3BX2A

Puf4 rna binding domain bound to ho endonuclease rna 3' utr recognition sequence
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
328
structure length
328
Chain Sequence
VLDQYIGSIHSLCKDQHGCRFLQKQLDILGSKAADAIFEETKDYTVELMTDSFGNYLIQKLLEEVTTEQRIVLTKISSPHFVEISLNPHGTRALQKLIECIKTDEEAQIVVDSLRPYTVQLSKDLNGNHVIQKCLQRLKPENFQFIFDAISDSCIDIATHRHGCCVLQRCLDHGTTEQCDNLCDKLLALVDKLTLDPFGNYVVQYIITKEAEKNKYDYTHKIVHLLKPRAIELSIHKFGSNVIEKILKTAIVSEPMILEILNNGGETGIQSLLNDSYGNYVLQTALDISHKQNDYLYKRLSEIVAPLLVGPIRNTPHGKRIIGMLHLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription, rna binding protein/rna
molecule keywords HO endonuclease 3' UTR binding sequence
publication title Basis of altered RNA-binding specificity by PUF proteins revealed by crystal structures of yeast Puf4p
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 131
structure length 328
sequence length 328
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00806 PUF Pumilio-family RNA binding repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 3bx2A00
2QK2A 4OO6A 4BPLA 1TH1A 4U5VA 4UQIA 2YNRA 3Q5UA 3ZIPA 3ZIRA 3LTMA 5SW9A 4YK6A 2Z6HA 3LWWA 2FV2A 2Z5NA 1HO8A 4QMHA 2JKTA 5H2WA 5KLTB 4HNMA 1T08A 5B56A 4ZDUA 4JW2B 4ADYA 1QZ7A 4U5UA 1F59A 5E6QB 4DB6A 3TJ3A 3OUXA 3UKYB 1M8XA 4P6ZB 3OQSA 3FEYC 2BNXA 1UPLA 2IAEB 3Q0RA 3Q0OA 3K5YA 4DBAA 2NPPB 1QGKA 2C1TA 3ZINA 4DB8A 3TT9A 1GCJA 2VGLA 3GNIA 2PF4A 4RXHB 4CT6B 2RU4A 4I5LA 4FQ3A 2Z5JA 2Z5MA 4TNMA 3ZIOA 2NYMB 4NEEA 3UL0B 4CB8A 3Q0NA 3WPTA 4GMOA 4PLRA 4R10A 5EKGA 3TPOA 3UKZB 3O2SA 3ODSA 1IALA 2GL7A 3IFQA 2XA7B 3Q0MA 4E4VA 2JDQA 1EE5A 2OF3A 1O6OA 2IW3A 4RZPA 4K6JA 3NMWA 4FFBC 1IBRB 4BQKA 1M1EA 2Z5KA 4U3JC 3QMLC 3OBVA 4L7MA 4U58A 3L3QA 5K6SA 3TPMA 1I7WA 2F31A 1QBKB 3DADA 3QHEA 1Z2CB 4LACA 2WTKA 1UPKA 3RZXA 1BK6A 3ZIQA 3ODRA 1I7XA 5BZUA 4YJEA 5KLAA 4CRVB 3NMXA 3WOZA 4NZWA 5AEIA 4I5NA 3EA5B 5HUYC 4I2WA 3K61A 1M8YA 3BX3A 3C2GA 1EE4A 4G3AA 3VWAA 4CBAA 4DB9A 1O6PA 4KZGA 3A6PA 2H4MA 4V3RA 3UL1B 2C1MA 1B3UA 3LTJA 4P6ZG 4UADA 3Q0QA 4EV8A 4UAFB 4GMNA 4H3HA 3GVTA 1UN0A 3DW8A 3BSBA 4UQIB 4EV9A 1V18A 3BX2A 3V71A 4I2ZA 3PSPA 1XM9A 4D4EA 2BAPA 2JKTB 3BTRC 4D49A 3K64A 3PSTA 4IMJA 4HTVA 4YGXA 3UKWB 2NYLA 3ZKVA 1PJMB 3IBVA 3FGAB 3V6YA 5SWFA 3K4EA 2YNSA 4MFUA 4A0CA 1BK5A 3O2TA 2BKUB 5KL1A 4U5NA 3C2HA 2VGLB 2PKGA 1Y2AC 2RU4B 3RZ9A 1IB2A 3OPBA 3GB8A 3O2QA 5CTTA 1G3JA 4YJLA 4UWXA 4B18A 5K9SA 4V3QA 4FZFA 4MFVA 1EJYI 3VE6A 3UVUA 1M5NS 5H2XA 2QNAA 4HM9A 1Q1SC 2QK1A 4PLQA 4QMIA 1WA5B 4K92A 4OIHA 4WV6A 3K62A 5KL8A 3L6YA 4B8OA 3K7VA 2JKRA 3NMZA 4EVAA 3O4XA 