4DB9A

Designed armadillo repeat protein (yiiim3aiii)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
203
structure length
203
Chain Sequence
HHHHHGSELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGAEPALEQLQSSPNEKIQKEAQEALEKIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Armadillo repeat protein, YIIIM3AIII
publication title Structure-based optimization of designed Armadillo-repeat proteins.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 77
structure length 203
sequence length 203
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 4db9A00
5B56A 2XA7A 2BCTA 4UADA 3NMXA 2QMRA 4V3RA 3TT9A 4A0CA 3GNIA 5BZ5A 5BZ1A 4H3KA 2RU4B 1IB2A 2JKTA 4B18A 4D49A 3AU3A 3K5YA 3FGAA 2IX3A 4DZSA 1IBRB 2QNAA 1UPLA 4U3JC 5FC8E 2PF4A 5SVZA 3WOYA 5D5KC 1LRVA 4B8PA 2OF3A 2JKRA 3K62A 2Z5KA 3GRLA 4PVZA 3ND2A 3K61A 3OQSA 4ZDUA 5SW9A 3L3QA 5KL1A 4FQ3A 2YNRA 4K92A 3PSPA 2YNSA 4BQKA 2X19B 4UQIB 4KZGA 1WA5C 3ZKVA 4BA3A 3H3DX 3K64A 4EV9A 3V6YA 3ZHPA 4G3AA 3BX3A 3UVUA 1PJNB 3BX2A 4D4EA 5HHGE 2OT8A 5E6QB 2JKTB 3V71A 5BYMA 1XQRA 3EG5B 4CBAA 4MZ6E 3RZXA 3QHEA 4U5LA 2WTKA 4HXTA 1XM9A 3FGAB 1IALA 3V74A 4QMJA 4Y5JA 4I2ZA 3ZIQA 4TNMA 3Q0SA 4HNMA 3TPMA 3ODRA 1T08A 4FZAA 3NOWA 3GAEA 4U5OA 2GL7A 5H2XA 4CRUB 3NMWA 4CB9A 1I7WA 4JW2B 3TPOA 5KL8A 2FV2A 4DJSA 4CB8A 4UAEA 4R10A 1PJMB 3BSXA 3QG9A 3KNDA 4CRVB 4EV8A 5LSWA 1WA5B 3TX7A 3QGBA 1W9CA 3O2QA 4UQIA 2BNXA 3WPTA 3C5WA 2BAPA 4DB8A 3L6XA 3K7VA 5EKFA 4EVAA 1M8YA 1BK6A 3GQ2A 3GB8A 4V3OA 5KLTB 3L6YA 3OUXA 3Q0NA 2VGLA 1M1EA 3K7WA 3LWWA 3T7UA 3UKYB 1M8ZA 3VE6A 4YJLA 4P6ZB 3TJZB 3K4EA 1EE5A 1EJLI 5HUWC 3ZINA 4OIHA 1Q1TC 1W63B 3TJ3A 2Z6GA 5DN7A 4U58A 2C1TA 2DB0A 2NPPA 4EVPA 1BK5A 4MZ5E 1JDHA 1Z2CB 1F59A 1M5NS 4B8OA 2Z5NA 3QMLC 3BCTA 3QGCA 5EKGA 3Q0MA 5K9SA 2QK1A 1EJYI 3LTJA 5JJAA 3EA5B 3ODSA 3A6PA 3Q0PA 2IE4A 4U54A 3K5ZA 4YK6A 4RV1A 2VGLB 4U5UA 3ZIRA 4U5NA 5AEIA 3IBVA 5H2WA 2C1MA 4RXHB 4HTVA 5BZUA 4OO6A 3ZIPA 3BTRC 3VWAA 3Q0LA 4DBAA 3FEXC 4GMOA 3UKWB 3C2GA 1EE4A 1LUJA 3OUWA 3GS3A 4O27A 2NYMB 3BSBA 2NPPB 1O6OA 3O2TA 2NYLA 4LACA 1W63A 4IMJA 2X1GF 5KLRB 2H4MA 1UN0A 2QK2A 1I7XA 5BZVA 1G3JA 4FZDA 1TH1A 3RZ9A 4R0ZA 4U5VA 4FFBC 4UWXA 3WYFC 4IMIA 2YJYA 3W3UA 4I5LA 4PLQA 3O4XA 5CTTA 3Q0OA 3UL1B 5KLAA 4V3QA 5HUYC 4I5NA 1QZ7A 3L3FX 3O2SA 4FZFA 1IQ1C 1Y2AC 4MFVA 4GMNA 3ZIOA 3OPBA 2IE3A 2NYLB 3UL0B 1M8WA 2W3CA 4UAFB 3LTMA 3DADA 2NYMA 4CV5B 3IFQA 4B8JA 1UKLA 3BWTA 1QBKB 1JPWA 3Q0QA 3WOZA 3Q0RA 1QGKA 5SWFA 4EVTA 2JDQA 1XQSA 5EWPA 5K6SA 1GCJA 4QMIA 2IAEA 3EBBA 