4PLRA

Crystal structures of designed armadillo repeat proteins: implications of construct design and crystallization conditions on overall structure.
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
289
structure length
289
Chain Sequence
SHHHHHHGSELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGAEPALEQLQSSPNEKIQKEAQEALEKIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding protein
molecule keywords Arm00008
publication title Crystal structures of designed armadillo repeat proteins: Implications of construct design and crystallization conditions on overall structure.
pubmed doi rcsb
source organism Synthetic construct
total genus 121
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 4plrA00
2XA7B 4RV1A 2IW3A 2JKTA 4NEEA 5SVZA 4H3HA 5H2XA 3VE6A 3FGAB 1O6OA 3C2GA 3AU3A 1GCJA 1IBRB 4U5NA 1Q1TC 1W63B 3Q0QA 4DBAA 5BYMA 3C2HA 2Z5NA 4P6ZG 4QMHA 3K49A 5EKGA 2RU4B 1BK6A 4U5UA 3BWTA 3K5QA 5D5KC 4DZSA 4RZPA 4D49A 4V3OA 3Q0MA 4YI0C 3V71A 1QGKA 2NPPA 4D4EA 3Q0PA 4EVAA 5EKFA 2BKUB 2DB0A 3GQ2A 2C1TA 3C5WA 1U6GC 2YNRA 3FEYC 4Y5JA 3GVTA 4GMNA 3QG9A 1WA5C 4GMOA 4XZRB 5HHGE 2VGLB 2Z5OA 1Z2CB 2OF3A 5KLAA 4RXHB 3UVUA 3W3UA 3V6YA 3UKZB 2NYMB 5KL1A 3NOWA 3GVOA 3WOYA 3GB8A 3A6PA 3K62A 1Q1SC 2IAEA 4UQIB 2XA7A 4EV9A 3TT9A 4YGXA 3EBBA 3QHEA 4QMJA 2QK1A 4U5LA 3UKXB 3FGAA 3DADA 5HUWC 4UAFB 2X19B 5K6SA 4K6JA 1W63A 4R11A 2IWHA 5E6QB 4L7MA 1EE5A 1WA5B 1Y2AC 4I2ZA 3LWWA 4HXTA 5H2WA 1I7XA 5BZ1A 4YJLA 1G3JA 2C1MA 2RU4A 5DN7A 5BZVA 4B8JA 1XQSA 4BPLA 4MZ5E 3T7UA 3ZIPA 2BCTA 1LRVA 3K64A 4U5SA 1QZ7A 3H3DX 4A0CA 1JPPA 4DJSA 5J3VA 3L3FX 4NZWA 3KNDA 4P6ZB 3DW8A 3BX2A 3WPTA 4JLQA 2GL7A 3OBVA 3GNIA 4EVPA 4I5NA 1EJLI 1T08A 1QBKB 5BZUA 3IBVA 3Q0RA 2VGLA 3UL0B 3ND2A 2OT8A 3UKWB 3ZINA 4BQKA 4I2WA 3UKYB 4UWXA 2NYMA 4FZDA 3OQSA 3FEXC 3QGCA 2WTKA 5AEIA 3TX7A 1V18A 2BAPA 3ZIOA 4UQIA 3PSPA 4DB6A 3BTRC 2JKRB 3VWAA 2NYLB 2PKGA 1QGRA 5EWPA 4ADYA 3K5ZA 4CT6B 4CRVB 3ZIQA 2F31A 3IFQA 4K92A 2PF4A 3RZXA 4HNMA 4UADA 4EVTA 3ZHPA 3TPMA 1M8ZA 4B8PA 1TH1A 1JPWA 1F59A 1UPKA 4LACA 1UKLA 4U58A 4TNMA 5FC8E 3QMLC 4HTVA 2YNSA 1I7WA 2Q5DA 4CV5B 3WOZA 5KLRB 4O27A 3NMXA 4R0ZA 2X1GF 3Q5UA 3UL1B 2P8QA 4UAEA 1O6PA 2JAKA 4FZFA 1OYZA 4IMIA 2YJYA 3GAEA 3K5YA 3L3QA 4U3JC 2IE3A 1XQRA 4V3QA 3ODRA 2QNAA 5BZ5A 4MFUA 3OUWA 1IB2A 3Q0OA 3NMWA 3EA5B 5KLTB 1UPLA 3O4XA 3BCTA 3L6YA 1B3UA 4B8OA 2JKRA 3K7VA 4IMJA 2NYLA 2BNXA 4FFBC 3OPBA 5CTTA 5HUYC 4CB8A 3Q0LA 4V3RA 4G3AA 3ZIRA 1W9CA 1M8WA 4U5OA 5B56A 4MZ6E 3ODSA 2IX3A 3ZKVA 3BX3A 1JDHA 3EG5B 4WV6A 3PSTA 