3BX2A

Puf4 rna binding domain bound to ho endonuclease rna 3' utr recognition sequence
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
328
structure length
328
Chain Sequence
VLDQYIGSIHSLCKDQHGCRFLQKQLDILGSKAADAIFEETKDYTVELMTDSFGNYLIQKLLEEVTTEQRIVLTKISSPHFVEISLNPHGTRALQKLIECIKTDEEAQIVVDSLRPYTVQLSKDLNGNHVIQKCLQRLKPENFQFIFDAISDSCIDIATHRHGCCVLQRCLDHGTTEQCDNLCDKLLALVDKLTLDPFGNYVVQYIITKEAEKNKYDYTHKIVHLLKPRAIELSIHKFGSNVIEKILKTAIVSEPMILEILNNGGETGIQSLLNDSYGNYVLQTALDISHKQNDYLYKRLSEIVAPLLVGPIRNTPHGKRIIGMLHLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HO endonuclease 3' UTR binding sequence
publication title Basis of altered RNA-binding specificity by PUF proteins revealed by crystal structures of yeast Puf4p
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription, rna binding protein/rna
total genus 131
structure length 328
sequence length 328
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00806 PUF Pumilio-family RNA binding repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 3bx2A00
2BCTA 3GB8A 3RZXA 3PSTA 1WA5B 1IQ1C 3K4EA 2RU4A 4HM9A 2PF4A 3FEXC 4UADA 4DB8A 3Q0MA 4YJLA 4PLSA 5EWPA 1F59A 1G3JA 2NYLA 3UVUA 3RZ9A 4U5OA 4ZDUA 1UPKA 2Z5JA 4I5LA 3IFQA 4DBAA 4RZPA 5BZ5A 4YJEA 2BAPA 5K9SA 4MFUA 2JKRA 1W9CA 4QMJA 2VGLA 3EBBA 3C2GA 1XM9A 3O2SA 4UAEA 5BYMA 5KL1A 5HUWC 1M8YA 5H2WA 4P6ZG 2JAKA 2JKTB 5BZUA 4DVGB 3TPOA 3FGAB 5K6SA 5KLTB 2DB0A 4PVZA 4QMHA 4XZRB 5CTTA 4DZSA 2W3CA 3ZINA 3BSBA 2OT8A 3ZIQA 1QZ7A 2Z5OA 1QBKB 3GNIA 1Y2AC 1TH1A 4B18A 3FEYC 4I2WA 3OUWA 4EV9A 4EVTA 4CV5B 3Q0OA 4RXHB 5JJAA 3K62A 1UPLA 2YNRA 4CBAA 2QK1A 5SVZA 2X19B 4UAFB 3K5QA 2IAEB 2QK2A 4YGXA 3OUXA 3Q0LA 4L7MA 2X1GF 3C2HA 3TT9A 4A0CA 1V18A 5KL8A 1LRVA 4K6JA 3Q0QA 4GMNA 3IBVA 4U5LA 3GRLA 4FDDA 4UQIA 4B8PA 3ZKVA 3L6XA 1QGRA 4ADYA 1W63B 2Z5KA 3NMXA 2NPPA 5SWFA 3C5WA 4OO6A 4TNMA 3GQ2A 3ODRA 3O4XA 4QMIA 5SW9A 4I5NA 4YK6A 2NYMA 4GMOA 3BX3A 3Q0SA 2YJYA 2IE4A 4H3KA 4MFVA 3VE6A 4V3QA 3GVOA 3ZIOA 2Z5MA 3K61A 4HTVA 2XA7A 3LTMA 1HO8A 4B8JA 3QGCA 3NMWA 3ODSA 4I2ZA 4H3HA 4MZ5E 3NMZA 3WPTA 1O6OA 1LUJA 3K5YA 3O2QA 1EE5A 3W3UA 4EVPA 2OF3A 1JDHA 3GVTA 3O2TA 4RV1A 2IWHA 2IX3A 5HUYC 3Q0PA 2RU4B 2Z6HA 4BA3A 3TPMA 2H4MA 3UKWB 2IW3A 5AEIA 1EJLI 5B56A 3TJ3A 4CT7B 3KNDA 1M5NS 4U5NA 5FC8E 5KLRB 2NYLB 1XQSA 1I7XA 4U58A 4V3RA 3TX7A 4P6ZB 3L3QA 4LACA 3V71A 1JPPA 4JLQA 2QNAA 4FFBC 5DN7A 4E4VA 3K64A 4G3AA 3ZIPA 2PKGA 1W63A 3UL1B 1EJYI 2JKRB 3QMLC 3VWAA 1UN0A 2VGLB 4R0ZA 3T7UA 4OIHA 1IALA 2GL7A 2F31A 4CRVB 4DJSA 4YI0C 4U5SA 1B3UA 4R10A 1JPWA 5E6QB 3PSPA 1Z2CB 1M8ZA 4EV8A 