4RV1A 1W63A 4DVGB 4UAEA 4XZRB 3GAEA 5EWPA 1LUJA 2Q5DA 4FZAA 5LSWA 3T7UA 5EKFA 5SVZA 5D5KC 4U54A 3ZHPA 5DN7A 1PJNB 3OUWA 4Y5JA 1M8WA 2IWHA 3TJZB 3Q0LA 1JPPA 5BZ5A 2OT8A 3BCTA 1UKLA 4R11A 2Z6GA 3KNDA 4EVTA 3AU3A 2IX3A 3L6XA 5BZ1A 3K5QA 3K5ZA 3EG5B 4PLSA 3K7WA 1EJLI 4DZSA 4PVZA 3BSXA 4H3KA 4B8PA 1U6GC 2JAKA 1QGRA 3C5WA 4CB9A 3QGBA 2IE4A 2Z5OA 2IAEA 4JLQA 3BWTA 4CV5B 4QMJA 2NPPA 3V74A 3FGAA 4CRUB 5FC8E 3GRLA 4IMIA 1M8ZA 3GVOA 2NYMA 2NYLB 4YI0C 3Q0PA 5BZVA 2QMRA 3UKXB 3W3UA 4MZ5E 3NOWA 1IQ1C 2XA7A 3GQ2A 3Q0SA 5KLRB 1JPWA 1Q1TC 5BYMA 4BA3A 1OYZA 4EVPA 5HUWC 3ND2A 2P8QA 4DJSA 4U5SA 3FEXC 2YJYA 2IE3A 4V3OA 5J3VA 3QG9A 3L3FX 2DB0A 3WYFC 1LRVA 5HHGE 4O27A 4R0ZA 3H3DX 3GS3A 4U5OA 2BCTA 3QGCA 3TX7A 3K49A 3EBBA 1WA5C 1JDHA 1XQSA 4U5LA 4FZDA 3WOYA 4B8JA 2JKRB 1W9CA 2X1GF 4CT7B 1W63B 4FDDA 1XQRA 4HXTA 2X19B 4MZ6E 2W3CA 5JJAA
chains in the Genus database with same CATH superfamily
2QK2A 4OO6A 4BPLA 1TH1A 4U5VA 4UQIA 2YNRA 5CL8A 3Q5UA 3ZIPA 3ZIRA 3LTMA 5SW9A 4YK6A 2Z6HA 3LWWA 2FV2A 2Z5NA 1HO8A 4QMHA 2JKTA 5H2WA 5CLEA 5KLTB 5CLDA 4HNMA 1T08A 5B56A 4ZDUA 4A3TA 4JW2B 3UJ0A 4ADYA 1QZ7A 3VLDA 4U5UA 1F59A 5E6QB 4DB6A 3TJ3A 4A3VA 3OUXA 3UKYB 1M8XA 4P6ZB 3OQSA 3FEYC 2BNXA 1UPLA 2IAEB 3Q0RA 3Q0OA 3K5YA 5CL6A 3VLEA 4DBAA 2NPPB 5KUBA 1QGKA 2C1TA 3ZINA 4DB8A 3TT9A 1GCJA 2VGLA 3GNIA 2PF4A 4RXHB 4CT6B 2RU4A 4I5LA 4FQ3A 2Z5JA 2Z5MA 4TNMA 5CL4A 3ZIOA 2NYMB 4NEEA 3UL0B 4CB8A 3Q0NA 3WPTA 1TE4A 4GMOA 4PLRA 4R10A 3TPOA 5EKGA 3UKZB 3O2SA 3ODSA 1IALA 2GL7A 3IFQA 2XA7B 3Q0MA 4E4VA 3JX7A 2JDQA 1EE5A 2OF3A 1O6OA 2IW3A 5CL3A 4RZPA 4K6JA 3NMWA 4FFBC 1IBRB 4BQKA 1M1EA 2Z5KA 4U3JC 3QMLC 3OBVA 4L7MA 4U58A 3L3QA 5K6SA 3TPMA 1I7WA 2F31A 1QBKB 3DADA 3ZILA 3QHEA 1Z2CB 4LACA 2WTKA 1UPKA 3RZXA 1BK6A 3ZIQA 1LSHA 3ODRA 1I7XA 4JW3C 5BZUA 4YJEA 4FP7A 5KLAA 4CRVB 3NMXA 3WOZA 4I8MA 4NZWA 5AEIA 4I5NA 5CLAA 3EA5B 5HUYC 4I2WA 3K61A 1M8YA 3BX3A 3C2GA 1EE4A 4G3AA 3VWAA 4CBAA 4DB9A 1O6PA 4KZGA 3A6PA 2H4MA 4V3RA 3UL1B 2C1MA 1B3UA 3LTJA 4P6ZG 4UADA 3Q0QA 4EV8A 4UAFB 4GMNA 4H3HA 3GVTA 1UN0A 3DW8A 3T8SA 3BSBA 4UQIB 4EV9A 3UJ4A 1V18A 3BX2A 3V71A 4I2ZA 3PSPA 1XM9A 4D4EA 4I6IA 2BAPA 2JKTB 3BTRC 4D49A 3K64A 5CL7A 3PSTA 3SL9A 4IMJA 4HTVA 4YGXA 3UKWB 2NYLA 1N4KA 3ZKVA 1PJMB 3IBVA 3FGAB 3V6YA 5SWFA 3K4EA 5CL5A 2YNSA 4MFUA 4A0CA 4I2SA 1BK5A 3O2TA 2BKUB 5KL1A 4U5NA 3C2HA 2VGLB 2PKGA 1Y2AC 2RU4B 3RZ9A 1IB2A 3OPBA 3GB8A 3O2QA 5CTTA 1G3JA 4YJLA 4L4HA 4UWXA 4B18A 5K9SA 4V3QA 4FZFA 4MFVA 1EJYI 3VE6A 3UVUA 1M5NS 3ZIKA 5H2XA 2QNAA 2XOAA 4HM9A 1Q1SC 2QK1A 4PLQA 4QMIA 5CLBA 1WA5B 4K92A 4OIHA 4WV6A 3K62A 5KL8A 