3O2QA 2JKTB 3K4EA 3TJZB 2Z5KA 4CB9A 5LSWA 4FZAA 3L6XA 5KL8A 3GRLA 4QMIA 4EV8A 3K7WA 3QGBA 2W3CA 1IQ1C 1BK5A 3RZ9A 4OIHA 3TJ3A 3BSBA 4YK6A 1M5NS 3LTJA 4DVGB 3O2TA 1XM9A 1M8YA 4I5LA 4U54A 5SW9A 3O2SA 2Z5JA 1UN0A 5K9SA 1M1EA 2JDQA 4PLQA 3LTMA 4PLSA 3V74A 4R10A 4CRUB 1PJMB 4CT7B 4DB8A 4YJEA 1HO8A 4FDDA 2QMRA 2NPPB 1M8XA 3TPOA 3Q0NA 4CBAA 3WYFC 5JJAA 1IALA 4OO6A 4H3KA 4DB9A 1LUJA 4PVZA 4KZGA 4E4VA 3GS3A 3BSXA 2Z6HA 2IE4A 3K61A 2H4MA 4B18A 4JW2B 5SWFA 4U5VA 2Z5MA 3Q0SA 1EJYI 2QK2A 2FV2A 1PJNB 3NMZA 4FQ3A 4BA3A 4ZDUA 4PLRA 4HM9A 2Z6GA 1EE4A 2IAEB 4MFVA 3OUXA
chains in the Genus database with same CATH superfamily
2XA7B 4RV1A 2IW3A 2JKTA 4NEEA 5SVZA 4H3HA 5H2XA 3VE6A 3FGAB 1O6OA 3C2GA 3AU3A 1GCJA 1IBRB 4U5NA 1Q1TC 1W63B 3Q0QA 4DBAA 5BYMA 3C2HA 2Z5NA 4P6ZG 4QMHA 3UJ4A 3K49A 5EKGA 2RU4B 1BK6A 4U5UA 3BWTA 1LSHA 3K5QA 5D5KC 4DZSA 4RZPA 4D49A 4V3OA 3Q0MA 4YI0C 3V71A 1QGKA 2NPPA 3JY1A 4L4HA 4D4EA 4JKQA 3Q0PA 4EVAA 5CL8A 4I2SA 5EKFA 2BKUB 2DB0A 3GQ2A 2C1TA 3C5WA 1U6GC 2YNRA 3FEYC 4Y5JA 3GVTA 4GMNA 3QG9A 4JW2A 1WA5C 4GMOA 4XZRB 5HHGE 2VGLB 2Z5OA 1Z2CB 2OF3A 5KLAA 4RXHB 3UVUA 3W3UA 3V6YA 3UKZB 2NYMB 5KL1A 3NOWA 3GVOA 5CLCA 3WOYA 3GB8A 3A6PA 3K62A 4I1EA 1Q1SC 2IAEA 4UQIB 2XA7A 4EV9A 3TT9A 4YGXA 3EBBA 4U2XD 5CLAA 3QHEA 4QMJA 2QK1A 4U5LA 3UKXB 3FGAA 3DADA 5HUWC 4UAFB 2X19B 5K6SA 4K6JA 1W63A 4R11A 2IWHA 5E6QB 4L7MA 1EE5A 1WA5B 1Y2AC 4I2ZA 5CL7A 3LWWA 4HXTA 5H2WA 1I7XA 5BZ1A 4YJLA 1G3JA 2C1MA 2RU4A 5DN7A 5CLBA 5BZVA 4B8JA 1XQSA 4BPLA 3UJ0A 4MZ5E 3T7UA 3ZIPA 2BCTA 1LRVA 3K64A 4U5SA 1QZ7A 3H3DX 4A0CA 1JPPA 4DJSA 5J3VA 3L3FX 4NZWA 3KNDA 4P6ZB 3DW8A 3BX2A 3WPTA 4JLQA 2GL7A 3OBVA 3GNIA 4EVPA 4I5NA 1EJLI 1T08A 1QBKB 5BZUA 3IBVA 3Q0RA 2VGLA 3UL0B 3ND2A 2OT8A 3VLEA 3UKWB 3ZINA 4BQKA 4I2WA 3UKYB 3SLAA 4UWXA 2NYMA 4FZDA 3OQSA 4FP7A 3FEXC 3QGCA 2WTKA 5AEIA 3SL9A 3TX7A 1V18A 2BAPA 4I7IA 3ZIOA 4UQIA 3PSPA 2XOAA 4DB6A 3BTRC 2JKRB 3VWAA 3T8SA 2NYLB 2PKGA 4I8MA 1QGRA 5EWPA 4L4IA 4ADYA 3K5ZA 4CT6B 4CRVB 3ZIQA 2F31A 3IFQA 4K92A 2PF4A 3RZXA 4HNMA 3ZIKA 4UADA 3ZILA 4EVTA 3ZHPA 3TPMA 1M8ZA 4B8PA 1TH1A 1JPWA 4JW3C 4A3TA 3VLDA 1F59A 1UPKA 4LACA 1UKLA 4U58A 4I37A 4TNMA 5FC8E 3QMLC 4HTVA 2YNSA 1I7WA 2Q5DA 4CV5B 3JXZA 3WOZA 5KLRB 4O27A 3NMXA 4R0ZA 2X1GF 3Q5UA 3UL1B 2P8QA 4UAEA 1O6PA 2JAKA 4FZFA 1OYZA 4IMIA 2YJYA 3GAEA 3K5YA 3L3QA 4U3JC 3JX7A 2IE3A 4I0YA 4A3VA 1XQRA 4V3QA 3ODRA 2QNAA 5BZ5A 4MFUA 3OUWA 5CLEA 1IB2A 3Q0OA 3NMWA 3EA5B 5KLTB 5CL3A 1UPLA 5CL5A 3O4XA 3BCTA 3L6YA 1B3UA 5CLDA 4B8OA 2JKRA 3K7VA 4IMJA 2NYLA 2BNXA 4FFBC 3OPBA 5CTTA 