3QHEA 5BZ1A 3OPBA 1Q1SC 4JW2B 3WOZA 3A6PA 1M8WA 3EG5B 3UKZB 4K92A 1U6GC 3Q0RA 3AU3A 3OBVA 3K49A 4U54A 3V74A 5EKGA 5HHGE 2JKTA 4KZGA 4O27A 3ND2A 3FGAA 3TJZB 4CRUB 4U5UA 2BNXA 3L3FX 4BQKA 3BTRC 2BKUB 4FZDA 4U5VA 3UL0B 4UQIB 3BCTA 3QG9A 3K5ZA 1GCJA 1OYZA 3BSXA 4MZ6E 4HNMA 3UKYB 4D4EA 5H2XA 4PLRA 4BPLA 2NPPB 3Q0NA 1M1EA 3DADA 3DW8A 3GAEA 2C1TA 1IBRB 2NYMB 3ZHPA 4NZWA 2IAEA 3QGBA 3ZIRA 3WOYA 4FZFA 1T08A 4U3JC 1PJNB 5J3VA 4FZAA 2Z6GA 5KLAA 2XA7B 1XQRA 3GS3A 4R11A 5EKFA 3H3DX 4UWXA 2JDQA 4CB8A 1PJMB 1BK5A 2Z5NA 4PLQA 2QMRA 2YNSA 4EVAA 3LTJA 4FQ3A 2FV2A 3OQSA 2P8QA 1IB2A 3LWWA 1WA5C 4HXTA 3BWTA 5D5KC 3WYFC 1O6PA 1I7WA 4V3OA 5LSWA 3EA5B 4WV6A 4DB6A 3K7VA 2Q5DA 1QGKA 2C1MA 3Q5UA 4Y5JA 1M8XA 3K7WA 4IMJA 1BK6A 3BX2A 3NOWA 2IE3A 3L6YA 3V6YA 1EE4A 4IMIA 1UKLA 3UKXB 4DB9A 4D49A 1Q1TC 4B8OA 4CT6B 4CB9A 4NEEA 5BZVA 2WTKA
chains in the Genus database with same CATH superfamily
2BCTA 3GB8A 3RZXA 3PSTA 1WA5B 4I2SA 1IQ1C 3K4EA 2RU4A 4HM9A 2PF4A 3FEXC 3VLDA 4UADA 4DB8A 3Q0MA 4YJLA 4PLSA 4I8MA 5EWPA 1F59A 5CL4A 1G3JA 2NYLA 3UVUA 3RZ9A 5CLAA 4U5OA 4ZDUA 1UPKA 2Z5JA 4I5LA 3IFQA 4DBAA 5CLEA 4RZPA 5BZ5A 4YJEA 2BAPA 5K9SA 4MFUA 2JKRA 1W9CA 4QMJA 3VLFA 2VGLA 3EBBA 3C2GA 1XM9A 3O2SA 4UAEA 5BYMA 5KL1A 5HUWC 1M8YA 5H2WA 4P6ZG 2JAKA 2JKTB 5BZUA 4DVGB 3TPOA 3FGAB 5K6SA 1LSHA 2DB0A 5KLTB 4PVZA 4QMHA 4XZRB 5CTTA 4I0YA 4DZSA 5CL9A 2W3CA 3ZINA 3BSBA 2OT8A 3ZIQA 1QZ7A 2Z5OA 1QBKB 3GNIA 1Y2AC 1TH1A 4B18A 3FEYC 4JW2A 4I2WA 3OUWA 4EV9A 4EVTA 4CV5B 3Q0OA 4RXHB 5JJAA 4I37A 1UPLA 3K62A 2YNRA 4I96A 4CBAA 2QK1A 5CL5A 5SVZA 2X19B 4UAFB 3K5QA 2IAEB 2QK2A 4YGXA 3OUXA 3Q0LA 1N4KA 2X1GF 4L7MA 5CL7A 3C2HA 3TT9A 4A0CA 1V18A 5KL8A 1LRVA 4K6JA 3Q0QA 4GMNA 4L4IA 3IBVA 4U5LA 3GRLA 4FDDA 4UQIA 4B8PA 3ZKVA 3L6XA 1QGRA 4ADYA 1W63B 2Z5KA 3NMXA 2NPPA 5SWFA 3C5WA 4OO6A 4TNMA 3GQ2A 3ODRA 3O4XA 4QMIA 5SW9A 4I5NA 4YK6A 2NYMA 4JW3C 4GMOA 3BX3A 3Q0SA 2YJYA 2IE4A 4H3KA 3BVSA 4MFVA 3VE6A 4V3QA 3GVOA 3ZIOA 2Z5MA 3K61A 3JXYA 4HTVA 2XA7A 3LTMA 1HO8A 4B8JA 3VLEA 3QGCA 3NMWA 3ODSA 4I2ZA 4H3HA 4MZ5E 3NMZA 3WPTA 1O6OA 3JY1A 1LUJA 3K5YA 3O2QA 1EE5A 3W3UA 4EVPA 4L4HA 2OF3A 1JDHA 3GVTA 3O2TA 4RV1A 2IWHA 2IX3A 5HUYC 3Q0PA 3JXZA 2RU4B 2Z6HA 5CLDA 1TE4A 4BA3A 3TPMA 2H4MA 3UKWB 2IW3A 5AEIA 1EJLI 5B56A 3TJ3A 4CT7B 3KNDA 1M5NS 4U5NA 5FC8E 5KLRB 2NYLB 1XQSA 1I7XA 4U58A 4V3RA 3TX7A 4P6ZB 3L3QA 4LACA 3V71A 1JPPA 4JLQA 2QNAA 4FFBC 5DN7A 4E4VA 3K64A 4G3AA 3ZIPA 2PKGA 4I6IA 1W63A 3T8SA 3UL1B 1EJYI 2JKRB 3QMLC 3VWAA 1UN0A 2VGLB 4R0ZA 3T7UA 4OIHA 5CL8A 1IALA 2GL7A 2F31A 4CRVB 4DJSA 4YI0C 4U5SA 1B3UA 4R10A 1JPWA 