A;  3L3F X;  4CB9 A;  5EKG A;  4CV5 B;  1O6P A;  4YGX A;  3V71 A;  3K5Q A;  4OIH A;  5BZ5 A;  2Z5K A;  5H2W A;  2X19 B;  2H4M A;  5CLD A;  3EBB A;  4UQI A;  2NPP A;  1O6O A;  1WA5 C;  3K64 A;  3C2G A;  2JKR A;  1JDH A;  5CL6 A;  1QZ7 A;  4V3R A;  1LRV A;  3QML C;  3ZIP A;  3Q0S A;  3NMW A;  4B18 A;  3QGC A;  5KLT B;  4QMI A;  3TJ3 A;  2BCT A;  4NZW A;  4PLR A;  4UQI B;  4DBA A;  5BZU A;  3BCT A;  4I96 A;  5BZV A;  1UKL A;  2JKR B;  4A3V A;  4HTV A;  3A6P A;  4A3T A;  4I6I A;  3BX2 A;  4UAD A;  4D49 A;  5JJA A;  3WOZ A;  4JKQ A;  4MZ6 E;  4U3J C;  4I1E A;  1M8X A;  2OF3 A;  3TJZ B;  3JXY A;  3V6Y A;  3ZIO A;  2NYM A;  4K92 A;  4R11 A;  5H2X A;  1BK5 A;  4FZA A;  3WOY A;  3SLA A;  1IAL A;  3NMX A;  1QBK B;  3NMZ A;  3GVT A;  4GMO A;  1W9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...