4I2WA 3PSTA 5J3VA 2XA7B 4P6ZG 1Q1SC 4U5SA 3K49A 4JLQA 1B3UA 4WV6A 3UKXB 4L7MA 4YI0C 2Z5OA 4ADYA 4H3HA 1U6GC 4NZWA 4DB9A 4CT6B 4BPLA 4E4VA 4MFUA 4YJEA 2IW3A 2F31A 1O6PA 2RU4A 3C2HA 2IWHA 1JPPA 4DB6A 3GVTA 2JAKA 1OYZA 1V18A 4K6JA 3Q5UA 3OBVA 4PLRA 3FEYC 4PLSA 4DVGB 1UPKA 2Z6HA 2JKRB 1M8XA 4FDDA 3K5QA 4XZRB 4YGXA 4RZPA 4CT7B 2Z5MA 1HO8A 2P8QA 2Q5DA 3UKZB 2Z5JA 3DW8A 2IAEB 4R11A 4NEEA 1QGRA 3GVOA 3NMZA 4HM9A 2BKUB 2PKGA 4QMHA
chains in the Genus database with same CATH superfamily
5B56A 2XA7A 2BCTA 4UADA 3NMXA 2QMRA 4V3RA 3TT9A 4A0CA 3GNIA 5BZ5A 5BZ1A 4H3KA 2RU4B 1IB2A 2JKTA 4B18A 4D49A 3AU3A 3K5YA 3FGAA 2IX3A 4DZSA 5KUBA 1IBRB 2QNAA 1UPLA 4U3JC 5FC8E 2PF4A 5SVZA 3WOYA 5D5KC 1LRVA 4B8PA 2OF3A 2JKRA 3K62A 2Z5KA 3GRLA 4PVZA 3ND2A 3K61A 3OQSA 4ZDUA 5SW9A 3L3QA 5CLEA 4JW2A 5KL1A 4FQ3A 2YNRA 4K92A 3PSPA 2YNSA 4BQKA 2X19B 4UQIB 4KZGA 5CLCA 1WA5C 3ZKVA 4BA3A 3H3DX 3K64A 4EV9A 3V6YA 3ZHPA 4G3AA 3BX3A 3UVUA 1PJNB 3BX2A 4D4EA 5HHGE 2OT8A 5E6QB 2JKTB 3V71A 3VLDA 5BYMA 1XQRA 3EG5B 4CBAA 4MZ6E 3RZXA 3QHEA 4U5LA 2WTKA 4HXTA 1XM9A 3FGAB 1IALA 3V74A 4QMJA 5CLBA 4Y5JA 4I2ZA 3ZIQA 4TNMA 3Q0SA 4HNMA 3VLFA 3TPMA 3ODRA 1T08A 4FZAA 3NOWA 3GAEA 4U5OA 2GL7A 5H2XA 4CRUB 3NMWA 4CB9A 1I7WA 4JW2B 3TPOA 5KL8A 2FV2A 4DJSA 4CB8A 4UAEA 4R10A 4A3VA 1PJMB 3BSXA 3QG9A 3KNDA 4CRVB 4EV8A 5LSWA 1WA5B 3TX7A 3QGBA 1W9CA 3O2QA 4I8MA 4UQIA 2BNXA 3WPTA 3C5WA 2BAPA 4DB8A 3L6XA 3K7VA 5EKFA 4EVAA 1M8YA 3SL9A 1BK6A 3GQ2A 3GB8A 4V3OA 5KLTB 3L6YA 3OUXA 3Q0NA 2VGLA 1M1EA 3K7WA 3LWWA 3T7UA 3UKYB 1M8ZA 3ZIKA 3VE6A 2XOAA 1LSHA 4YJLA 3T8SA 4P6ZB 3TJZB 4I6IA 3K4EA 1EE5A 1EJLI 5HUWC 3ZINA 4OIHA 1Q1TC 1W63B 3TJ3A 2Z6GA 5CLDA 5DN7A 4U58A 2C1TA 2DB0A 2NPPA 4EVPA 1BK5A 4MZ5E 1JDHA 1Z2CB 1F59A 1M5NS 4I0YA 4B8OA 2Z5NA 5CL8A 3QMLC 3BCTA 3QGCA 5EKGA 3Q0MA 5K9SA 2QK1A 1EJYI 3LTJA 5JJAA 3EA5B 3ODSA 3A6PA 3Q0PA 2IE4A 4U54A 3K5ZA 4YK6A 5CL4A 4RV1A 5CLAA 2VGLB 4U5UA 3ZIRA 4U5NA 5AEIA 3IBVA 5H2WA 2C1MA 4RXHB 4HTVA 5CL5A 5BZUA 3UJ0A 4OO6A 3ZIPA 3BTRC 1N4KA 3VWAA 3Q0LA 4DBAA 4A3TA 3ZILA 3FEXC 3SLAA 4GMOA 3UKWB 3C2GA 1EE4A 1LUJA 3OUWA 3GS3A 4I1EA 4O27A 2NYMB 3BSBA 2NPPB 1O6OA 3O2TA 2NYLA 4LACA 1W63A 4IMJA 2X1GF 5KLRB 2H4MA 4JW3C 1UN0A 2QK2A 1I7XA 5BZVA 1G3JA 4FZDA 1TH1A 3RZ9A 4R0ZA 4U5VA 4U2XD 4FFBC 4UWXA 3WYFC 4IMIA 2YJYA 3W3UA 4I5LA 3JXZA 4PLQA 3O4XA 5CTTA 3Q0OA 3UL1B 3BVSA 5KLAA 4V3QA 5HUYC 4I5NA 3JXYA 4I37A 1QZ7A 3L3FX 3UJ4A 3O2SA 4FZFA 3VLEA 1IQ1C 1Y2AC 4MFVA 4GMNA 3ZIOA 4FP7A 3OPBA 2IE3A 3JX7A 5CL7A 4L4IA 2NYLB 3UL0B 1M8WA 2W3CA 4UAFB 3LTMA 