5E6QB 3PSPA 1Z2CB 1M8ZA 4EV8A 3UJ0A 3QHEA 3JX7A 5BZ1A 3OPBA 1Q1SC 4I7IA 4JW2B 3WOZA 3A6PA 1M8WA 4U2XD 3EG5B 5CL3A 3UKZB 4K92A 1U6GC 3Q0RA 3AU3A 3OBVA 3K49A 4U54A 3V74A 5EKGA 5HHGE 2JKTA 4KZGA 4O27A 3ND2A 3FGAA 3TJZB 4CRUB 4U5UA 2BNXA 3L3FX 4BQKA 3BTRC 2XOAA 2BKUB 4FZDA 4FP7A 4U5VA 3UL0B 4UQIB 4I3NA 5CL6A 3BCTA 3QG9A 4JKQA 3K5ZA 1GCJA 5CLBA 1OYZA 3BSXA 4MZ6E 4HNMA 3UKYB 4D4EA 5H2XA 3ZILA 5KUBA 4PLRA 4BPLA 2NPPB 3Q0NA 3ZIKA 1M1EA 3DADA 3DW8A 3GAEA 2C1TA 1IBRB 2NYMB 3ZHPA 5CLCA 4NZWA 4A3VA 2IAEA 3UJ4A 3QGBA 3ZIRA 4I1EA 3WOYA 4FZFA 3SL9A 1T08A 4U3JC 1PJNB 5J3VA 4FZAA 2Z6GA 5KLAA 2XA7B 1XQRA 3GS3A 4R11A 5EKFA 3H3DX 4UWXA 2JDQA 4CB8A 1PJMB 1BK5A 2Z5NA 4PLQA 2QMRA 2YNSA 3SLAA 4EVAA 3LTJA 4FQ3A 2FV2A 3OQSA 2P8QA 1IB2A 3LWWA 1WA5C 4HXTA 3BWTA 5D5KC 3WYFC 1O6PA 1I7WA 4V3OA 5LSWA 3EA5B 4WV6A 4DB6A 3K7VA 2Q5DA 1QGKA 2C1MA 3Q5UA 4Y5JA 1M8XA 3K7WA 4IMJA 1BK6A 3BX2A 3NOWA 2IE3A 3L6YA 3V6YA 1EE4A 4IMIA 1UKLA 4A3TA 3UKXB 4DB9A 4D49A 1Q1TC 4B8OA 4CT6B 4CB9A 4NEEA 5BZVA 2WTKA
chains in the Genus database with same CATH topology
2BCTA 3GB8A 3RZXA 3PSTA 1WA5B 4I2SA 1IQ1C 3K4EA 2RU4A 4HM9A 2PF4A 3FEXC 3VLDA 4UADA 4DB8A 3Q0MA 4YJLA 4PLSA 4I8MA 5EWPA 1F59A 5CL4A 1G3JA 2NYLA 3UVUA 3RZ9A 5CLAA 4U5OA 4ZDUA 1UPKA 2Z5JA 4I5LA 3IFQA 4DBAA 5CLEA 4RZPA 5BZ5A 4YJEA 2BAPA 5K9SA 4MFUA 2JKRA 1W9CA 4QMJA 3VLFA 2VGLA 3EBBA 3C2GA 1XM9A 3O2SA 4UAEA 5BYMA 5KL1A 5HUWC 1M8YA 5H2WA 4P6ZG 2JAKA 2JKTB 5BZUA 4DVGB 3TPOA 3FGAB 5K6SA 5KLTB 2DB0A 4PVZA 4QMHA 4XZRB 5CTTA 4I0YA 4DZSA 5CL9A 2W3CA 3ZINA 3BSBA 2OT8A 3ZIQA 1QZ7A 2Z5OA 1QBKB 3GNIA 1Y2AC 1TH1A 4B18A 3FEYC 4JW2A 4I2WA 3OUWA 4EV9A 4EVTA 4CV5B 3Q0OA 4RXHB 5JJAA 4I37A 1UPLA 3K62A 2YNRA 4I96A 4CBAA 2QK1A 5CL5A 5SVZA 2X19B 4UAFB 3K5QA 2IAEB 2QK2A 4YGXA 3OUXA 3Q0LA 4L7MA 2X1GF 5CL7A 3C2HA 3TT9A 4A0CA 1V18A 5KL8A 1LRVA 4K6JA 3Q0QA 4GMNA 4L4IA 3IBVA 4U5LA 3GRLA 4FDDA 4UQIA 4B8PA 3ZKVA 3L6XA 1QGRA 4ADYA 1W63B 2Z5KA 3NMXA 2NPPA 5SWFA 3C5WA 4OO6A 4TNMA 3GQ2A 3ODRA 3O4XA 4QMIA 5SW9A 4I5NA 4YK6A 2NYMA 4JW3C 4GMOA 3BX3A 3Q0SA 2YJYA 2IE4A 4H3KA 3BVSA 4MFVA 3VE6A 4V3QA 3GVOA 3ZIOA 2Z5MA 3K61A 3JXYA 4HTVA 2XA7A 3LTMA 1HO8A 4B8JA 3VLEA 3QGCA 3NMWA 3ODSA 4I2ZA 4H3HA 4MZ5E 3NMZA 3WPTA 1O6OA 3JY1A 1LUJA 3K5YA 3O2QA 1EE5A 3W3UA 4EVPA 4L4HA 2OF3A 1JDHA 3GVTA 3O2TA 4RV1A 2IWHA 2IX3A 5HUYC 3Q0PA 3JXZA 2RU4B 2Z6HA 5CLDA 1TE4A 4BA3A 3TPMA 2H4MA 3UKWB 2IW3A 5AEIA 1EJLI 5B56A 3TJ3A 4CT7B 3KNDA 1M5NS 4U5NA 5FC8E 5KLRB 2NYLB 1XQSA 1I7XA 4U58A 4V3RA 3TX7A 4P6ZB 3L3QA 4LACA 3V71A 1JPPA 4JLQA 2QNAA 4FFBC 5DN7A 4E4VA 3K64A 4G3AA 3ZIPA 2PKGA 4I6IA 1W63A 