4JKQA 3L6YA 4B8OA 3K7VA 2JKRA 3NMZA 4EVAA 3O4XA 4RV1A 1W63A 4DVGB 4UAEA 4XZRB 3GAEA 5EWPA 1LUJA 2Q5DA 4FZAA 5LSWA 3T7UA 5EKFA 4I37A 5SVZA 5D5KC 4U54A 3ZHPA 5DN7A 1PJNB 3OUWA 4Y5JA 1M8WA 2IWHA 3TJZB 3Q0LA 1JPPA 3JXZA 5BZ5A 2OT8A 3BCTA 1UKLA 4R11A 2Z6GA 3KNDA 4EVTA 3AU3A 2IX3A 3L6XA 5BZ1A 3K5QA 3K5ZA 3SLAA 3EG5B 4PLSA 3K7WA 4JW2A 1EJLI 4DZSA 4PVZA 3BSXA 4H3KA 4B8PA 1U6GC 2JAKA 1QGRA 5CL9A 3C5WA 4CB9A 3QGBA 2IE4A 2Z5OA 2IAEA 4JLQA 3BWTA 4CV5B 4QMJA 2NPPA 3V74A 3FGAA 4U2XD 5JJAA 4CRUB 5FC8E 5CLCA 3GRLA 4IMIA 1M8ZA 3VLFA 3GVOA 4I3NA 2NYMA 2NYLB 4YI0C 3Q0PA 5BZVA 2QMRA 3UKXB 3W3UA 4MZ5E 3NOWA 1IQ1C 2XA7A 3GQ2A 3Q0SA 3BVSA 5KLRB 1JPWA 1Q1TC 5BYMA 4BA3A 1OYZA 4EVPA 5HUWC 3ND2A 2P8QA 4DJSA 4U5SA 4L4IA 3FEXC 2YJYA 2IE3A 4V3OA 5J3VA 3JXYA 3QG9A 3L3FX 2DB0A 3WYFC 1LRVA 5HHGE 4O27A 4R0ZA 4I7IA 3JY1A 3H3DX 3GS3A 4U5OA 2BCTA 3QGCA 3TX7A 3K49A 3EBBA 1WA5C 1JDHA 1XQSA 4U5LA 4FZDA 3WOYA 4B8JA 4I0YA 2JKRB 1W9CA 2X1GF 4CT7B 1W63B 4FDDA 1XQRA 4HXTA 2X19B 4MZ6E 4I1EA 2W3CA 4I96A
chains in the Genus database with same CATH topology
2QK2A 4OO6A 4BPLA 1TH1A 4U5VA 4UQIA 2YNRA 5CL8A 3Q5UA 3ZIPA 3ZIRA 3LTMA 5SW9A 4YK6A 2Z6HA 3LWWA 2FV2A 2Z5NA 1HO8A 4QMHA 2JKTA 5H2WA 5CLEA 5KLTB 5CLDA 4HNMA 1T08A 5B56A 4ZDUA 4A3TA 4JW2B 4ADYA 1QZ7A 3VLDA 4U5UA 1F59A 5E6QB 4DB6A 3TJ3A 4A3VA 3OUXA 3UKYB 1M8XA 4P6ZB 3OQSA 3FEYC 2BNXA 1UPLA 2IAEB 3Q0RA 3Q0OA 3K5YA 5CL6A 3VLEA 4DBAA 2NPPB 5KUBA 1QGKA 2C1TA 3ZINA 4DB8A 3TT9A 1GCJA 2VGLA 3GNIA 2PF4A 4RXHB 4CT6B 2RU4A 4I5LA 4FQ3A 2Z5JA 2Z5MA 4TNMA 5CL4A 3ZIOA 2NYMB 4NEEA 3UL0B 4CB8A 3Q0NA 3WPTA 1TE4A 4GMOA 4PLRA 4R10A 3TPOA 5EKGA 3UKZB 3O2SA 3ODSA 1IALA 2GL7A 3IFQA 2XA7B 3Q0MA 4E4VA 3JX7A 2JDQA 1EE5A 2OF3A 1O6OA 2IW3A 5CL3A 4RZPA 4K6JA 3NMWA 4FFBC 1IBRB 4BQKA 1M1EA 2Z5KA 4U3JC 3QMLC 3OBVA 4L7MA 4U58A 3L3QA 5K6SA 3TPMA 1I7WA 2F31A 1QBKB 3DADA 3ZILA 3QHEA 1Z2CB 4LACA 2WTKA 1UPKA 3RZXA 1BK6A 3ZIQA 3ODRA 1I7XA 4JW3C 5BZUA 4YJEA 4FP7A 5KLAA 4CRVB 3NMXA 3WOZA 4I8MA 4NZWA 5AEIA 4I5NA 5CLAA 3EA5B 5HUYC 4I2WA 3K61A 1M8YA 3BX3A 3C2GA 1EE4A 4G3AA 3VWAA 4CBAA 4DB9A 1O6PA 4KZGA 3A6PA 2H4MA 4V3RA 3UL1B 2C1MA 1B3UA 3LTJA 4P6ZG 4UADA 3Q0QA 4EV8A 4UAFB 4GMNA 4H3HA 3GVTA 1UN0A 3DW8A 3BSBA 4UQIB 4EV9A 1V18A 3BX2A 3V71A 4I2ZA 3PSPA 1XM9A 4D4EA 4I6IA 2BAPA 2JKTB 3BTRC 4D49A 3K64A 5CL7A 3PSTA 3SL9A 4IMJA 4HTVA 4YGXA 3UKWB 2NYLA 3ZKVA 1PJMB 3IBVA 3FGAB 3V6YA 5SWFA 3K4EA 5CL5A 2YNSA 4MFUA 4A0CA 4I2SA 1BK5A 3O2TA 2BKUB 5KL1A 4U5NA 3C2HA 2VGLB 2PKGA 1Y2AC 2RU4B 3RZ9A 1IB2A 3OPBA 3GB8A 3O2QA 5CTTA 1G3JA 4YJLA 4L4HA 4UWXA 4B18A 5K9SA 4V3QA 4FZFA 4MFVA 