5HUYC 4CB8A 3Q0LA 4V3RA 4G3AA 5CL9A 3ZIRA 1W9CA 1M8WA 4U5OA 5B56A 4MZ6E 3ODSA 2IX3A 3ZKVA 3BX3A 1JDHA 3EG5B 4WV6A 3PSTA 3O2QA 2JKTB 3K4EA 3TJZB 2Z5KA 4CB9A 5LSWA 4FZAA 3L6XA 5KL8A 3GRLA 4QMIA 4EV8A 3K7WA 3QGBA 2W3CA 1IQ1C 1TE4A 1BK5A 3RZ9A 4OIHA 5CL6A 3TJ3A 3BSBA 4YK6A 1M5NS 1N4KA 5CL4A 3LTJA 4DVGB 3JXYA 3O2TA 1XM9A 4I3NA 3VLFA 1M8YA 4I5LA 4U54A 5SW9A 3O2SA 2Z5JA 1UN0A 5K9SA 1M1EA 2JDQA 4PLQA 3LTMA 4PLSA 3V74A 4R10A 4CRUB 1PJMB 4CT7B 4DB8A 4I6IA 4YJEA 1HO8A 4FDDA 2QMRA 2NPPB 1M8XA 3TPOA 3Q0NA 4CBAA 3WYFC 5JJAA 1IALA 4OO6A 4H3KA 4DB9A 5KUBA 1LUJA 4PVZA 4KZGA 4E4VA 3GS3A 3BSXA 3BVSA 2Z6HA 2IE4A 3K61A 2H4MA 4B18A 4JW2B 5SWFA 4I96A 4U5VA 2Z5MA 3Q0SA 1EJYI 2QK2A 2FV2A 1PJNB 3NMZA 4FQ3A 4BA3A 4ZDUA 4PLRA 4HM9A 2Z6GA 1EE4A 2IAEB 4MFVA 3OUXA
chains in the Genus database with same CATH topology
2XA7B 4RV1A 2IW3A 2JKTA 4NEEA 5SVZA 4H3HA 5H2XA 3VE6A 3FGAB 1O6OA 3C2GA 3AU3A 1GCJA 1IBRB 4U5NA 1Q1TC 1W63B 3Q0QA 4DBAA 5BYMA 3C2HA 2Z5NA 4P6ZG 4QMHA 3K49A 5EKGA 2RU4B 1BK6A 4U5UA 3BWTA 3K5QA 5D5KC 4DZSA 4RZPA 4D49A 4V3OA 3Q0MA 4YI0C 3V71A 1QGKA 2NPPA 3JY1A 4L4HA 4D4EA 4JKQA 3Q0PA 4EVAA 5CL8A 4I2SA 5EKFA 2BKUB 2DB0A 3GQ2A 2C1TA 3C5WA 1U6GC 2YNRA 3FEYC 4Y5JA 3GVTA 4GMNA 3QG9A 4JW2A 1WA5C 4GMOA 4XZRB 5HHGE 2VGLB 2Z5OA 1Z2CB 2OF3A 5KLAA 4RXHB 3UVUA 3W3UA 3V6YA 3UKZB 2NYMB 5KL1A 3NOWA 3GVOA 5CLCA 3WOYA 3GB8A 3A6PA 3K62A 4I1EA 1Q1SC 2IAEA 4UQIB 2XA7A 4EV9A 3TT9A 4YGXA 3EBBA 4U2XD 5CLAA 3QHEA 4QMJA 2QK1A 4U5LA 3UKXB 3FGAA 3DADA 5HUWC 4UAFB 2X19B 5K6SA 4K6JA 1W63A 4R11A 2IWHA 5E6QB 4L7MA 1EE5A 1WA5B 1Y2AC 4I2ZA 5CL7A 3LWWA 4HXTA 5H2WA 1I7XA 5BZ1A 4YJLA 1G3JA 2C1MA 2RU4A 5DN7A 5CLBA 5BZVA 4B8JA 1XQSA 4BPLA 4MZ5E 3T7UA 3ZIPA 2BCTA 1LRVA 3K64A 4U5SA 1QZ7A 3H3DX 4A0CA 1JPPA 4DJSA 5J3VA 3L3FX 4NZWA 3KNDA 4P6ZB 3DW8A 3BX2A 3WPTA 4JLQA 2GL7A 3OBVA 3GNIA 4EVPA 4I5NA 1EJLI 1T08A 1QBKB 5BZUA 3IBVA 3Q0RA 2VGLA 3UL0B 3ND2A 2OT8A 3VLEA 3UKWB 3ZINA 4BQKA 4I2WA 3UKYB 3SLAA 4UWXA 2NYMA 4FZDA 3OQSA 4FP7A 3FEXC 3QGCA 2WTKA 5AEIA 3SL9A 3TX7A 1V18A 2BAPA 4I7IA 3ZIOA 4UQIA 3PSPA 2XOAA 4DB6A 3BTRC 2JKRB 3VWAA 2NYLB 2PKGA 4I8MA 1QGRA 5EWPA 4L4IA 4ADYA 3K5ZA 4CT6B 4CRVB 3ZIQA 2F31A 3IFQA 4K92A 2PF4A 3RZXA 4HNMA 3ZIKA 4UADA 3ZILA 4EVTA 3ZHPA 3TPMA 1M8ZA 4B8PA 1TH1A 1JPWA 4JW3C 4A3TA 3VLDA 1F59A 1UPKA 4LACA 1UKLA 4U58A 4I37A 4TNMA 5FC8E 3QMLC 4HTVA 2YNSA 1I7WA 2Q5DA 4CV5B 3JXZA 3WOZA 5KLRB 4O27A 3NMXA 4R0ZA 2X1GF 3Q5UA 3UL1B 2P8QA 4UAEA 1O6PA 2JAKA 4FZFA 1OYZA 4IMIA 2YJYA 3GAEA 3K5YA 3L3QA 4U3JC 3JX7A 2IE3A 4I0YA 4A3VA 1XQRA 4V3QA 3ODRA 