3DADA 2NYMA 4CV5B 3IFQA 4B8JA 4JKQA 1UKLA 3BWTA 1QBKB 1JPWA 3Q0QA 3WOZA 3Q0RA 4I3NA 1QGKA 5SWFA 4EVTA 2JDQA 5CL3A 1XQSA 5EWPA 5K6SA 1GCJA 5CL6A 4QMIA 2IAEA 3EBBA 4I2WA 3PSTA 5J3VA 2XA7B 4P6ZG 4L4HA 1Q1SC 4U5SA 3K49A 4JLQA 4I2SA 1B3UA 4WV6A 3UKXB 4I96A 4L7MA 4YI0C 2Z5OA 4ADYA 4H3HA 1U6GC 4NZWA 4DB9A 4CT6B 4BPLA 4E4VA 4MFUA 4YJEA 2IW3A 2F31A 1O6PA 2RU4A 3C2HA 2IWHA 1JPPA 4DB6A 3GVTA 2JAKA 1OYZA 1V18A 4K6JA 3Q5UA 3OBVA 4PLRA 3FEYC 3JY1A 4PLSA 5CL9A 4DVGB 1UPKA 2Z6HA 2JKRB 1M8XA 4FDDA 3K5QA 4XZRB 4YGXA 4I7IA 4RZPA 4CT7B 2Z5MA 1HO8A 2P8QA 2Q5DA 1TE4A 3UKZB 2Z5JA 3DW8A 2IAEB 4R11A 4NEEA 1QGRA 3GVOA 3NMZA 4HM9A 2BKUB 2PKGA 4QMHA
chains in the Genus database with same CATH topology
5B56A 2XA7A 2BCTA 4UADA 3NMXA 2QMRA 4V3RA 3TT9A 4A0CA 3GNIA 5BZ5A 5BZ1A 4H3KA 2RU4B 1IB2A 2JKTA 4B18A 4D49A 3AU3A 3K5YA 3FGAA 2IX3A 4DZSA 5KUBA 1IBRB 2QNAA 1UPLA 4U3JC 5FC8E 2PF4A 5SVZA 3WOYA 5D5KC 1LRVA 4B8PA 2OF3A 2JKRA 3K62A 2Z5KA 3GRLA 4PVZA 3ND2A 3K61A 3OQSA 4ZDUA 5SW9A 3L3QA 5CLEA 4JW2A 5KL1A 4FQ3A 2YNRA 4K92A 3PSPA 2YNSA 4BQKA 2X19B 4UQIB 4KZGA 5CLCA 1WA5C 3ZKVA 4BA3A 3H3DX 3K64A 4EV9A 3V6YA 3ZHPA 4G3AA 3BX3A 3UVUA 1PJNB 3BX2A 4D4EA 5HHGE 2OT8A 5E6QB 2JKTB 3V71A 3VLDA 5BYMA 1XQRA 3EG5B 4CBAA 4MZ6E 3RZXA 3QHEA 4U5LA 2WTKA 4HXTA 1XM9A 3FGAB 1IALA 3V74A 4QMJA 5CLBA 4Y5JA 4I2ZA 3ZIQA 4TNMA 3Q0SA 4HNMA 3VLFA 3TPMA 3ODRA 1T08A 4FZAA 3NOWA 3GAEA 4U5OA 2GL7A 5H2XA 4CRUB 3NMWA 4CB9A 1I7WA 4JW2B 3TPOA 5KL8A 2FV2A 4DJSA 4CB8A 4UAEA 4R10A 4A3VA 1PJMB 3BSXA 3QG9A 3KNDA 4CRVB 4EV8A 5LSWA 1WA5B 3TX7A 3QGBA 1W9CA 3O2QA 4I8MA 4UQIA 2BNXA 3WPTA 3C5WA 2BAPA 4DB8A 3L6XA 3K7VA 5EKFA 4EVAA 1M8YA 3SL9A 1BK6A 3GQ2A 3GB8A 4V3OA 5KLTB 3L6YA 3OUXA 3Q0NA 2VGLA 1M1EA 3K7WA 3LWWA 3T7UA 3UKYB 1M8ZA 3ZIKA 3VE6A 2XOAA 4YJLA 4P6ZB 3TJZB 4I6IA 3K4EA 1EE5A 1EJLI 5HUWC 3ZINA 4OIHA 1Q1TC 1W63B 3TJ3A 2Z6GA 5CLDA 5DN7A 4U58A 2C1TA 2DB0A 2NPPA 4EVPA 1BK5A 4MZ5E 1JDHA 1Z2CB 1F59A 1M5NS 4I0YA 4B8OA 2Z5NA 5CL8A 3QMLC 3BCTA 3QGCA 5EKGA 3Q0MA 5K9SA 2QK1A 1EJYI 3LTJA 5JJAA 3EA5B 3ODSA 3A6PA 3Q0PA 2IE4A 4U54A 3K5ZA 4YK6A 5CL4A 4RV1A 5CLAA 2VGLB 4U5UA 3ZIRA 4U5NA 5AEIA 3IBVA 5H2WA 2C1MA 4RXHB 4HTVA 5CL5A 5BZUA 4OO6A 3ZIPA 3BTRC 3VWAA 3Q0LA 4DBAA 4A3TA 3ZILA 3FEXC 3SLAA 4GMOA 3UKWB 3C2GA 1EE4A 1LUJA 3OUWA 3GS3A 4I1EA 4O27A 2NYMB 3BSBA 2NPPB 1O6OA 3O2TA 2NYLA 4LACA 1W63A 4IMJA 2X1GF 5KLRB 2H4MA 4JW3C 1UN0A 2QK2A 1I7XA 5BZVA 1G3JA 4FZDA 1TH1A 3RZ9A 4R0ZA 4U5VA 4U2XD 4FFBC 4UWXA 3WYFC 4IMIA 2YJYA 3W3UA 4I5LA 3JXZA 4PLQA 3O4XA 5CTTA 3Q0OA 