3UL1B 1EJYI 2JKRB 3QMLC 3VWAA 1UN0A 2VGLB 4R0ZA 3T7UA 4OIHA 5CL8A 1IALA 2GL7A 2F31A 4CRVB 4DJSA 4YI0C 4U5SA 1B3UA 4R10A 1JPWA 5E6QB 3PSPA 1Z2CB 1M8ZA 4EV8A 3QHEA 3JX7A 5BZ1A 3OPBA 1Q1SC 4I7IA 4JW2B 3WOZA 3A6PA 1M8WA 4U2XD 3EG5B 5CL3A 3UKZB 4K92A 1U6GC 3Q0RA 3AU3A 3OBVA 3K49A 4U54A 3V74A 5EKGA 5HHGE 2JKTA 4KZGA 4O27A 3ND2A 3FGAA 3TJZB 4CRUB 4U5UA 2BNXA 3L3FX 4BQKA 3BTRC 2XOAA 2BKUB 4FZDA 4FP7A 4U5VA 3UL0B 4UQIB 4I3NA 5CL6A 3BCTA 3QG9A 4JKQA 3K5ZA 1GCJA 5CLBA 1OYZA 3BSXA 4MZ6E 4HNMA 3UKYB 4D4EA 5H2XA 3ZILA 5KUBA 4PLRA 4BPLA 2NPPB 3Q0NA 3ZIKA 1M1EA 3DADA 3DW8A 3GAEA 2C1TA 1IBRB 2NYMB 3ZHPA 5CLCA 4NZWA 4A3VA 2IAEA 3QGBA 3ZIRA 4I1EA 3WOYA 4FZFA 3SL9A 1T08A 4U3JC 1PJNB 5J3VA 4FZAA 2Z6GA 5KLAA 2XA7B 1XQRA 3GS3A 4R11A 5EKFA 3H3DX 4UWXA 2JDQA 4CB8A 1PJMB 1BK5A 2Z5NA 4PLQA 2QMRA 2YNSA 3SLAA 4EVAA 3LTJA 4FQ3A 2FV2A 3OQSA 2P8QA 1IB2A 3LWWA 1WA5C 4HXTA 3BWTA 5D5KC 3WYFC 1O6PA 1I7WA 4V3OA 5LSWA 3EA5B 4WV6A 4DB6A 3K7VA 2Q5DA 1QGKA 2C1MA 3Q5UA 4Y5JA 1M8XA 3K7WA 4IMJA 1BK6A 3BX2A 3NOWA 2IE3A 3L6YA 3V6YA 1EE4A 4IMIA 1UKLA 4A3TA 3UKXB 4DB9A 4D49A 1Q1TC 4B8OA 4CT6B 4CB9A 4NEEA 5BZVA 2WTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCT A;  3GB8 A;  3RZX A;  3PST A;  1WA5 B;  1IQ1 C;  3K4E A;  2RU4 A;  4HM9 A;  2PF4 A;  3FEX C;  4UAD A;  4DB8 A;  3Q0M A;  4YJL A;  4PLS A;  5EWP A;  1F59 A;  1G3J A;  2NYL A;  3UVU A;  3RZ9 A;  4U5O A;  4ZDU A;  1UPK A;  2Z5J A;  4I5L A;  3IFQ A;  4DBA A;  4RZP A;  5BZ5 A;  4YJE A;  2BAP A;  5K9S A;  4MFU A;  2JKR A;  1W9C A;  4QMJ A;  2VGL A;  3EBB A;  3C2G A;  1XM9 A;  3O2S A;  4UAE A;  5BYM A;  5KL1 A;  5HUW C;  1M8Y A;  5H2W A;  4P6Z G;  2JAK A;  2JKT B;  5BZU A;  4DVG B;  3TPO A;  3FGA B;  5K6S A;  5KLT B;  2DB0 A;  4PVZ A;  4QMH A;  4XZR B;  5CTT A;  4DZS A;  2W3C A;  3ZIN A;  3BSB A;  2OT8 A;  3ZIQ A;  1QZ7 A;  2Z5O A;  1QBK B;  3GNI A;  1Y2A C;  1TH1 A;  4B18 A;  3FEY C;  4I2W A;  3OUW A;  4EV9 A;  4EVT A;  4CV5 B;  3Q0O A;  4RXH B;  5JJA A;  3K62 A;  1UPL A;  2YNR A;  4CBA A;  2QK1 A;  5SVZ A;  2X19 B;  4UAF B;  3K5Q A;  2IAE B;  2QK2 A;  4YGX A;  3OUX A;  3Q0L A;  4L7M A;  2X1G F;  3C2H A;  3TT9 A;  4A0C A;  1V18 A;  5KL8 A;  1LRV A;  4K6J A;  3Q0Q A;  4GMN A;  3IBV A;  4U5L A;  3GRL A;  4FDD A;  4UQI A;  4B8P A;  3ZKV A;  3L6X A;  1QGR A;  4ADY A;  1W63 B;  2Z5K A;  3NMX A;  2NPP A;  5SWF A;  3C5W A;  4OO6 A;  4TNM A;  3GQ2 A;  3ODR A;  3O4X A;  4QMI A;  5SW9 A;  4I5N A;  4YK6 A;  2NYM A;  4GMO A;  3BX3 A;  3Q0S A;  2YJY A;  2IE4 A;  4H3K A;  4MFV A;  3VE6 A;  4V3Q A;  3GVO A;  3ZIO A;  2Z5M