4DB9A

Designed armadillo repeat protein (yiiim3aiii)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
203
structure length
203
Chain Sequence
HHHHHGSELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGAEPALEQLQSSPNEKIQKEAQEALEKIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Armadillo repeat protein, YIIIM3AIII
publication title Structure-based optimization of designed Armadillo-repeat proteins.
pubmed doi rcsb
source organism Synthetic construct
total genus 77
structure length 203
sequence length 203
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 4db9A00
5HHGE 3VE6A 4JLQA 2Z5NA 3GS3A 4UAEA 2QK2A 4CB9A 1M8YA 4EVPA 4PVZA 4JW2B 3QGCA 1IB2A 3Q0LA 1I7XA 4RZPA 1XQRA 4NZWA 2JKRA 5D5KC 3GVTA 3V74A 1QGRA 2JDQA 2QMRA 2JKRB 5KLRB 1JPWA 1BK5A 5H2XA 1Q1TC 2VGLA 4I5NA 4RV1A 3UL1B 3Q0OA 4K6JA 4DZSA 2OT8A 4B18A 5HUWC 4CB8A 4DB8A 2IW3A 4NEEA 3ZKVA 4HNMA 5BZUA 1EJLI 3W3UA 3LTMA 4B8JA 2BKUB 3V71A 2PF4A 1XM9A 2RU4B 2YJYA 4P6ZG 5KLAA 1O6OA 3WOZA 1WA5B 3KNDA 2IWHA 4YGXA 1JPPA 4FDDA 5K9SA 2F31A 3TJZB 1B3UA 4YK6A 2GL7A 4FZAA 4U3JC 4CV5B 2FV2A 4BA3A 2BAPA 4DBAA 2YNRA 1Y2AC 4IMJA 3FGAA 3O2SA 3C2GA 3K49A 3Q0NA 4YJLA 2IE4A 3NMWA 3GNIA 1IBRB 1W63A 1TH1A 3K5YA 3FGAB 5SWFA 4BQKA 3QG9A 5BYMA 4DB9A 4ZDUA 4HTVA 4LACA 4B8OA 4DVGB 4UQIA 2IAEA 4CRUB 3EA5B 1W63B 4ADYA 2NYMA 3WOYA 5BZ5A 4U54A 1Z2CB 3UL0B 2BNXA 4OO6A 2Z5KA 4K92A 1UPLA 4UQIB 2IAEB 3K7WA 3Q0QA 3IBVA 4U5LA 2NYMB 4MZ6E 4QMHA 3GAEA 5EWPA 4E4VA 2NPPA 2NYLA 2BCTA 3ZINA 5BZ1A 4L7MA 2NPPB 3EG5B 3NMXA 1PJMB 5J3VA 3GB8A 4PLRA 2P8QA 2Z6HA 1QZ7A 1LUJA 4GMOA 4TNMA 1OYZA 5KL8A 3OQSA 1M8XA 5AEIA 2X19B 4I2ZA 1LRVA 2VGLB 4R10A 3RZXA 2QNAA 5LSWA 2XA7A 5KLTB 1EJYI 1O6PA 2XA7B 3UVUA 4FFBC 3K61A 4V3RA 4YJEA 3DW8A 3O2QA 3T7UA 3BSXA 2YNSA 2JAKA 4CT7B 4O27A 1M8WA 4RXHB 1PJNB 4B8PA 1UN0A 2JKTA 5FC8E 3O2TA 3Q0PA 4V3OA 3L6YA 4OIHA 1QGKA 2C1TA 5SW9A 3ODRA 1M8ZA 2Z6GA 3TPOA 4H3HA 3BTRC 4PLSA 5EKFA 4CRVB 4D49A 3QGBA 3PSPA 4EV8A 4EVTA 3WYFC 3ZIRA 3BSBA 4FZFA 3RZ9A 4UAFB 1EE5A 3FEXC 4H3KA 3BX2A 3ZIPA 3L3QA 4U5OA 1UKLA 3NMZA 4R0ZA 3GQ2A 4UADA 4MZ5E 3TT9A 4D4EA 1T08A 3TJ3A 1I7WA 2DB0A 4FQ3A 5CTTA 3AU3A 4R11A 1HO8A 1QBKB 4G3AA 3QMLC 3K5ZA 3Q0RA 3OUXA 1F59A 2WTKA 2NYLB 1GCJA 4PLQA 1IQ1C 3UKWB 