3UL1B 3BVSA 5KLAA 4V3QA 5HUYC 4I5NA 3JXYA 4I37A 1QZ7A 3L3FX 3O2SA 4FZFA 3VLEA 1IQ1C 1Y2AC 4MFVA 4GMNA 3ZIOA 4FP7A 3OPBA 2IE3A 3JX7A 5CL7A 4L4IA 2NYLB 3UL0B 1M8WA 2W3CA 4UAFB 3LTMA 3DADA 2NYMA 4CV5B 3IFQA 4B8JA 4JKQA 1UKLA 3BWTA 1QBKB 1JPWA 3Q0QA 3WOZA 3Q0RA 4I3NA 1QGKA 5SWFA 4EVTA 2JDQA 5CL3A 1XQSA 5EWPA 5K6SA 1GCJA 5CL6A 4QMIA 2IAEA 3EBBA 4I2WA 3PSTA 5J3VA 2XA7B 4P6ZG 4L4HA 1Q1SC 4U5SA 3K49A 4JLQA 4I2SA 1B3UA 4WV6A 3UKXB 4I96A 4L7MA 4YI0C 2Z5OA 4ADYA 4H3HA 1U6GC 4NZWA 4DB9A 4CT6B 4BPLA 4E4VA 4MFUA 4YJEA 2IW3A 2F31A 1O6PA 2RU4A 3C2HA 2IWHA 1JPPA 4DB6A 3GVTA 2JAKA 1OYZA 1V18A 4K6JA 3Q5UA 3OBVA 4PLRA 3FEYC 3JY1A 4PLSA 5CL9A 4DVGB 1UPKA 2Z6HA 2JKRB 1M8XA 4FDDA 3K5QA 4XZRB 4YGXA 4I7IA 4RZPA 4CT7B 2Z5MA 1HO8A 2P8QA 2Q5DA 1TE4A 3UKZB 2Z5JA 3DW8A 2IAEB 4R11A 4NEEA 1QGRA 3GVOA 3NMZA 4HM9A 2BKUB 2PKGA 4QMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B56 A;  2XA7 A;  2BCT A;  4UAD A;  3NMX A;  2QMR A;  4V3R A;  3TT9 A;  4A0C A;  3GNI A;  5BZ5 A;  5BZ1 A;  4H3K A;  2RU4 B;  1IB2 A;  2JKT A;  4B18 A;  4D49 A;  3AU3 A;  3K5Y A;  3FGA A;  2IX3 A;  4DZS A;  1IBR B;  2QNA A;  1UPL A;  4U3J C;  5FC8 E;  2PF4 A;  5SVZ A;  3WOY A;  5D5K C;  1LRV A;  4B8P A;  2OF3 A;  2JKR A;  3K62 A;  2Z5K A;  3GRL A;  4PVZ A;  3ND2 A;  3K61 A;  3OQS A;  4ZDU A;  5SW9 A;  3L3Q A;  5KL1 A;  4FQ3 A;  2YNR A;  4K92 A;  3PSP A;  2YNS A;  4BQK A;  2X19 B;  4UQI B;  4KZG A;  1WA5 C;  3ZKV A;  4BA3 A;  3H3D X;  3K64 A;  4EV9 A;  3V6Y A;  3ZHP A;  4G3A A;  3BX3 A;  3UVU A;  1PJN B;  3BX2 A;  4D4E A;  5HHG E;  2OT8 A;  5E6Q B;  2JKT B;  3V71 A;  5BYM A;  1XQR A;  3EG5 B;  4CBA A;  4MZ6 E;  3RZX A;  3QHE A;  4U5L A;  2WTK A;  4HXT A;  1XM9 A;  3FGA B;  1IAL A;  3V74 A;  4QMJ A;  4Y5J A;  4I2Z A;  3ZIQ A;  4TNM A;  3Q0S A;  4HNM A;  3TPM A;  3ODR A;  1T08 A;  4FZA A;  3NOW A;  3GAE A;  4U5O A;  2GL7 A;  5H2X A;  4CRU B;  3NMW A;  4CB9 A;  1I7W A;  4JW2 B;  3TPO A;  5KL8 A;  2FV2 A;  4DJS A;  4CB8 A;  4UAE A;  4R10 A;  1PJM B;  3BSX A;  3QG9 A;  3KND A;  4CRV B;  4EV8 A;  5LSW A;  1WA5 B;  3TX7 A;  3QGB A;  1W9C A;  3O2Q A;  4UQI A;  2BNX A;  3WPT A;  3C5W A;  2BAP A;  4DB8 A;  3L6X A;  3K7V A;  5EKF A;  4EVA A;  1M8Y A;  1BK6 A;  3GQ2 A;  3GB8 A;  4V3O A;  5KLT B;  3L6Y A;  3OUX A;  3Q0N A;  2VGL A;  1M1E A;  3K7W A;  3LWW A;  3T7U A;  3UKY B;  1M8Z A;  3VE6 A;  4YJL A;  4P6Z B;  3TJZ B;  3K4E A;  1EE5 A;  1EJL I;  5HUW C;  3ZIN A;  4OIH A;  1Q1T C;  1W63 B;  3TJ3 A;  2Z6G A;  5DN7 A;  4U58 A;  2C1T A;  2DB0 