A;  3K61 A;  4HTV A;  2XA7 A;  3LTM A;  1HO8 A;  4B8J A;  3QGC A;  3NMW A;  3ODS A;  4I2Z A;  4H3H A;  4MZ5 E;  3NMZ A;  3WPT A;  1O6O A;  1LUJ A;  3K5Y A;  3O2Q A;  1EE5 A;  3W3U A;  4EVP A;  2OF3 A;  1JDH A;  3GVT A;  3O2T A;  4RV1 A;  2IWH A;  2IX3 A;  5HUY C;  3Q0P A;  2RU4 B;  2Z6H A;  4BA3 A;  3TPM A;  2H4M A;  3UKW B;  2IW3 A;  5AEI A;  1EJL I;  5B56 A;  3TJ3 A;  4CT7 B;  3KND A;  1M5N S;  4U5N A;  5FC8 E;  5KLR B;  2NYL B;  1XQS A;  1I7X A;  4U58 A;  4V3R A;  3TX7 A;  4P6Z B;  3L3Q A;  4LAC A;  3V71 A;  1JPP A;  4JLQ A;  2QNA A;  4FFB C;  5DN7 A;  4E4V A;  3K64 A;  4G3A A;  3ZIP A;  2PKG A;  1W63 A;  3UL1 B;  1EJY I;  2JKR B;  3QML C;  3VWA A;  1UN0 A;  2VGL B;  4R0Z A;  3T7U A;  4OIH A;  1IAL A;  2GL7 A;  2F31 A;  4CRV B;  4DJS A;  4YI0 C;  4U5S A;  1B3U A;  4R10 A;  1JPW A;  5E6Q B;  3PSP A;  1Z2C B;  1M8Z A;  4EV8 A;  3QHE A;  5BZ1 A;  3OPB A;  1Q1S C;  4JW2 B;  3WOZ A;  3A6P A;  1M8W A;  3EG5 B;  3UKZ B;  4K92 A;  1U6G C;  3Q0R A;  3AU3 A;  3OBV A;  3K49 A;  4U54 A;  3V74 A;  5EKG A;  5HHG E;  2JKT A;  4KZG A;  4O27 A;  3ND2 A;  3FGA A;  3TJZ B;  4CRU B;  4U5U A;  2BNX A;  3L3F X;  4BQK A;  3BTR C;  2BKU B;  4FZD A;  4U5V A;  3UL0 B;  4UQI B;  3BCT A;  3QG9 A;  3K5Z A;  1GCJ A;  1OYZ A;  3BSX A;  4MZ6 E;  4HNM A;  3UKY B;  4D4E A;  5H2X A;  4PLR A;  4BPL A;  2NPP B;  3Q0N A;  1M1E A;  3DAD A;  3DW8 A;  3GAE A;  2C1T A;  1IBR B;  2NYM B;  3ZHP A;  4NZW A;  2IAE A;  3QGB A;  3ZIR A;  3WOY A;  4FZF A;  1T08 A;  4U3J C;  1PJN B;  5J3V A;  4FZA A;  2Z6G A;  5KLA A;  2XA7 B;  1XQR A;  3GS3 A;  4R11 A;  5EKF A;  3H3D X;  4UWX A;  2JDQ A;  4CB8 A;  1PJM B;  1BK5 A;  2Z5N A;  4PLQ A;  2QMR A;  2YNS A;  4EVA A;  3LTJ A;  4FQ3 A;  2FV2 A;  3OQS A;  2P8Q A;  1IB2 A;  3LWW A;  1WA5 C;  4HXT A;  3BWT A;  5D5K C;  3WYF C;  1O6P A;  1I7W A;  4V3O A;  5LSW A;  3EA5 B;  4WV6 A;  4DB6 A;  3K7V A;  2Q5D A;  1QGK A;  2C1M A;  3Q5U A;  4Y5J A;  1M8X A;  3K7W A;  4IMJ A;  1BK6 A;  3BX2 A;  3NOW A;  2IE3 A;  3L6Y A;  3V6Y A;  1EE4 A;  4IMI A;  1UKL A;  3UKX B;  4DB9 A;  4D49 A;  1Q1T C;  4B8O A;  4CT6 B;  4CB9 A;  4NEE A;  5BZV A;  2WTK A; 
#chains in the Genus database with same CATH topology