2QNAA 5BZ5A 4MFUA 3OUWA 5CLEA 1IB2A 3Q0OA 3NMWA 3EA5B 5KLTB 5CL3A 1UPLA 5CL5A 3O4XA 3BCTA 3L6YA 1B3UA 5CLDA 4B8OA 2JKRA 3K7VA 4IMJA 2NYLA 2BNXA 4FFBC 3OPBA 5CTTA 5HUYC 4CB8A 3Q0LA 4V3RA 4G3AA 5CL9A 3ZIRA 1W9CA 1M8WA 4U5OA 5B56A 4MZ6E 3ODSA 2IX3A 3ZKVA 3BX3A 1JDHA 3EG5B 4WV6A 3PSTA 3O2QA 2JKTB 3K4EA 3TJZB 2Z5KA 4CB9A 5LSWA 4FZAA 3L6XA 5KL8A 3GRLA 4QMIA 4EV8A 3K7WA 3QGBA 2W3CA 1IQ1C 1TE4A 1BK5A 3RZ9A 4OIHA 5CL6A 3TJ3A 3BSBA 4YK6A 1M5NS 5CL4A 3LTJA 4DVGB 3JXYA 3O2TA 1XM9A 4I3NA 3VLFA 1M8YA 4I5LA 4U54A 5SW9A 3O2SA 2Z5JA 1UN0A 5K9SA 1M1EA 2JDQA 4PLQA 3LTMA 4PLSA 3V74A 4R10A 4CRUB 1PJMB 4CT7B 4DB8A 4I6IA 4YJEA 1HO8A 4FDDA 2QMRA 2NPPB 1M8XA 3TPOA 3Q0NA 4CBAA 3WYFC 5JJAA 1IALA 4OO6A 4H3KA 4DB9A 5KUBA 1LUJA 4PVZA 4KZGA 4E4VA 3GS3A 3BSXA 3BVSA 2Z6HA 2IE4A 3K61A 2H4MA 4B18A 4JW2B 5SWFA 4I96A 4U5VA 2Z5MA 3Q0SA 1EJYI 2QK2A 2FV2A 1PJNB 3NMZA 4FQ3A 4BA3A 4ZDUA 4PLRA 4HM9A 2Z6GA 1EE4A 2IAEB 4MFVA 3OUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XA7 B;  4RV1 A;  2IW3 A;  2JKT A;  4NEE A;  5SVZ A;  4H3H A;  5H2X A;  3VE6 A;  3FGA B;  1O6O A;  3C2G A;  3AU3 A;  1GCJ A;  1IBR B;  4U5N A;  1Q1T C;  1W63 B;  3Q0Q A;  4DBA A;  5BYM A;  3C2H A;  2Z5N A;  4P6Z G;  4QMH A;  3K49 A;  5EKG A;  2RU4 B;  1BK6 A;  4U5U A;  3BWT A;  3K5Q A;  5D5K C;  4DZS A;  4RZP A;  4D49 A;  4V3O A;  3Q0M A;  4YI0 C;  3V71 A;  1QGK A;  2NPP A;  4D4E A;  3Q0P A;  4EVA A;  5EKF A;  2BKU B;  2DB0 A;  3GQ2 A;  2C1T A;  3C5W A;  1U6G C;  2YNR A;  3FEY C;  4Y5J A;  3GVT A;  4GMN A;  3QG9 A;  1WA5 C;  4GMO A;  4XZR B;  5HHG E;  2VGL B;  2Z5O A;  1Z2C B;  2OF3 A;  5KLA A;  4RXH B;  3UVU A;  3W3U A;  3V6Y A;  3UKZ B;  2NYM B;  5KL1 A;  3NOW A;  3GVO A;  3WOY A;  3GB8 A;  3A6P A;  3K62 A;  1Q1S C;  2IAE A;  4UQI B;  2XA7 A;  4EV9 A;  3TT9 A;  4YGX A;  3EBB A;  3QHE A;  4QMJ A;  2QK1 A;  4U5L A;  3UKX B;  3FGA A;  3DAD A;  5HUW C;  4UAF B;  2X19 B;  5K6S A;  4K6J A;  1W63 A;  4R11 A;  2IWH A;  5E6Q B;  4L7M A;  1EE5 A;  1WA5 B;  1Y2A C;  4I2Z A;  3LWW A;  4HXT A;  5H2W A;  1I7X A;  5BZ1 A;  4YJL A;  1G3J A;  2C1M A;  2RU4 A;  5DN7 A;  5BZV A;  4B8J A;  1XQS A;  4BPL A;  4MZ5 E;  3T7U A;  3ZIP A;  2BCT A;  1LRV A;  3K64 A;  4U5S A;  1QZ7 A;  3H3D X;  4A0C A;  1JPP A;  4DJS A;  5J3V A;  3L3F X;  4NZW A;  3KND A;  4P6Z B;  3DW8 A;  3BX2 A;  3WPT A;  4JLQ A;  2GL7 A;  3OBV A;  3GNI A;  4EVP A;  4I5N A;  1EJL I;  1T08 A;  1QBK B;  5BZU A;  3IBV A;  3Q0R A;  2VGL A;  3UL0 B;  3ND2 A;  2OT8 A;  3UKW B;  3ZIN A;  4BQK A;  4I2W A;  3UKY B;  4UWX