A;  2NPP A;  4EVP A;  1BK5 A;  4MZ5 E;  1JDH A;  1Z2C B;  1F59 A;  1M5N S;  4B8O A;  2Z5N A;  3QML C;  3BCT A;  3QGC A;  5EKG A;  3Q0M A;  5K9S A;  2QK1 A;  1EJY I;  3LTJ A;  5JJA A;  3EA5 B;  3ODS A;  3A6P A;  3Q0P A;  2IE4 A;  4U54 A;  3K5Z A;  4YK6 A;  4RV1 A;  2VGL B;  4U5U A;  3ZIR A;  4U5N A;  5AEI A;  3IBV A;  5H2W A;  2C1M A;  4RXH B;  4HTV A;  5BZU A;  4OO6 A;  3ZIP A;  3BTR C;  3VWA A;  3Q0L A;  4DBA A;  3FEX C;  4GMO A;  3UKW B;  3C2G A;  1EE4 A;  1LUJ A;  3OUW A;  3GS3 A;  4O27 A;  2NYM B;  3BSB A;  2NPP B;  1O6O A;  3O2T A;  2NYL A;  4LAC A;  1W63 A;  4IMJ A;  2X1G F;  5KLR B;  2H4M A;  1UN0 A;  2QK2 A;  1I7X A;  5BZV A;  1G3J A;  4FZD A;  1TH1 A;  3RZ9 A;  4R0Z A;  4U5V A;  4FFB C;  4UWX A;  3WYF C;  4IMI A;  2YJY A;  3W3U A;  4I5L A;  4PLQ A;  3O4X A;  5CTT A;  3Q0O A;  3UL1 B;  5KLA A;  4V3Q A;  5HUY C;  4I5N A;  1QZ7 A;  3L3F X;  3O2S A;  4FZF A;  1IQ1 C;  1Y2A C;  4MFV A;  4GMN A;  3ZIO A;  3OPB A;  2IE3 A;  2NYL B;  3UL0 B;  1M8W A;  2W3C A;  4UAF B;  3LTM A;  3DAD A;  2NYM A;  4CV5 B;  3IFQ A;  4B8J A;  1UKL A;  3BWT A;  1QBK B;  1JPW A;  3Q0Q A;  3WOZ A;  3Q0R A;  1QGK A;  5SWF A;  4EVT A;  2JDQ A;  1XQS A;  5EWP A;  5K6S A;  1GCJ A;  4QMI A;  2IAE A;  3EBB A;  4I2W A;  3PST A;  5J3V A;  2XA7 B;  4P6Z G;  1Q1S C;  4U5S A;  3K49 A;  4JLQ A;  1B3U A;  4WV6 A;  3UKX B;  4L7M A;  4YI0 C;  2Z5O A;  4ADY A;  4H3H A;  1U6G C;  4NZW A;  4DB9 A;  4CT6 B;  4BPL A;  4E4V A;  4MFU A;  4YJE A;  2IW3 A;  2F31 A;  1O6P A;  2RU4 A;  3C2H A;  2IWH A;  1JPP A;  4DB6 A;  3GVT A;  2JAK A;  1OYZ A;  1V18 A;  4K6J A;  3Q5U A;  3OBV A;  4PLR A;  3FEY C;  4PLS A;  4DVG B;  1UPK A;  2Z6H A;  2JKR B;  1M8X A;  4FDD A;  3K5Q A;  4XZR B;  4YGX A;  4RZP A;  4CT7 B;  2Z5M A;  1HO8 A;  2P8Q A;  2Q5D A;  3UKZ B;  2Z5J A;  3DW8 A;  2IAE B;  4R11 A;  4NEE A;  1QGR A;  3GVO A;  3NMZ A;  4HM9 A;  2BKU B;  2PKG A;  4QMH A; 
#chains in the Genus database with same CATH topology
 5B56 A;  2XA7 A;  2BCT A;  4UAD A;  3NMX A;  2QMR A;  4V3R A;  3TT9 A;  4A0C A;  3GNI A;  5BZ5 A;  5BZ1 A;  4H3K A;  2RU4 B;  1IB2 A;  2JKT A;  4B18 A;  4D49 A;  3AU3 A;  3K5Y A;  3FGA A;  2IX3 A;  4DZS A;  5KUB A;  1IBR B;  2QNA A;  1UPL A;  4U3J C;  5FC8 E;  2PF4 A;  5SVZ A;  3WOY A;  5D5K C;  1LRV A;  4B8P A;  2OF3 A;  2JKR A;  3K62 A;  2Z5K A;  3GRL A;  4PVZ A;  3ND2 A;  3K61 A;  3OQS A;  4ZDU A;  5SW9 A;  3L3Q A;  5CLE A;  4JW2 A;  5KL1 A;  4FQ3 A;  2YNR A;  4K92 A;  3PSP A;  2YNS A;  4BQK A;  2X19 B;  4UQI