3DADA 3FEYC 3K64A 3LTJA 3WPTA 3Q0MA 2C1MA 4WV6A 5B56A 4HM9A 1BK6A 5K6SA 4CT6B 3L3FX 2Z5JA 5H2WA 3EBBA 3NOWA 3ND2A 1M5NS 2Q5DA 3BCTA 2IX3A 1G3JA 2H4MA 1UPKA 3UKZB 3Q0SA 4U5VA 3H3DX 1Q1SC 4BPLA 3BX3A 3TPMA 3BWTA 4I2WA 2RU4A 5DN7A 5SVZA 5HUYC 5BZVA 4DJSA 4U5UA 5EKGA 4A0CA 1U6GC 4EVAA 3C2HA 3OUWA 3IFQA 2Z5OA 3K7VA 3K62A 3ZHPA 4KZGA 1EE4A 4QMJA 1V18A 3C5WA 2JKTB 2PKGA 4EV9A 4DB6A 3OPBA 4YI0C 3UKXB 3L6XA 3PSTA 1WA5C 4GMNA 4HXTA 3ZIQA 5KL1A 4QMIA 5JJAA 3ZIOA 3UKYB 4FZDA 3GVOA 4XZRB 1M1EA 1W9CA 4CBAA 4MFVA 1XQSA 3GRLA 3LWWA 3Q5UA 5E6QB 4IMIA 3A6PA 3K5QA 2W3CA 2OF3A 4V3QA 3VWAA 4Y5JA 3O4XA 1JDHA 2IE3A 2Z5MA 4UWXA 3TX7A 4I5LA 4P6ZB 3V6YA 3K4EA 3OBVA 2QK1A 4U5SA 1IALA 3QHEA 4MFUA 3ODSA 4U58A 2X1GF 4U5NA
chains in the Genus database with same CATH superfamily
5HHGE 3VE6A 1N4KA 4JLQA 2Z5NA 3GS3A 4UAEA 2QK2A 4CB9A 1M8YA 4EVPA 4PVZA 3VLDA 4JW2B 5CLAA 3QGCA 1IB2A 3Q0LA 1I7XA 4RZPA 1XQRA 4NZWA 2JKRA 5D5KC 3UJ4A 3GVTA 3V74A 3BVSA 1QGRA 2JDQA 2QMRA 2JKRB 5KLRB 1JPWA 1BK5A 5H2XA 1Q1TC 2VGLA 4I5NA 4RV1A 3UL1B 3Q0OA 4K6JA 4DZSA 2OT8A 4B18A 5HUWC 4CB8A 4DB8A 2IW3A 4NEEA 3ZKVA 5CLEA 4HNMA 5BZUA 1EJLI 3W3UA 3LTMA 4B8JA 2BKUB 4I37A 3V71A 2PF4A 1XM9A 5CLDA 2RU4B 2YJYA 4P6ZG 5KLAA 4I7IA 1O6OA 3WOZA 1WA5B 3KNDA 2IWHA 4YGXA 1JPPA 4FDDA 5K9SA 2F31A 5CL5A 3TJZB 4I0YA 1B3UA 4YK6A 2GL7A 4FZAA 4U3JC 4CV5B 2FV2A 4BA3A 2BAPA 4I1EA 4DBAA 2YNRA 1Y2AC 4IMJA 3FGAA 3O2SA 3C2GA 3K49A 5CLCA 3SL9A 3Q0NA 4YJLA 2IE4A 3NMWA 3GNIA 1IBRB 1W63A 1TH1A 3K5YA 3FGAB 5SWFA 4BQKA 3QG9A 5BYMA 4DB9A 4ZDUA 4HTVA 4LACA 4B8OA 4DVGB 4UQIA 2IAEA 4CRUB 3EA5B 1W63B 4ADYA 2NYMA 3WOYA 5BZ5A 4U54A 1Z2CB 3UL0B 2BNXA 4OO6A 4L4HA 2Z5KA 4K92A 5CL9A 1UPLA 4UQIB 2IAEB 3K7WA 3Q0QA 3IBVA 4U5LA 2NYMB 3SLAA 4MZ6E 4QMHA 3GAEA 5EWPA 4E4VA 2NPPA 2NYLA 2XOAA 3ZILA 3VLFA 2BCTA 3ZINA 5BZ1A 4L7MA 3VLEA 2NPPB 3EG5B 3NMXA 1PJMB 4A3VA 5J3VA 3GB8A 4PLRA 2P8QA 2Z6HA 1QZ7A 5CL6A 1LUJA 4GMOA 4TNMA 1OYZA 5KL8A 3OQSA 1M8XA 5AEIA 2X19B 4I2ZA 1LRVA 2VGLB 4R10A 3RZXA 5CL7A 2QNAA 5LSWA 2XA7A 5KLTB 1EJYI 5CLBA 5KUBA 1O6PA 4FP7A 4I6IA 2XA7B 4U2XD 3UVUA 4FFBC 3K61A 4V3RA 4YJEA 3DW8A 3O2QA 3T7UA 3BSXA 2YNSA 2JAKA 4CT7B 4O27A 1M8WA 4RXHB 1PJNB 4B8PA 1UN0A 2JKTA 5FC8E 5CL8A 3O2TA 3Q0PA 4V3OA 3L6YA 4OIHA 