A;  2NYM A;  4FZD A;  3OQS A;  3FEX C;  3QGC A;  2WTK A;  5AEI A;  3TX7 A;  1V18 A;  2BAP A;  3ZIO A;  4UQI A;  3PSP A;  4DB6 A;  3BTR C;  2JKR B;  3VWA A;  2NYL B;  2PKG A;  1QGR A;  5EWP A;  4ADY A;  3K5Z A;  4CT6 B;  4CRV B;  3ZIQ A;  2F31 A;  3IFQ A;  4K92 A;  2PF4 A;  3RZX A;  4HNM A;  4UAD A;  4EVT A;  3ZHP A;  3TPM A;  1M8Z A;  4B8P A;  1TH1 A;  1JPW A;  1F59 A;  1UPK A;  4LAC A;  1UKL A;  4U58 A;  4TNM A;  5FC8 E;  3QML C;  4HTV A;  2YNS A;  1I7W A;  2Q5D A;  4CV5 B;  3WOZ A;  5KLR B;  4O27 A;  3NMX A;  4R0Z A;  2X1G F;  3Q5U A;  3UL1 B;  2P8Q A;  4UAE A;  1O6P A;  2JAK A;  4FZF A;  1OYZ A;  4IMI A;  2YJY A;  3GAE A;  3K5Y A;  3L3Q A;  4U3J C;  2IE3 A;  1XQR A;  4V3Q A;  3ODR A;  2QNA A;  5BZ5 A;  4MFU A;  3OUW A;  1IB2 A;  3Q0O A;  3NMW A;  3EA5 B;  5KLT B;  1UPL A;  3O4X A;  3BCT A;  3L6Y A;  1B3U A;  4B8O A;  2JKR A;  3K7V A;  4IMJ A;  2NYL A;  2BNX A;  4FFB C;  3OPB A;  5CTT A;  5HUY C;  4CB8 A;  3Q0L A;  4V3R A;  4G3A A;  3ZIR A;  1W9C A;  1M8W A;  4U5O A;  5B56 A;  4MZ6 E;  3ODS A;  2IX3 A;  3ZKV A;  3BX3 A;  1JDH A;  3EG5 B;  4WV6 A;  3PST A;  3O2Q A;  2JKT B;  3K4E A;  3TJZ B;  2Z5K A;  4CB9 A;  5LSW A;  4FZA A;  3L6X A;  5KL8 A;  3GRL A;  4QMI A;  4EV8 A;  3K7W A;  3QGB A;  2W3C A;  1IQ1 C;  1BK5 A;  3RZ9 A;  4OIH A;  3TJ3 A;  3BSB A;  4YK6 A;  1M5N S;  3LTJ A;  4DVG B;  3O2T A;  1XM9 A;  1M8Y A;  4I5L A;  4U54 A;  5SW9 A;  3O2S A;  2Z5J A;  1UN0 A;  5K9S A;  1M1E A;  2JDQ A;  4PLQ A;  3LTM A;  4PLS A;  3V74 A;  4R10 A;  4CRU B;  1PJM B;  4CT7 B;  4DB8 A;  4YJE A;  1HO8 A;  4FDD A;  2QMR A;  2NPP B;  1M8X A;  3TPO A;  3Q0N A;  4CBA A;  3WYF C;  5JJA A;  1IAL A;  4OO6 A;  4H3K A;  4DB9 A;  1LUJ A;  4PVZ A;  4KZG A;  4E4V A;  3GS3 A;  3BSX A;  2Z6H A;  2IE4 A;  3K61 A;  2H4M A;  4B18 A;  4JW2 B;  5SWF A;  4U5V A;  2Z5M A;  3Q0S A;  1EJY I;  2QK2 A;  2FV2 A;  1PJN B;  3NMZ A;  4FQ3 A;  4BA3 A;  4ZDU A;  4PLR A;  4HM9 A;  2Z6G A;  1EE4 A;  2IAE B;  4MFV A;  3OUX A; 
#chains in the Genus database with same CATH topology
 2XA7 B;  4RV1 A;  2IW3 A;  2JKT A;  4NEE A;  5SVZ A;  4H3H A;  5H2X A;  3VE6 A;  3FGA B;  1O6O A;  3C2G A;  3AU3 A;  1GCJ A;  1IBR B;  4U5N A;  1Q1T C;  1W63 B;  3Q0Q A;  4DBA A;  5BYM A;  3C2H A;  2Z5N A;  4P6Z G;  4QMH A;  3UJ4 A;  3K49 A;  5EKG A;  2RU4 B;  1BK6 A;  4U5U A;  3BWT A;  1LSH A;  3K5Q A;  5D5K C;  4DZS A;  4RZP A;  4D49 A;  4V3O A;  3Q0M A;  4YI0 C;  3V71 A;  1QGK A;  2NPP A;  3JY1 A;  4L4H A;  4D4E A;  4JKQ A;  3Q0P A;  4EVA A;  5CL8 A;  