1EJYI 3VE6A 3UVUA 1M5NS 3ZIKA 5H2XA 2QNAA 2XOAA 4HM9A 1Q1SC 2QK1A 4PLQA 4QMIA 5CLBA 1WA5B 4K92A 4OIHA 4WV6A 3K62A 5KL8A 4JKQA 3L6YA 4B8OA 3K7VA 2JKRA 3NMZA 4EVAA 3O4XA 4RV1A 1W63A 4DVGB 4UAEA 4XZRB 3GAEA 5EWPA 1LUJA 2Q5DA 4FZAA 5LSWA 3T7UA 5EKFA 4I37A 5SVZA 5D5KC 4U54A 3ZHPA 5DN7A 1PJNB 3OUWA 4Y5JA 1M8WA 2IWHA 3TJZB 3Q0LA 1JPPA 3JXZA 5BZ5A 2OT8A 3BCTA 1UKLA 4R11A 2Z6GA 3KNDA 4EVTA 3AU3A 2IX3A 3L6XA 5BZ1A 3K5QA 3K5ZA 3SLAA 3EG5B 4PLSA 3K7WA 4JW2A 1EJLI 4DZSA 4PVZA 3BSXA 4H3KA 4B8PA 1U6GC 2JAKA 1QGRA 5CL9A 3C5WA 4CB9A 3QGBA 2IE4A 2Z5OA 2IAEA 4JLQA 3BWTA 4CV5B 4QMJA 2NPPA 3V74A 3FGAA 4U2XD 5JJAA 4CRUB 5FC8E 5CLCA 3GRLA 4IMIA 1M8ZA 3VLFA 3GVOA 4I3NA 2NYMA 2NYLB 4YI0C 3Q0PA 5BZVA 2QMRA 3UKXB 3W3UA 4MZ5E 3NOWA 1IQ1C 2XA7A 3GQ2A 3Q0SA 3BVSA 5KLRB 1JPWA 1Q1TC 5BYMA 4BA3A 1OYZA 4EVPA 5HUWC 3ND2A 2P8QA 4DJSA 4U5SA 4L4IA 3FEXC 2YJYA 2IE3A 4V3OA 5J3VA 3JXYA 3QG9A 3L3FX 2DB0A 3WYFC 1LRVA 5HHGE 4O27A 4R0ZA 4I7IA 3JY1A 3H3DX 3GS3A 4U5OA 2BCTA 3QGCA 3TX7A 3K49A 3EBBA 1WA5C 1JDHA 1XQSA 4U5LA 4FZDA 3WOYA 4B8JA 4I0YA 2JKRB 1W9CA 2X1GF 4CT7B 1W63B 4FDDA 1XQRA 4HXTA 2X19B 4MZ6E 4I1EA 2W3CA 4I96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QK2 A;  4OO6 A;  4BPL A;  1TH1 A;  4U5V A;  4UQI A;  2YNR A;  3Q5U A;  3ZIP A;  3ZIR A;  3LTM A;  5SW9 A;  4YK6 A;  2Z6H A;  3LWW A;  2FV2 A;  2Z5N A;  1HO8 A;  4QMH A;  2JKT A;  5H2W A;  5KLT B;  4HNM A;  1T08 A;  5B56 A;  4ZDU A;  4JW2 B;  4ADY A;  1QZ7 A;  4U5U A;  1F59 A;  5E6Q B;  4DB6 A;  3TJ3 A;  3OUX A;  3UKY B;  1M8X A;  4P6Z B;  3OQS A;  3FEY C;  2BNX A;  1UPL A;  2IAE B;  3Q0R A;  3Q0O A;  3K5Y A;  4DBA A;  2NPP B;  1QGK A;  2C1T A;  3ZIN A;  4DB8 A;  3TT9 A;  1GCJ A;  2VGL A;  3GNI A;  2PF4 A;  4RXH B;  4CT6 B;  2RU4 A;  4I5L A;  4FQ3 A;  2Z5J A;  2Z5M A;  4TNM A;  3ZIO A;  2NYM B;  4NEE A;  3UL0 B;  4CB8 A;  3Q0N A;  3WPT A;  4GMO A;  4PLR A;  4R10 A;  5EKG A;  3TPO A;  3UKZ B;  3O2S A;  3ODS A;  1IAL A;  2GL7 A;  3IFQ A;  2XA7 B;  3Q0M A;  4E4V A;  2JDQ A;  1EE5 A;  2OF3 A;  1O6O A;  2IW3 A;  4RZP A;  4K6J A;  3NMW A;  4FFB C;  1IBR B;  4BQK A;  1M1E A;  2Z5K A;  4U3J C;  3QML C;  3OBV A;  4L7M A;  4U58 A;  3L3Q A;  5K6S A;  3TPM A;  1I7W A;  2F31 A;  1QBK B;  3DAD A;  3QHE A;  1Z2C B;  4LAC A;  2WTK A;  1UPK A;  3RZX A;  1BK6 A;  3ZIQ A;  3ODR A;  1I7X A;  5BZU A;  4YJE A;  5KLA A;  4CRV B;  3NMX A;  3WOZ A;  4NZW A;  5AEI A;  4I5N A;  3EA5 B;  5HUY C;  4I2W A;  3K61 A;  1M8Y A;  3BX3 A;  3C2G A;  1EE4 A;  4G3A A;  3VWA A;  4CBA A;  4DB9 A;  1O6P A;  4KZG A;  3A6P A;  2H4M A;  4V3R A;  3UL1 