 2BCT A;  3GB8 A;  3RZX A;  3PST A;  1WA5 B;  4I2S A;  1IQ1 C;  3K4E A;  2RU4 A;  4HM9 A;  2PF4 A;  3FEX C;  3VLD A;  4UAD A;  4DB8 A;  3Q0M A;  4YJL A;  4PLS A;  4I8M A;  5EWP A;  1F59 A;  5CL4 A;  1G3J A;  2NYL A;  3UVU A;  3RZ9 A;  5CLA A;  4U5O A;  4ZDU A;  1UPK A;  2Z5J A;  4I5L A;  3IFQ A;  4DBA A;  5CLE A;  4RZP A;  5BZ5 A;  4YJE A;  2BAP A;  5K9S A;  4MFU A;  2JKR A;  1W9C A;  4QMJ A;  3VLF A;  2VGL A;  3EBB A;  3C2G A;  1XM9 A;  3O2S A;  4UAE A;  5BYM A;  5KL1 A;  5HUW C;  1M8Y A;  5H2W A;  4P6Z G;  2JAK A;  2JKT B;  5BZU A;  4DVG B;  3TPO A;  3FGA B;  5K6S A;  1LSH A;  2DB0 A;  5KLT B;  4PVZ A;  4QMH A;  4XZR B;  5CTT A;  4I0Y A;  4DZS A;  5CL9 A;  2W3C A;  3ZIN A;  3BSB A;  2OT8 A;  3ZIQ A;  1QZ7 A;  2Z5O A;  1QBK B;  3GNI A;  1Y2A C;  1TH1 A;  4B18 A;  3FEY C;  4JW2 A;  4I2W A;  3OUW A;  4EV9 A;  4EVT A;  4CV5 B;  3Q0O A;  4RXH B;  5JJA A;  4I37 A;  1UPL A;  3K62 A;  2YNR A;  4I96 A;  4CBA A;  2QK1 A;  5CL5 A;  5SVZ A;  2X19 B;  4UAF B;  3K5Q A;  2IAE B;  2QK2 A;  4YGX A;  3OUX A;  3Q0L A;  1N4K A;  2X1G F;  4L7M A;  5CL7 A;  3C2H A;  3TT9 A;  4A0C A;  1V18 A;  5KL8 A;  1LRV A;  4K6J A;  3Q0Q A;  4GMN A;  4L4I A;  3IBV A;  4U5L A;  3GRL A;  4FDD A;  4UQI A;  4B8P A;  3ZKV A;  3L6X A;  1QGR A;  4ADY A;  1W63 B;  2Z5K A;  3NMX A;  2NPP A;  5SWF A;  3C5W A;  4OO6 A;  4TNM A;  3GQ2 A;  3ODR A;  3O4X A;  4QMI A;  5SW9 A;  4I5N A;  4YK6 A;  2NYM A;  4JW3 C;  4GMO A;  3BX3 A;  3Q0S A;  2YJY A;  2IE4 A;  4H3K A;  3BVS A;  4MFV A;  3VE6 A;  4V3Q A;  3GVO A;  3ZIO A;  2Z5M A;  3K61 A;  3JXY A;  4HTV A;  2XA7 A;  3LTM A;  1HO8 A;  4B8J A;  3VLE A;  3QGC A;  3NMW A;  3ODS A;  4I2Z A;  4H3H A;  4MZ5 E;  3NMZ A;  3WPT A;  1O6O A;  3JY1 A;  1LUJ A;  3K5Y A;  3O2Q A;  1EE5 A;  3W3U A;  4EVP A;  4L4H A;  2OF3 A;  1JDH A;  3GVT A;  3O2T A;  4RV1 A;  2IWH A;  2IX3 A;  5HUY C;  3Q0P A;  3JXZ A;  2RU4 B;  2Z6H A;  5CLD A;  1TE4 A;  4BA3 A;  3TPM A;  2H4M A;  3UKW B;  2IW3 A;  5AEI A;  1EJL I;  5B56 A;  3TJ3 A;  4CT7 B;  3KND A;  1M5N S;  4U5N A;  5FC8 E;  5KLR B;  2NYL B;  1XQS A;  1I7X A;  4U58 A;  4V3R A;  3TX7 A;  4P6Z B;  3L3Q A;  4LAC A;  3V71 A;  1JPP A;  4JLQ A;  2QNA A;  4FFB C;  5DN7 A;  4E4V A;  3K64 A;  4G3A A;  3ZIP A;  2PKG A;  4I6I A;  1W63 A;  3T8S A;  3UL1 B;  1EJY I;  2JKR B;  3QML C;  3VWA A;  1UN0 A;  2VGL B;  4R0Z A;  3T7U A;  4OIH A;  5CL8 A;  1IAL A;  2GL7 A;  2F31 A;  4CRV B;  4DJS A;  4YI0 C;  4U5S A;  1B3U A;  4R10 A;  1JPW A;  5E6Q B;  3PSP A;  1Z2C B;  1M8Z A;  4EV8 A;  3UJ0 A;  3QHE A;  3JX7 A;  5BZ1 A;  3OPB A;  1Q1S C;  4I7I A;  4JW2 B;  3WOZ A;  3A6P A;  1M8W A;  4U2X D;  3EG5 B;  5CL3 A;  3UKZ B;  4K92 A;  1U6G C;  3Q0R A;  3AU3 A;  3OBV A;  3K49 A;  4U54 A;  3V74 A;  5EKG A;  5HHG E;  2JKT A;  4KZG A;  4O27 A;  3ND2 A;  3FGA A;  3TJZ B;  4CRU B;  4U5U A;  2BNX A;  3L3F X;  4BQK A;  3BTR C;  2XOA A;  2BKU B;  4FZD A;  4FP7 A;  4U5V A;  3UL0 