4I2S A;  5EKF A;  2BKU B;  2DB0 A;  3GQ2 A;  2C1T A;  3C5W A;  1U6G C;  2YNR A;  3FEY C;  4Y5J A;  3GVT A;  4GMN A;  3QG9 A;  4JW2 A;  1WA5 C;  4GMO A;  4XZR B;  5HHG E;  2VGL B;  2Z5O A;  1Z2C B;  2OF3 A;  5KLA A;  4RXH B;  3UVU A;  3W3U A;  3V6Y A;  3UKZ B;  2NYM B;  5KL1 A;  3NOW A;  3GVO A;  5CLC A;  3WOY A;  3GB8 A;  3A6P A;  3K62 A;  4I1E A;  1Q1S C;  2IAE A;  4UQI B;  2XA7 A;  4EV9 A;  3TT9 A;  4YGX A;  3EBB A;  4U2X D;  5CLA A;  3QHE A;  4QMJ A;  2QK1 A;  4U5L A;  3UKX B;  3FGA A;  3DAD A;  5HUW C;  4UAF B;  2X19 B;  5K6S A;  4K6J A;  1W63 A;  4R11 A;  2IWH A;  5E6Q B;  4L7M A;  1EE5 A;  1WA5 B;  1Y2A C;  4I2Z A;  5CL7 A;  3LWW A;  4HXT A;  5H2W A;  1I7X A;  5BZ1 A;  4YJL A;  1G3J A;  2C1M A;  2RU4 A;  5DN7 A;  5CLB A;  5BZV A;  4B8J A;  1XQS A;  4BPL A;  3UJ0 A;  4MZ5 E;  3T7U A;  3ZIP A;  2BCT A;  1LRV A;  3K64 A;  4U5S A;  1QZ7 A;  3H3D X;  4A0C A;  1JPP A;  4DJS A;  5J3V A;  3L3F X;  4NZW A;  3KND A;  4P6Z B;  3DW8 A;  3BX2 A;  3WPT A;  4JLQ A;  2GL7 A;  3OBV A;  3GNI A;  4EVP A;  4I5N A;  1EJL I;  1T08 A;  1QBK B;  5BZU A;  3IBV A;  3Q0R A;  2VGL A;  3UL0 B;  3ND2 A;  2OT8 A;  3VLE A;  3UKW B;  3ZIN A;  4BQK A;  4I2W A;  3UKY B;  3SLA A;  4UWX A;  2NYM A;  4FZD A;  3OQS A;  4FP7 A;  3FEX C;  3QGC A;  2WTK A;  5AEI A;  3SL9 A;  3TX7 A;  1V18 A;  2BAP A;  4I7I A;  3ZIO A;  4UQI A;  3PSP A;  2XOA A;  4DB6 A;  3BTR C;  2JKR B;  3VWA A;  3T8S A;  2NYL B;  2PKG A;  4I8M A;  1QGR A;  5EWP A;  4L4I A;  4ADY A;  3K5Z A;  4CT6 B;  4CRV B;  3ZIQ A;  2F31 A;  3IFQ A;  4K92 A;  2PF4 A;  3RZX A;  4HNM A;  3ZIK A;  4UAD A;  3ZIL A;  4EVT A;  3ZHP A;  3TPM A;  1M8Z A;  4B8P A;  1TH1 A;  1JPW A;  4JW3 C;  4A3T A;  3VLD A;  1F59 A;  1UPK A;  4LAC A;  1UKL A;  4U58 A;  4I37 A;  4TNM A;  5FC8 E;  3QML C;  4HTV A;  2YNS A;  1I7W A;  2Q5D A;  4CV5 B;  3JXZ A;  3WOZ A;  5KLR B;  4O27 A;  3NMX A;  4R0Z A;  2X1G F;  3Q5U A;  3UL1 B;  2P8Q A;  4UAE A;  1O6P A;  2JAK A;  4FZF A;  1OYZ A;  4IMI A;  2YJY A;  3GAE A;  3K5Y A;  3L3Q A;  4U3J C;  3JX7 A;  2IE3 A;  4I0Y A;  4A3V A;  1XQR A;  4V3Q A;  3ODR A;  2QNA A;  5BZ5 A;  4MFU A;  3OUW A;  5CLE A;  1IB2 A;  3Q0O A;  3NMW A;  3EA5 B;  5KLT B;  5CL3 A;  1UPL A;  5CL5 A;  3O4X A;  3BCT A;  3L6Y A;  1B3U A;  5CLD A;  4B8O A;  2JKR A;  3K7V A;  4IMJ A;  2NYL A;  2BNX A;  4FFB C;  3OPB A;  5CTT A;  5HUY C;  4CB8 A;  3Q0L A;  4V3R A;  4G3A A;  5CL9 A;  3ZIR A;  1W9C A;  1M8W A;  4U5O A;  5B56 A;  4MZ6 E;  3ODS A;  2IX3 A;  3ZKV A;  3BX3 A;  1JDH A;  3EG5 B;  