B;  4KZG A;  5CLC A;  1WA5 C;  3ZKV A;  4BA3 A;  3H3D X;  3K64 A;  4EV9 A;  3V6Y A;  3ZHP A;  4G3A A;  3BX3 A;  3UVU A;  1PJN B;  3BX2 A;  4D4E A;  5HHG E;  2OT8 A;  5E6Q B;  2JKT B;  3V71 A;  3VLD A;  5BYM A;  1XQR A;  3EG5 B;  4CBA A;  4MZ6 E;  3RZX A;  3QHE A;  4U5L A;  2WTK A;  4HXT A;  1XM9 A;  3FGA B;  1IAL A;  3V74 A;  4QMJ A;  5CLB A;  4Y5J A;  4I2Z A;  3ZIQ A;  4TNM A;  3Q0S A;  4HNM A;  3VLF A;  3TPM A;  3ODR A;  1T08 A;  4FZA A;  3NOW A;  3GAE A;  4U5O A;  2GL7 A;  5H2X A;  4CRU B;  3NMW A;  4CB9 A;  1I7W A;  4JW2 B;  3TPO A;  5KL8 A;  2FV2 A;  4DJS A;  4CB8 A;  4UAE A;  4R10 A;  4A3V A;  1PJM B;  3BSX A;  3QG9 A;  3KND A;  4CRV B;  4EV8 A;  5LSW A;  1WA5 B;  3TX7 A;  3QGB A;  1W9C A;  3O2Q A;  4I8M A;  4UQI A;  2BNX A;  3WPT A;  3C5W A;  2BAP A;  4DB8 A;  3L6X A;  3K7V A;  5EKF A;  4EVA A;  1M8Y A;  3SL9 A;  1BK6 A;  3GQ2 A;  3GB8 A;  4V3O A;  5KLT B;  3L6Y A;  3OUX A;  3Q0N A;  2VGL A;  1M1E A;  3K7W A;  3LWW A;  3T7U A;  3UKY B;  1M8Z A;  3ZIK A;  3VE6 A;  2XOA A;  1LSH A;  4YJL A;  3T8S A;  4P6Z B;  3TJZ B;  4I6I A;  3K4E A;  1EE5 A;  1EJL I;  5HUW C;  3ZIN A;  4OIH A;  1Q1T C;  1W63 B;  3TJ3 A;  2Z6G A;  5CLD A;  5DN7 A;  4U58 A;  2C1T A;  2DB0 A;  2NPP A;  4EVP A;  1BK5 A;  4MZ5 E;  1JDH A;  1Z2C B;  1F59 A;  1M5N S;  4I0Y A;  4B8O A;  2Z5N A;  5CL8 A;  3QML C;  3BCT A;  3QGC A;  5EKG A;  3Q0M A;  5K9S A;  2QK1 A;  1EJY I;  3LTJ A;  5JJA A;  3EA5 B;  3ODS A;  3A6P A;  3Q0P A;  2IE4 A;  4U54 A;  3K5Z A;  4YK6 A;  5CL4 A;  4RV1 A;  5CLA A;  2VGL B;  4U5U A;  3ZIR A;  4U5N A;  5AEI A;  3IBV A;  5H2W A;  2C1M A;  4RXH B;  4HTV A;  5CL5 A;  5BZU A;  3UJ0 A;  4OO6 A;  3ZIP A;  3BTR C;  1N4K A;  3VWA A;  3Q0L A;  4DBA A;  4A3T A;  3ZIL A;  3FEX C;  3SLA A;  4GMO A;  3UKW B;  3C2G A;  1EE4 A;  1LUJ A;  3OUW A;  3GS3 A;  4I1E A;  4O27 A;  2NYM B;  3BSB A;  2NPP B;  1O6O A;  3O2T A;  2NYL A;  4LAC A;  1W63 A;  4IMJ A;  2X1G F;  5KLR B;  2H4M A;  4JW3 C;  1UN0 A;  2QK2 A;  1I7X A;  5BZV A;  1G3J A;  4FZD A;  1TH1 A;  3RZ9 A;  4R0Z A;  4U5V A;  4U2X D;  4FFB C;  4UWX A;  3WYF C;  4IMI A;  2YJY A;  3W3U A;  4I5L A;  3JXZ A;  4PLQ A;  3O4X A;  5CTT A;  3Q0O A;  3UL1 B;  3BVS A;  5KLA A;  4V3Q A;  5HUY C;  4I5N A;  3JXY A;  4I37 A;  1QZ7 A;  3L3F X;  3UJ4 A;  3O2S A;  4FZF A;  3VLE A;  1IQ1 C;  1Y2A C;  4MFV A;  4GMN A;  3ZIO A;  4FP7 A;  3OPB A;  2IE3 A;  3JX7 A;  5CL7 A;  4L4I A;  2NYL B;  3UL0 B;  1M8W A;  2W3C A;  4UAF B;  3LTM A;  3DAD A;  2NYM A;  4CV5 B;  