B;  4UQI B;  4I3N A;  5CL6 A;  3BCT A;  3QG9 A;  4JKQ A;  3K5Z A;  1GCJ A;  5CLB A;  1OYZ A;  3BSX A;  4MZ6 E;  4HNM A;  3UKY B;  4D4E A;  5H2X A;  3ZIL A;  5KUB A;  4PLR A;  4BPL A;  2NPP B;  3Q0N A;  3ZIK A;  1M1E A;  3DAD A;  3DW8 A;  3GAE A;  2C1T A;  1IBR B;  2NYM B;  3ZHP A;  5CLC A;  4NZW A;  4A3V A;  2IAE A;  3UJ4 A;  3QGB A;  3ZIR A;  4I1E A;  3WOY A;  4FZF A;  3SL9 A;  1T08 A;  4U3J C;  1PJN B;  5J3V A;  4FZA A;  2Z6G A;  5KLA A;  2XA7 B;  1XQR A;  3GS3 A;  4R11 A;  5EKF A;  3H3D X;  4UWX A;  2JDQ A;  4CB8 A;  1PJM B;  1BK5 A;  2Z5N A;  4PLQ A;  2QMR A;  2YNS A;  3SLA A;  4EVA A;  3LTJ A;  4FQ3 A;  2FV2 A;  3OQS A;  2P8Q A;  1IB2 A;  3LWW A;  1WA5 C;  4HXT A;  3BWT A;  5D5K C;  3WYF C;  1O6P A;  1I7W A;  4V3O A;  5LSW A;  3EA5 B;  4WV6 A;  4DB6 A;  3K7V A;  2Q5D A;  1QGK A;  2C1M A;  3Q5U A;  4Y5J A;  1M8X A;  3K7W A;  4IMJ A;  1BK6 A;  3BX2 A;  3NOW A;  2IE3 A;  3L6Y A;  3V6Y A;  1EE4 A;  4IMI A;  1UKL A;  4A3T A;  3UKX B;  4DB9 A;  4D49 A;  1Q1T C;  4B8O A;  4CT6 B;  4CB9 A;  4NEE A;  5BZV A;  2WTK A; 
#chains in the Genus database with same CATH homology
 2BCT A;  3GB8 A;  3RZX A;  3PST A;  1WA5 B;  4I2S A;  1IQ1 C;  3K4E A;  2RU4 A;  4HM9 A;  2PF4 A;  3FEX C;  3VLD A;  4UAD A;  4DB8 A;  3Q0M A;  4YJL A;  4PLS A;  4I8M A;  5EWP A;  1F59 A;  5CL4 A;  1G3J A;  2NYL A;  3UVU A;  3RZ9 A;  5CLA A;  4U5O A;  4ZDU A;  1UPK A;  2Z5J A;  4I5L A;  3IFQ A;  4DBA A;  5CLE A;  4RZP A;  5BZ5 A;  4YJE A;  2BAP A;  5K9S A;  4MFU A;  2JKR A;  1W9C A;  4QMJ A;  3VLF A;  2VGL A;  3EBB A;  3C2G A;  1XM9 A;  3O2S A;  4UAE A;  5BYM A;  5KL1 A;  5HUW C;  1M8Y A;  5H2W A;  4P6Z G;  2JAK A;  2JKT B;  5BZU A;  4DVG B;  3TPO A;  3FGA B;  5K6S A;  5KLT B;  2DB0 A;  4PVZ A;  4QMH A;  4XZR B;  5CTT A;  4I0Y A;  4DZS A;  5CL9 A;  2W3C A;  3ZIN A;  3BSB A;  2OT8 A;  3ZIQ A;  1QZ7 A;  2Z5O A;  1QBK B;  3GNI A;  1Y2A C;  1TH1 A;  4B18 A;  3FEY C;  4JW2 A;  4I2W A;  3OUW A;  4EV9 A;  4EVT A;  4CV5 B;  3Q0O A;  4RXH B;  5JJA A;  4I37 A;  1UPL A;  3K62 A;  2YNR A;  4I96 A;  4CBA A;  2QK1 A;  5CL5 A;  5SVZ A;  2X19 B;  4UAF B;  3K5Q A;  2IAE B;  2QK2 A;  4YGX A;  3OUX A;  3Q0L A;  4L7M A;  2X1G F;  5CL7 A;  3C2H A;  3TT9 A;  4A0C A;  1V18 A;  5KL8 A;  1LRV A;  4K6J A;  3Q0Q A;  4GMN A;  4L4I A;  3IBV A;  4U5L A;  3GRL A;  4FDD A;  4UQI A;  4B8P A;  3ZKV A;  3L6X A;  1QGR A;  4ADY A;  1W63 B;  2Z5K A;  3NMX A;  2NPP A;  5SWF A;  3C5W A;  4OO6 A;  4TNM A;  3GQ2 A;  3ODR A;  3O4X A;  4QMI A;  5SW9 A;  4I5N A;  4YK6 A;  2NYM A;  4JW3 C;  4GMO A;  3BX3 