4WV6 A;  3PST A;  3O2Q A;  2JKT B;  3K4E A;  3TJZ B;  2Z5K A;  4CB9 A;  5LSW A;  4FZA A;  3L6X A;  5KL8 A;  3GRL A;  4QMI A;  4EV8 A;  3K7W A;  3QGB A;  2W3C A;  1IQ1 C;  1TE4 A;  1BK5 A;  3RZ9 A;  4OIH A;  5CL6 A;  3TJ3 A;  3BSB A;  4YK6 A;  1M5N S;  1N4K A;  5CL4 A;  3LTJ A;  4DVG B;  3JXY A;  3O2T A;  1XM9 A;  4I3N A;  3VLF A;  1M8Y A;  4I5L A;  4U54 A;  5SW9 A;  3O2S A;  2Z5J A;  1UN0 A;  5K9S A;  1M1E A;  2JDQ A;  4PLQ A;  3LTM A;  4PLS A;  3V74 A;  4R10 A;  4CRU B;  1PJM B;  4CT7 B;  4DB8 A;  4I6I A;  4YJE A;  1HO8 A;  4FDD A;  2QMR A;  2NPP B;  1M8X A;  3TPO A;  3Q0N A;  4CBA A;  3WYF C;  5JJA A;  1IAL A;  4OO6 A;  4H3K A;  4DB9 A;  5KUB A;  1LUJ A;  4PVZ A;  4KZG A;  4E4V A;  3GS3 A;  3BSX A;  3BVS A;  2Z6H A;  2IE4 A;  3K61 A;  2H4M A;  4B18 A;  4JW2 B;  5SWF A;  4I96 A;  4U5V A;  2Z5M A;  3Q0S A;  1EJY I;  2QK2 A;  2FV2 A;  1PJN B;  3NMZ A;  4FQ3 A;  4BA3 A;  4ZDU A;  4PLR A;  4HM9 A;  2Z6G A;  1EE4 A;  2IAE B;  4MFV A;  3OUX A; 
#chains in the Genus database with same CATH homology
 2XA7 B;  4RV1 A;  2IW3 A;  2JKT A;  4NEE A;  5SVZ A;  4H3H A;  5H2X A;  3VE6 A;  3FGA B;  1O6O A;  3C2G A;  3AU3 A;  1GCJ A;  1IBR B;  4U5N A;  1Q1T C;  1W63 B;  3Q0Q A;  4DBA A;  5BYM A;  3C2H A;  2Z5N A;  4P6Z G;  4QMH A;  3K49 A;  5EKG A;  2RU4 B;  1BK6 A;  4U5U A;  3BWT A;  3K5Q A;  5D5K C;  4DZS A;  4RZP A;  4D49 A;  4V3O A;  3Q0M A;  4YI0 C;  3V71 A;  1QGK A;  2NPP A;  3JY1 A;  4L4H A;  4D4E A;  4JKQ A;  3Q0P A;  4EVA A;  5CL8 A;  4I2S A;  5EKF A;  2BKU B;  2DB0 A;  3GQ2 A;  2C1T A;  3C5W A;  1U6G C;  2YNR A;  3FEY C;  4Y5J A;  3GVT A;  4GMN A;  3QG9 A;  4JW2 A;  1WA5 C;  4GMO A;  4XZR B;  5HHG E;  2VGL B;  2Z5O A;  1Z2C B;  2OF3 A;  5KLA A;  4RXH B;  3UVU A;  3W3U A;  3V6Y A;  3UKZ B;  2NYM B;  5KL1 A;  3NOW A;  3GVO A;  5CLC A;  3WOY A;  3GB8 A;  3A6P A;  3K62 A;  4I1E A;  1Q1S C;  2IAE A;  4UQI B;  2XA7 A;  4EV9 A;  3TT9 A;  4YGX A;  3EBB A;  4U2X D;  5CLA A;  3QHE A;  4QMJ A;  2QK1 A;  4U5L A;  3UKX B;  3FGA A;  3DAD A;  5HUW C;  4UAF B;  2X19 B;  5K6S A;  4K6J A;  1W63 A;  4R11 A;  2IWH A;  5E6Q B;  4L7M A;  1EE5 A;  1WA5 B;  1Y2A C;  4I2Z A;  5CL7 A;  3LWW A;  4HXT A;  5H2W A;  1I7X A;  5BZ1 A;  4YJL A;  1G3J A;  2C1M A;  2RU4 A;  5DN7 A;  5CLB A;  5BZV A;  4B8J A;  1XQS A;  4BPL A;  4MZ5 E;  3T7U A;  3ZIP A;  2BCT A;  1LRV A;  3K64 A;  4U5S A;  1QZ7 A;  3H3D X;  4A0C A;  1JPP A;  4DJS A;  5J3V A;  3L3F X;  4NZW A;  3KND A;  4P6Z B;  3DW8 A;  3BX2 A;  3WPT A;  4JLQ A;  2GL7 A;  3OBV