3IFQ A;  4B8J A;  4JKQ A;  1UKL A;  3BWT A;  1QBK B;  1JPW A;  3Q0Q A;  3WOZ A;  3Q0R A;  4I3N A;  1QGK A;  5SWF A;  4EVT A;  2JDQ A;  5CL3 A;  1XQS A;  5EWP A;  5K6S A;  1GCJ A;  5CL6 A;  4QMI A;  2IAE A;  3EBB A;  4I2W A;  3PST A;  5J3V A;  2XA7 B;  4P6Z G;  4L4H A;  1Q1S C;  4U5S A;  3K49 A;  4JLQ A;  4I2S A;  1B3U A;  4WV6 A;  3UKX B;  4I96 A;  4L7M A;  4YI0 C;  2Z5O A;  4ADY A;  4H3H A;  1U6G C;  4NZW A;  4DB9 A;  4CT6 B;  4BPL A;  4E4V A;  4MFU A;  4YJE A;  2IW3 A;  2F31 A;  1O6P A;  2RU4 A;  3C2H A;  2IWH A;  1JPP A;  4DB6 A;  3GVT A;  2JAK A;  1OYZ A;  1V18 A;  4K6J A;  3Q5U A;  3OBV A;  4PLR A;  3FEY C;  3JY1 A;  4PLS A;  5CL9 A;  4DVG B;  1UPK A;  2Z6H A;  2JKR B;  1M8X A;  4FDD A;  3K5Q A;  4XZR B;  4YGX A;  4I7I A;  4RZP A;  4CT7 B;  2Z5M A;  1HO8 A;  2P8Q A;  2Q5D A;  1TE4 A;  3UKZ B;  2Z5J A;  3DW8 A;  2IAE B;  4R11 A;  4NEE A;  1QGR A;  3GVO A;  3NMZ A;  4HM9 A;  2BKU B;  2PKG A;  4QMH A; 
#chains in the Genus database with same CATH homology
 5B56 A;  2XA7 A;  2BCT A;  4UAD A;  3NMX A;  2QMR A;  4V3R A;  3TT9 A;  4A0C A;  3GNI A;  5BZ5 A;  5BZ1 A;  4H3K A;  2RU4 B;  1IB2 A;  2JKT A;  4B18 A;  4D49 A;  3AU3 A;  3K5Y A;  3FGA A;  2IX3 A;  4DZS A;  5KUB A;  1IBR B;  2QNA A;  1UPL A;  4U3J C;  5FC8 E;  2PF4 A;  5SVZ A;  3WOY A;  5D5K C;  1LRV A;  4B8P A;  2OF3 A;  2JKR A;  3K62 A;  2Z5K A;  3GRL A;  4PVZ A;  3ND2 A;  3K61 A;  3OQS A;  4ZDU A;  5SW9 A;  3L3Q A;  5CLE A;  4JW2 A;  5KL1 A;  4FQ3 A;  2YNR A;  4K92 A;  3PSP A;  2YNS A;  4BQK A;  2X19 B;  4UQI B;  4KZG A;  5CLC A;  1WA5 C;  3ZKV A;  4BA3 A;  3H3D X;  3K64 A;  4EV9 A;  3V6Y A;  3ZHP A;  4G3A A;  3BX3 A;  3UVU A;  1PJN B;  3BX2 A;  4D4E A;  5HHG E;  2OT8 A;  5E6Q B;  2JKT B;  3V71 A;  3VLD A;  5BYM A;  1XQR A;  3EG5 B;  4CBA A;  4MZ6 E;  3RZX A;  3QHE A;  4U5L A;  2WTK A;  4HXT A;  1XM9 A;  3FGA B;  1IAL A;  3V74 A;  4QMJ A;  5CLB A;  4Y5J A;  4I2Z A;  3ZIQ A;  4TNM A;  3Q0S A;  4HNM A;  3VLF A;  3TPM A;  3ODR A;  1T08 A;  4FZA A;  3NOW A;  3GAE A;  4U5O A;  2GL7 A;  5H2X A;  4CRU B;  3NMW A;  4CB9 A;  1I7W A;  4JW2 B;  3TPO A;  5KL8 A;  2FV2 A;  4DJS A;  4CB8 A;  4UAE A;  4R10 A;  4A3V A;  1PJM B;  3BSX A;  3QG9 A;  3KND A;  4CRV B;  4EV8 A;  5LSW A;  1WA5 B;  3TX7 A;  3QGB A;  1W9C A;  3O2Q A;  4I8M A;  4UQI A;  2BNX A;  3WPT A;  3C5W A;  2BAP A;  4DB8 A;  3L6X A;  3K7V A;  5EKF A;  4EVA A;  1M8Y A;  3SL9 A;  1BK6 A;  3GQ2 A;  3GB8 A;  4V3O A;  5KLT B;  3L6Y A;  3OUX A;  3Q0N A;  2VGL A;  1M1E