A;  3Q0S A;  2YJY A;  2IE4 A;  4H3K A;  3BVS A;  4MFV A;  3VE6 A;  4V3Q A;  3GVO A;  3ZIO A;  2Z5M A;  3K61 A;  3JXY A;  4HTV A;  2XA7 A;  3LTM A;  1HO8 A;  4B8J A;  3VLE A;  3QGC A;  3NMW A;  3ODS A;  4I2Z A;  4H3H A;  4MZ5 E;  3NMZ A;  3WPT A;  1O6O A;  3JY1 A;  1LUJ A;  3K5Y A;  3O2Q A;  1EE5 A;  3W3U A;  4EVP A;  4L4H A;  2OF3 A;  1JDH A;  3GVT A;  3O2T A;  4RV1 A;  2IWH A;  2IX3 A;  5HUY C;  3Q0P A;  3JXZ A;  2RU4 B;  2Z6H A;  5CLD A;  1TE4 A;  4BA3 A;  3TPM A;  2H4M A;  3UKW B;  2IW3 A;  5AEI A;  1EJL I;  5B56 A;  3TJ3 A;  4CT7 B;  3KND A;  1M5N S;  4U5N A;  5FC8 E;  5KLR B;  2NYL B;  1XQS A;  1I7X A;  4U58 A;  4V3R A;  3TX7 A;  4P6Z B;  3L3Q A;  4LAC A;  3V71 A;  1JPP A;  4JLQ A;  2QNA A;  4FFB C;  5DN7 A;  4E4V A;  3K64 A;  4G3A A;  3ZIP A;  2PKG A;  4I6I A;  1W63 A;  3UL1 B;  1EJY I;  2JKR B;  3QML C;  3VWA A;  1UN0 A;  2VGL B;  4R0Z A;  3T7U A;  4OIH A;  5CL8 A;  1IAL A;  2GL7 A;  2F31 A;  4CRV B;  4DJS A;  4YI0 C;  4U5S A;  1B3U A;  4R10 A;  1JPW A;  5E6Q B;  3PSP A;  1Z2C B;  1M8Z A;  4EV8 A;  3QHE A;  3JX7 A;  5BZ1 A;  3OPB A;  1Q1S C;  4I7I A;  4JW2 B;  3WOZ A;  3A6P A;  1M8W A;  4U2X D;  3EG5 B;  5CL3 A;  3UKZ B;  4K92 A;  1U6G C;  3Q0R A;  3AU3 A;  3OBV A;  3K49 A;  4U54 A;  3V74 A;  5EKG A;  5HHG E;  2JKT A;  4KZG A;  4O27 A;  3ND2 A;  3FGA A;  3TJZ B;  4CRU B;  4U5U A;  2BNX A;  3L3F X;  4BQK A;  3BTR C;  2XOA A;  2BKU B;  4FZD A;  4FP7 A;  4U5V A;  3UL0 B;  4UQI B;  4I3N A;  5CL6 A;  3BCT A;  3QG9 A;  4JKQ A;  3K5Z A;  1GCJ A;  5CLB A;  1OYZ A;  3BSX A;  4MZ6 E;  4HNM A;  3UKY B;  4D4E A;  5H2X A;  3ZIL A;  5KUB A;  4PLR A;  4BPL A;  2NPP B;  3Q0N A;  3ZIK A;  1M1E A;  3DAD A;  3DW8 A;  3GAE A;  2C1T A;  1IBR B;  2NYM B;  3ZHP A;  5CLC A;  4NZW A;  4A3V A;  2IAE A;  3QGB A;  3ZIR A;  4I1E A;  3WOY A;  4FZF A;  3SL9 A;  1T08 A;  4U3J C;  1PJN B;  5J3V A;  4FZA A;  2Z6G A;  5KLA A;  2XA7 B;  1XQR A;  3GS3 A;  4R11 A;  5EKF A;  3H3D X;  4UWX A;  2JDQ A;  4CB8 A;  1PJM B;  1BK5 A;  2Z5N A;  4PLQ A;  2QMR A;  2YNS A;  3SLA A;  4EVA A;  3LTJ A;  4FQ3 A;  2FV2 A;  3OQS A;  2P8Q A;  1IB2 A;  3LWW A;  1WA5 C;  4HXT A;  3BWT A;  5D5K C;  3WYF C;  1O6P A;  1I7W A;  4V3O A;  5LSW A;  3EA5 B;  4WV6 A;  4DB6 A;  3K7V A;  2Q5D A;  1QGK A;  2C1M A;  3Q5U A;  4Y5J A;  1M8X A;  3K7W A;  4IMJ A;  1BK6 A;  3BX2 A;  3NOW A;  2IE3 A;  3L6Y A;  3V6Y A;  1EE4 A;  4IMI A;  1UKL A;  4A3T A;  3UKX B;  4DB9 A;  4D49 A;  1Q1T C;  4B8O A;  4CT6 B;  4CB9 A;  4NEE A;  5BZV A;  2WTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...