B;  2C1M A;  1B3U A;  3LTJ A;  4P6Z G;  4UAD A;  3Q0Q A;  4EV8 A;  4UAF B;  4GMN A;  4H3H A;  3GVT A;  1UN0 A;  3DW8 A;  3BSB A;  4UQI B;  4EV9 A;  1V18 A;  3BX2 A;  3V71 A;  4I2Z A;  3PSP A;  1XM9 A;  4D4E A;  2BAP A;  2JKT B;  3BTR C;  4D49 A;  3K64 A;  3PST A;  4IMJ A;  4HTV A;  4YGX A;  3UKW B;  2NYL A;  3ZKV A;  1PJM B;  3IBV A;  3FGA B;  3V6Y A;  5SWF A;  3K4E A;  2YNS A;  4MFU A;  4A0C A;  1BK5 A;  3O2T A;  2BKU B;  5KL1 A;  4U5N A;  3C2H A;  2VGL B;  2PKG A;  1Y2A C;  2RU4 B;  3RZ9 A;  1IB2 A;  3OPB A;  3GB8 A;  3O2Q A;  5CTT A;  1G3J A;  4YJL A;  4UWX A;  4B18 A;  5K9S A;  4V3Q A;  4FZF A;  4MFV A;  1EJY I;  3VE6 A;  3UVU A;  1M5N S;  5H2X A;  2QNA A;  4HM9 A;  1Q1S C;  2QK1 A;  4PLQ A;  4QMI A;  1WA5 B;  4K92 A;  4OIH A;  4WV6 A;  3K62 A;  5KL8 A;  3L6Y A;  4B8O A;  3K7V A;  2JKR A;  3NMZ A;  4EVA A;  3O4X A;  4RV1 A;  1W63 A;  4DVG B;  4UAE A;  4XZR B;  3GAE A;  5EWP A;  1LUJ A;  2Q5D A;  4FZA A;  5LSW A;  3T7U A;  5EKF A;  5SVZ A;  5D5K C;  4U54 A;  3ZHP A;  5DN7 A;  1PJN B;  3OUW A;  4Y5J A;  1M8W A;  2IWH A;  3TJZ B;  3Q0L A;  1JPP A;  5BZ5 A;  2OT8 A;  3BCT A;  1UKL A;  4R11 A;  2Z6G A;  3KND A;  4EVT A;  3AU3 A;  2IX3 A;  3L6X A;  5BZ1 A;  3K5Q A;  3K5Z A;  3EG5 B;  4PLS A;  3K7W A;  1EJL I;  4DZS A;  4PVZ A;  3BSX A;  4H3K A;  4B8P A;  1U6G C;  2JAK A;  1QGR A;  3C5W A;  4CB9 A;  3QGB A;  2IE4 A;  2Z5O A;  2IAE A;  4JLQ A;  3BWT A;  4CV5 B;  4QMJ A;  2NPP A;  3V74 A;  3FGA A;  4CRU B;  5FC8 E;  3GRL A;  4IMI A;  1M8Z A;  3GVO A;  2NYM A;  2NYL B;  4YI0 C;  3Q0P A;  5BZV A;  2QMR A;  3UKX B;  3W3U A;  4MZ5 E;  3NOW A;  1IQ1 C;  2XA7 A;  3GQ2 A;  3Q0S A;  5KLR B;  1JPW A;  1Q1T C;  5BYM A;  4BA3 A;  1OYZ A;  4EVP A;  5HUW C;  3ND2 A;  2P8Q A;  4DJS A;  4U5S A;  3FEX C;  2YJY A;  2IE3 A;  4V3O A;  5J3V A;  3QG9 A;  3L3F X;  2DB0 A;  3WYF C;  1LRV A;  5HHG E;  4O27 A;  4R0Z A;  3H3D X;  3GS3 A;  4U5O A;  2BCT A;  3QGC A;  3TX7 A;  3K49 A;  3EBB A;  1WA5 C;  1JDH A;  1XQS A;  4U5L A;  4FZD A;  3WOY A;  4B8J A;  2JKR B;  1W9C A;  2X1G F;  4CT7 B;  1W63 B;  4FDD A;  1XQR A;  4HXT A;  2X19 B;  4MZ6 E;  2W3C A;  5JJA A; 
#chains in the Genus database with same CATH topology