A;  3GNI A;  4EVP A;  4I5N A;  1EJL I;  1T08 A;  1QBK B;  5BZU A;  3IBV A;  3Q0R A;  2VGL A;  3UL0 B;  3ND2 A;  2OT8 A;  3VLE A;  3UKW B;  3ZIN A;  4BQK A;  4I2W A;  3UKY B;  3SLA A;  4UWX A;  2NYM A;  4FZD A;  3OQS A;  4FP7 A;  3FEX C;  3QGC A;  2WTK A;  5AEI A;  3SL9 A;  3TX7 A;  1V18 A;  2BAP A;  4I7I A;  3ZIO A;  4UQI A;  3PSP A;  2XOA A;  4DB6 A;  3BTR C;  2JKR B;  3VWA A;  2NYL B;  2PKG A;  4I8M A;  1QGR A;  5EWP A;  4L4I A;  4ADY A;  3K5Z A;  4CT6 B;  4CRV B;  3ZIQ A;  2F31 A;  3IFQ A;  4K92 A;  2PF4 A;  3RZX A;  4HNM A;  3ZIK A;  4UAD A;  3ZIL A;  4EVT A;  3ZHP A;  3TPM A;  1M8Z A;  4B8P A;  1TH1 A;  1JPW A;  4JW3 C;  4A3T A;  3VLD A;  1F59 A;  1UPK A;  4LAC A;  1UKL A;  4U58 A;  4I37 A;  4TNM A;  5FC8 E;  3QML C;  4HTV A;  2YNS A;  1I7W A;  2Q5D A;  4CV5 B;  3JXZ A;  3WOZ A;  5KLR B;  4O27 A;  3NMX A;  4R0Z A;  2X1G F;  3Q5U A;  3UL1 B;  2P8Q A;  4UAE A;  1O6P A;  2JAK A;  4FZF A;  1OYZ A;  4IMI A;  2YJY A;  3GAE A;  3K5Y A;  3L3Q A;  4U3J C;  3JX7 A;  2IE3 A;  4I0Y A;  4A3V A;  1XQR A;  4V3Q A;  3ODR A;  2QNA A;  5BZ5 A;  4MFU A;  3OUW A;  5CLE A;  1IB2 A;  3Q0O A;  3NMW A;  3EA5 B;  5KLT B;  5CL3 A;  1UPL A;  5CL5 A;  3O4X A;  3BCT A;  3L6Y A;  1B3U A;  5CLD A;  4B8O A;  2JKR A;  3K7V A;  4IMJ A;  2NYL A;  2BNX A;  4FFB C;  3OPB A;  5CTT A;  5HUY C;  4CB8 A;  3Q0L A;  4V3R A;  4G3A A;  5CL9 A;  3ZIR A;  1W9C A;  1M8W A;  4U5O A;  5B56 A;  4MZ6 E;  3ODS A;  2IX3 A;  3ZKV A;  3BX3 A;  1JDH A;  3EG5 B;  4WV6 A;  3PST A;  3O2Q A;  2JKT B;  3K4E A;  3TJZ B;  2Z5K A;  4CB9 A;  5LSW A;  4FZA A;  3L6X A;  5KL8 A;  3GRL A;  4QMI A;  4EV8 A;  3K7W A;  3QGB A;  2W3C A;  1IQ1 C;  1TE4 A;  1BK5 A;  3RZ9 A;  4OIH A;  5CL6 A;  3TJ3 A;  3BSB A;  4YK6 A;  1M5N S;  5CL4 A;  3LTJ A;  4DVG B;  3JXY A;  3O2T A;  1XM9 A;  4I3N A;  3VLF A;  1M8Y A;  4I5L A;  4U54 A;  5SW9 A;  3O2S A;  2Z5J A;  1UN0 A;  5K9S A;  1M1E A;  2JDQ A;  4PLQ A;  3LTM A;  4PLS A;  3V74 A;  4R10 A;  4CRU B;  1PJM B;  4CT7 B;  4DB8 A;  4I6I A;  4YJE A;  1HO8 A;  4FDD A;  2QMR A;  2NPP B;  1M8X A;  3TPO A;  3Q0N A;  4CBA A;  3WYF C;  5JJA A;  1IAL A;  4OO6 A;  4H3K A;  4DB9 A;  5KUB A;  1LUJ A;  4PVZ A;  4KZG A;  4E4V A;  3GS3 A;  3BSX A;  3BVS A;  2Z6H A;  2IE4 A;  3K61 A;  2H4M A;  4B18 A;  4JW2 B;  5SWF A;  4I96 A;  4U5V A;  2Z5M A;  3Q0S A;  1EJY I;  2QK2 A;  2FV2 A;  1PJN B;  3NMZ A;  4FQ3 A;  4BA3 A;  4ZDU A;  4PLR A;  4HM9 A;  2Z6G A;  1EE4 A;  2IAE B;  4MFV A;  3OUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...