A;  3K7W A;  3LWW A;  3T7U A;  3UKY B;  1M8Z A;  3ZIK A;  3VE6 A;  2XOA A;  4YJL A;  4P6Z B;  3TJZ B;  4I6I A;  3K4E A;  1EE5 A;  1EJL I;  5HUW C;  3ZIN A;  4OIH A;  1Q1T C;  1W63 B;  3TJ3 A;  2Z6G A;  5CLD A;  5DN7 A;  4U58 A;  2C1T A;  2DB0 A;  2NPP A;  4EVP A;  1BK5 A;  4MZ5 E;  1JDH A;  1Z2C B;  1F59 A;  1M5N S;  4I0Y A;  4B8O A;  2Z5N A;  5CL8 A;  3QML C;  3BCT A;  3QGC A;  5EKG A;  3Q0M A;  5K9S A;  2QK1 A;  1EJY I;  3LTJ A;  5JJA A;  3EA5 B;  3ODS A;  3A6P A;  3Q0P A;  2IE4 A;  4U54 A;  3K5Z A;  4YK6 A;  5CL4 A;  4RV1 A;  5CLA A;  2VGL B;  4U5U A;  3ZIR A;  4U5N A;  5AEI A;  3IBV A;  5H2W A;  2C1M A;  4RXH B;  4HTV A;  5CL5 A;  5BZU A;  4OO6 A;  3ZIP A;  3BTR C;  3VWA A;  3Q0L A;  4DBA A;  4A3T A;  3ZIL A;  3FEX C;  3SLA A;  4GMO A;  3UKW B;  3C2G A;  1EE4 A;  1LUJ A;  3OUW A;  3GS3 A;  4I1E A;  4O27 A;  2NYM B;  3BSB A;  2NPP B;  1O6O A;  3O2T A;  2NYL A;  4LAC A;  1W63 A;  4IMJ A;  2X1G F;  5KLR B;  2H4M A;  4JW3 C;  1UN0 A;  2QK2 A;  1I7X A;  5BZV A;  1G3J A;  4FZD A;  1TH1 A;  3RZ9 A;  4R0Z A;  4U5V A;  4U2X D;  4FFB C;  4UWX A;  3WYF C;  4IMI A;  2YJY A;  3W3U A;  4I5L A;  3JXZ A;  4PLQ A;  3O4X A;  5CTT A;  3Q0O A;  3UL1 B;  3BVS A;  5KLA A;  4V3Q A;  5HUY C;  4I5N A;  3JXY A;  4I37 A;  1QZ7 A;  3L3F X;  3O2S A;  4FZF A;  3VLE A;  1IQ1 C;  1Y2A C;  4MFV A;  4GMN A;  3ZIO A;  4FP7 A;  3OPB A;  2IE3 A;  3JX7 A;  5CL7 A;  4L4I A;  2NYL B;  3UL0 B;  1M8W A;  2W3C A;  4UAF B;  3LTM A;  3DAD A;  2NYM A;  4CV5 B;  3IFQ A;  4B8J A;  4JKQ A;  1UKL A;  3BWT A;  1QBK B;  1JPW A;  3Q0Q A;  3WOZ A;  3Q0R A;  4I3N A;  1QGK A;  5SWF A;  4EVT A;  2JDQ A;  5CL3 A;  1XQS A;  5EWP A;  5K6S A;  1GCJ A;  5CL6 A;  4QMI A;  2IAE A;  3EBB A;  4I2W A;  3PST A;  5J3V A;  2XA7 B;  4P6Z G;  4L4H A;  1Q1S C;  4U5S A;  3K49 A;  4JLQ A;  4I2S A;  1B3U A;  4WV6 A;  3UKX B;  4I96 A;  4L7M A;  4YI0 C;  2Z5O A;  4ADY A;  4H3H A;  1U6G C;  4NZW A;  4DB9 A;  4CT6 B;  4BPL A;  4E4V A;  4MFU A;  4YJE A;  2IW3 A;  2F31 A;  1O6P A;  2RU4 A;  3C2H A;  2IWH A;  1JPP A;  4DB6 A;  3GVT A;  2JAK A;  1OYZ A;  1V18 A;  4K6J A;  3Q5U A;  3OBV A;  4PLR A;  3FEY C;  3JY1 A;  4PLS A;  5CL9 A;  4DVG B;  1UPK A;  2Z6H A;  2JKR B;  1M8X A;  4FDD A;  3K5Q A;  4XZR B;  4YGX A;  4I7I A;  4RZP A;  4CT7 B;  2Z5M A;  1HO8 A;  2P8Q A;  2Q5D A;  1TE4 A;  3UKZ B;  2Z5J A;  3DW8 A;  2IAE B;  4R11 A;  4NEE A;  1QGR A;  3GVO A;  3NMZ A;  4HM9 A;  2BKU B;  2PKG A;  4QMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...