 2QK2 A;  4OO6 A;  4BPL A;  1TH1 A;  4U5V A;  4UQI A;  2YNR A;  5CL8 A;  3Q5U A;  3ZIP A;  3ZIR A;  3LTM A;  5SW9 A;  4YK6 A;  2Z6H A;  3LWW A;  2FV2 A;  2Z5N A;  1HO8 A;  4QMH A;  2JKT A;  5H2W A;  5CLE A;  5KLT B;  5CLD A;  4HNM A;  1T08 A;  5B56 A;  4ZDU A;  4A3T A;  4JW2 B;  3UJ0 A;  4ADY A;  1QZ7 A;  3VLD A;  4U5U A;  1F59 A;  5E6Q B;  4DB6 A;  3TJ3 A;  4A3V A;  3OUX A;  3UKY B;  1M8X A;  4P6Z B;  3OQS A;  3FEY C;  2BNX A;  1UPL A;  2IAE B;  3Q0R A;  3Q0O A;  3K5Y A;  5CL6 A;  3VLE A;  4DBA A;  2NPP B;  5KUB A;  1QGK A;  2C1T A;  3ZIN A;  4DB8 A;  3TT9 A;  1GCJ A;  2VGL A;  3GNI A;  2PF4 A;  4RXH B;  4CT6 B;  2RU4 A;  4I5L A;  4FQ3 A;  2Z5J A;  2Z5M A;  4TNM A;  5CL4 A;  3ZIO A;  2NYM B;  4NEE A;  3UL0 B;  4CB8 A;  3Q0N A;  3WPT A;  1TE4 A;  4GMO A;  4PLR A;  4R10 A;  3TPO A;  5EKG A;  3UKZ B;  3O2S A;  3ODS A;  1IAL A;  2GL7 A;  3IFQ A;  2XA7 B;  3Q0M A;  4E4V A;  3JX7 A;  2JDQ A;  1EE5 A;  2OF3 A;  1O6O A;  2IW3 A;  5CL3 A;  4RZP A;  4K6J A;  3NMW A;  4FFB C;  1IBR B;  4BQK A;  1M1E A;  2Z5K A;  4U3J C;  3QML C;  3OBV A;  4L7M A;  4U58 A;  3L3Q A;  5K6S A;  3TPM A;  1I7W A;  2F31 A;  1QBK B;  3DAD A;  3ZIL A;  3QHE A;  1Z2C B;  4LAC A;  2WTK A;  1UPK A;  3RZX A;  1BK6 A;  3ZIQ A;  1LSH A;  3ODR A;  1I7X A;  4JW3 C;  5BZU A;  4YJE A;  4FP7 A;  5KLA A;  4CRV B;  3NMX A;  3WOZ A;  4I8M A;  4NZW A;  5AEI A;  4I5N A;  5CLA A;  3EA5 B;  5HUY C;  4I2W A;  3K61 A;  1M8Y A;  3BX3 A;  3C2G A;  1EE4 A;  4G3A A;  3VWA A;  4CBA A;  4DB9 A;  1O6P A;  4KZG A;  3A6P A;  2H4M A;  4V3R A;  3UL1 B;  2C1M A;  1B3U A;  3LTJ A;  4P6Z G;  4UAD A;  3Q0Q A;  4EV8 A;  4UAF B;  4GMN A;  4H3H A;  3GVT A;  1UN0 A;  3DW8 A;  3T8S A;  3BSB A;  4UQI B;  4EV9 A;  3UJ4 A;  1V18 A;  3BX2 A;  3V71 A;  4I2Z A;  3PSP A;  1XM9 A;  4D4E A;  4I6I A;  2BAP A;  2JKT B;  3BTR C;  4D49 A;  3K64 A;  5CL7 A;  3PST A;  3SL9 A;  4IMJ A;  4HTV A;  4YGX A;  3UKW B;  2NYL A;  1N4K A;  3ZKV A;  1PJM B;  3IBV A;  3FGA B;  3V6Y A;  5SWF A;  3K4E A;  5CL5 A;  2YNS A;  4MFU A;  4A0C A;  4I2S A;  1BK5 A;  3O2T A;  2BKU B;  5KL1 A;  4U5N A;  3C2H A;  2VGL B;  2PKG A;  1Y2A C;  2RU4 B;  3RZ9 A;  1IB2 A;  3OPB A;  3GB8 A;  3O2Q A;  5CTT A;  1G3J A;  4YJL A;  4L4H A;  4UWX A;  4B18 A;  5K9S A;  4V3Q A;  4FZF A;  4MFV A;  1EJY I;  3VE6 A;  3UVU A;  1M5N S;  3ZIK A;  5H2X A;  2QNA A;  2XOA A;  4HM9 A;  1Q1S C;  2QK1 A;  4PLQ A;  4QMI A;  5CLB A;  1WA5 B;  4K92 A;  4OIH A;  4WV6 A;  3K62 A;  5KL8 A;  4JKQ A;  3L6Y A;  4B8O A;  3K7V A;  2JKR A;  3NMZ A;  4EVA A;  3O4X A;  4RV1 A;  1W63 A;  4DVG B;  4UAE A;  4XZR B;  3GAE A;  5EWP A;  1LUJ A;  2Q5D A;  4FZA A;  5LSW A;  3T7U A;  5EKF A;  4I37 A;  5SVZ A;  5D5K C;  4U54 A;  3ZHP A;  5DN7 A;  1PJN B;  3OUW A;  4Y5J A;  1M8W A;  2IWH A;  3TJZ B;  3Q0L A;  1JPP A;  3JXZ A;  5BZ5 A;  2OT8 A;  3BCT A;  1UKL A;  4R11 A;  2Z6G A;  3KND A;  4EVT A;  3AU3 A;  2IX3 A;  3L6X A;  5BZ1 A;  3K5Q A;  3K5Z A;  3SLA A;  3EG5 B;  4PLS A;  3K7W A;  4JW2 A;  1EJL I;  4DZS A;  4PVZ A;  3BSX A;  4H3K A;  4B8P A;  1U6G C;  2JAK A;  1QGR A;  5CL9 A;  3C5W A;  4CB9 A;  3QGB A;  2IE4 A;  2Z5O A;  2IAE A;  4JLQ A;  3BWT A;  4CV5 B;  4QMJ A;  2NPP A;  3V74 A;  3FGA A;  4U2X D;  5JJA A;  4CRU B;  5FC8 E;  5CLC A;  3GRL A;  4IMI A;  1M8Z A;  3VLF A;  3GVO A;  4I3N A;  2NYM A;  2NYL B;  4YI0 C;  3Q0P A;  5BZV A;  2QMR A;  3UKX B;  3W3U A;  4MZ5 E;  3NOW A;  1IQ1 C;  2XA7 A;  3GQ2 A;  3Q0S A;  3BVS A;  5KLR B;  1JPW A;  1Q1T C;  5BYM A;  4BA3 A;  1OYZ A;  4EVP A;  5HUW C;  3ND2 A;  2P8Q A;  4DJS A;  4U5S A;  4L4I A;  3FEX C;  2YJY A;  2IE3 A;  4V3O A;  5J3V A;  3JXY A;  3QG9 A;  3L3F X;  2DB0 A;  3WYF C;  1LRV A;  5HHG E;  4O27 A;  4R0Z A;  4I7I A;  3JY1 A;  3H3D X;  3GS3 A;  4U5O A;  2BCT A;  3QGC A;  3TX7 A;  3K49 A;  3EBB A;  1WA5 C;  1JDH A;  1XQS A;  4U5L A;  4FZD A;  3WOY A;  4B8J A;  4I0Y A;  2JKR B;  1W9C A;  2X1G F;  4CT7 B;  1W63 B;  4FDD A;  1XQR A;  4HXT A;  2X19 B;  4MZ6 E;  4I1E A;  2W3C A;  4I96 A; 
#chains in the Genus database with same CATH homology
 2QK2 A;  4OO6 A;  4BPL A;  1TH1 A;  4U5V A;  4UQI A;  2YNR A;  5CL8 A;  3Q5U A;  3ZIP A;  3ZIR A;  3LTM A;  5SW9 A;  4YK6 A;  2Z6H A;  3LWW A;  2FV2 A;  2Z5N A;  1HO8 A;  4QMH A;  2JKT A;  5H2W A;  5CLE A;  5KLT B;  5CLD A;  4HNM A;  1T08 A;  5B56 A;  4ZDU A;  4A3T A;  4JW2 B;  4ADY A;  1QZ7 A;  3VLD A;  4U5U A;  1F59 A;  5E6Q B;  4DB6 A;  3TJ3 A;  4A3V A;  3OUX A;  3UKY B;  1M8X A;  4P6Z B;  3OQS A;  3FEY C;  2BNX A;  1UPL A;  2IAE B;  3Q0R A;  3Q0O A;  3K5Y A;  5CL6 A;  3VLE A;  4DBA A;  2NPP B;  5KUB A;  1QGK A;  2C1T A;  3ZIN A;  4DB8 A;  3TT9 A;  1GCJ A;  2VGL A;  3GNI A;  2PF4 A;  4RXH B;  4CT6 B;  2RU4 A;  4I5L A;  4FQ3 A;  2Z5J A;  2Z5M A;  4TNM A;  5CL4 A;  3ZIO A;  2NYM B;  4NEE A;  3UL0 B;  4CB8 A;  3Q0N A;  3WPT A;  1TE4 A;  4GMO A;  4PLR A;  4R10 A;  3TPO A;  5EKG A;  3UKZ B;  3O2S A;  3ODS A;  1IAL A;  2GL7 A;  3IFQ A;  2XA7 B;  3Q0M A;  4E4V A;  3JX7 A;  2JDQ A;  1EE5 A;  2OF3 A;  1O6O A;  2IW3 A;  5CL3 A;  4RZP A;  4K6J A;  3NMW A;  4FFB C;  1IBR B;  4BQK A;  1M1E A;  2Z5K A;  4U3J C;  3QML C;  3OBV A;  4L7M A;  4U58 A;  3L3Q A;  5K6S A;  3TPM A;  1I7W A;  2F31 A;  1QBK B;  3DAD A;  3ZIL A;  3QHE A;  1Z2C B;  4LAC A;  2WTK A;  1UPK A;  3RZX A;  1BK6 A;  3ZIQ A;  3ODR A;  1I7X A;  4JW3 C;  5BZU A;  4YJE A;  4FP7 A;  5KLA A;  4CRV B;  3NMX A;  3WOZ A;  4I8M A;  4NZW A;  5AEI A;  4I5N A;  5CLA A;  3EA5 B;  5HUY C;  4I2W A;  3K61 A;  1M8Y A;  3BX3 A;  3C2G A;  1EE4 A;  4G3A A;  3VWA A;  4CBA A;  4DB9 A;  1O6P A;  4KZG A;  3A6P A;  2H4M A;  4V3R A;  3UL1 B;  2C1M A;  1B3U A;  3LTJ A;  4P6Z G;  4UAD A;  3Q0Q A;  4EV8 A;  4UAF B;  4GMN A;  4H3H A;  3GVT A;  1UN0 A;  3DW8 A;  3BSB A;  4UQI B;  4EV9 A;  1V18 A;  3BX2 A;  3V71 A;  4I2Z A;  3PSP A;  1XM9 A;  4D4E A;  4I6I A;  2BAP A;  2JKT B;  3BTR C;  4D49 A;  3K64 A;  5CL7 A;  3PST A;  3SL9 A;  4IMJ A;  4HTV A;  4YGX A;  3UKW B;  2NYL A;  3ZKV A;  1PJM B;  3IBV A;  3FGA B;  3V6Y A;  5SWF A;  3K4E A;  5CL5 A;  2YNS A;  4MFU A;  4A0C A;  4I2S A;  1BK5 A;  3O2T A;  2BKU B;  5KL1 A;  4U5N A;  3C2H A;  2VGL B;  2PKG A;  1Y2A C;  2RU4 B;  3RZ9 A;  1IB2 A;  3OPB A;  3GB8 A;  3O2Q A;  5CTT A;  1G3J A;  4YJL A;  4L4H A;  4UWX A;  4B18 A;  5K9S A;  4V3Q A;  4FZF A;  4MFV A;  1EJY I;  3VE6 A;  3UVU A;  1M5N S;  3ZIK A;  5H2X A;  2QNA A;  2XOA A;  4HM9 A;  1Q1S C;  2QK1 A;  4PLQ A;  4QMI A;  5CLB A;  1WA5 B;  4K92 A;  4OIH A;  4WV6 A;  3K62 A;  5KL8 A;  4JKQ A;  3L6Y A;  4B8O A;  3K7V A;  2JKR A;  3NMZ A;  4EVA A;  3O4X A;  4RV1 A;  1W63 A;  4DVG B;  4UAE A;  4XZR B;  3GAE A;  5EWP A;  1LUJ A;  2Q5D A;  4FZA A;  5LSW A;  3T7U A;  5EKF A;  4I37 A;  5SVZ A;  5D5K C;  4U54 A;  3ZHP A;  5DN7 A;  1PJN B;  3OUW A;  4Y5J A;  1M8W A;  2IWH A;  3TJZ B;  3Q0L A;  1JPP A;  3JXZ A;  5BZ5 A;  2OT8 A;  3BCT A;  1UKL A;  4R11 A;  2Z6G A;  3KND A;  4EVT A;  3AU3 A;  2IX3 A;  3L6X A;  5BZ1 A;  3K5Q A;  3K5Z A;  3SLA A;  3EG5 B;  4PLS A;  3K7W A;  4JW2 A;  1EJL I;  4DZS A;  4PVZ A;  3BSX A;  4H3K A;  4B8P A;  1U6G C;  2JAK A;  1QGR A;  5CL9 A;  3C5W A;  4CB9 A;  3QGB A;  2IE4 A;  2Z5O A;  2IAE A;  4JLQ A;  3BWT A;  4CV5 B;  4QMJ A;  2NPP A;  3V74 A;  3FGA A;  4U2X D;  5JJA A;  4CRU B;  5FC8 E;  5CLC A;  3GRL A;  4IMI A;  1M8Z A;  3VLF A;  3GVO A;  4I3N A;  2NYM A;  2NYL B;  4YI0 C;  3Q0P A;  5BZV A;  2QMR A;  3UKX B;  3W3U A;  4MZ5 E;  3NOW A;  1IQ1 C;  2XA7 A;  3GQ2 A;  3Q0S A;  3BVS A;  5KLR B;  1JPW A;  1Q1T C;  5BYM A;  4BA3 A;  1OYZ A;  4EVP A;  5HUW C;  3ND2 A;  2P8Q A;  4DJS A;  4U5S A;  4L4I A;  3FEX C;  2YJY A;  2IE3 A;  4V3O A;  5J3V A;  3JXY A;  3QG9 A;  3L3F X;  2DB0 A;  3WYF C;  1LRV A;  5HHG E;  4O27 A;  4R0Z A;  4I7I A;  3JY1 A;  3H3D X;  3GS3 A;  4U5O A;  2BCT A;  3QGC A;  3TX7 A;  3K49 A;  3EBB A;  1WA5 C;  1JDH A;  1XQS A;  4U5L A;  4FZD A;  3WOY A;  4B8J A;  4I0Y A;  2JKR B;  1W9C A;  2X1G F;  4CT7 B;  1W63 B;  4FDD A;  1XQR A;  4HXT A;  2X19 B;  4MZ6 E;  4I1E A;  2W3C A;  4I96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...