1QGKA 2C1TA 5SW9A 3ODRA 1M8ZA 4I2SA 2Z6GA 3TPOA 4I8MA 4H3HA 3BTRC 4PLSA 5EKFA 4CRVB 4D49A 3QGBA 3PSPA 4EV8A 4EVTA 3WYFC 3ZIRA 3BSBA 4FZFA 3RZ9A 4UAFB 3JY1A 1EE5A 3FEXC 4H3KA 3BX2A 4JKQA 3T8SA 3ZIPA 3L3QA 3JXYA 4U5OA 1UKLA 3NMZA 4R0ZA 3GQ2A 4UADA 4MZ5E 3TT9A 4D4EA 1T08A 3TJ3A 1I7WA 2DB0A 4FQ3A 5CTTA 3AU3A 4R11A 1HO8A 1QBKB 4G3AA 3QMLC 4JW2A 3K5ZA 3Q0RA 3OUXA 1F59A 2WTKA 2NYLB 1GCJA 4PLQA 1TE4A 1IQ1C 3UKWB 3DADA 3FEYC 4L4IA 3K64A 3JX7A 3LTJA 3WPTA 4A3TA 2C1MA 3Q0MA 4WV6A 5B56A 4HM9A 1BK6A 5K6SA 4CT6B 3L3FX 2Z5JA 5H2WA 3EBBA 1LSHA 3NOWA 3ND2A 1M5NS 2Q5DA 3BCTA 2IX3A 1G3JA 2H4MA 1UPKA 3UKZB 3Q0SA 4U5VA 3H3DX 1Q1SC 4BPLA 3BX3A 3TPMA 3BWTA 4I2WA 2RU4A 5DN7A 5SVZA 5HUYC 5BZVA 4DJSA 4U5UA 5EKGA 4A0CA 1U6GC 4EVAA 3C2HA 3ZIKA 3OUWA 3IFQA 2Z5OA 3K7VA 3K62A 3ZHPA 4KZGA 1EE4A 4I96A 4QMJA 1V18A 3UJ0A 5CL3A 3C5WA 2JKTB 2PKGA 4EV9A 4DB6A 3OPBA 4YI0C 3UKXB 3L6XA 3PSTA 1WA5C 4GMNA 4HXTA 3ZIQA 5KL1A 4QMIA 5JJAA 3ZIOA 3UKYB 4FZDA 3GVOA 4XZRB 1M1EA 1W9CA 4CBAA 4MFVA 1XQSA 3GRLA 3LWWA 3Q5UA 5E6QB 5CL4A 4IMIA 3A6PA 3K5QA 2W3CA 2OF3A 4V3QA 3VWAA 4Y5JA 3O4XA 1JDHA 2IE3A 2Z5MA 4JW3C 4UWXA 3TX7A 4I5LA 4P6ZB 3V6YA 3K4EA 3OBVA 2QK1A 4I3NA 4U5SA 1IALA 3QHEA 4MFUA 3ODSA 3JXZA 4U58A 2X1GF 4U5NA
chains in the Genus database with same CATH topology
5HHGE 3VE6A 4JLQA 2Z5NA 3GS3A 4UAEA 2QK2A 4CB9A 1M8YA 4EVPA 4PVZA 3VLDA 4JW2B 5CLAA 3QGCA 1IB2A 3Q0LA 1I7XA 4RZPA 1XQRA 4NZWA 2JKRA 5D5KC 3GVTA 3V74A 3BVSA 1QGRA 2JDQA 2QMRA 2JKRB 5KLRB 1JPWA 1BK5A 5H2XA 1Q1TC 2VGLA 4I5NA 4RV1A 3UL1B 3Q0OA 4K6JA 4DZSA 2OT8A 4B18A 5HUWC 4CB8A 4DB8A 2IW3A 4NEEA 3ZKVA 5CLEA 4HNMA 5BZUA 1EJLI 3W3UA 3LTMA 4B8JA 2BKUB 4I37A 3V71A 2PF4A 1XM9A 5CLDA 2RU4B 2YJYA 4P6ZG 5KLAA 4I7IA 1O6OA 3WOZA 1WA5B 3KNDA 2IWHA 4YGXA 1JPPA 4FDDA 5K9SA 2F31A 5CL5A 3TJZB 4I0YA 1B3UA 4YK6A 2GL7A 4FZAA 4U3JC 4CV5B 2FV2A 4BA3A 2BAPA 4I1EA 4DBAA 2YNRA 1Y2AC 4IMJA 3FGAA 3O2SA 3C2GA 3K49A 5CLCA 3SL9A 3Q0NA 4YJLA 2IE4A 3NMWA 3GNIA 1IBRB 1W63A 1TH1A 3K5YA 3FGAB 5SWFA 4BQKA 3QG9A 5BYMA 4DB9A 4ZDUA 4HTVA 4LACA 4B8OA 4DVGB 4UQIA 2IAEA 4CRUB 3EA5B 1W63B 4ADYA 2NYMA 3WOYA 5BZ5A 4U54A 1Z2CB 3UL0B 2BNXA 4OO6A 4L4HA 2Z5KA 4K92A 5CL9A 1UPLA 4UQIB 2IAEB 3K7WA 3Q0QA 3IBVA 4U5LA 2NYMB 3SLAA 4MZ6E 4QMHA 3GAEA 5EWPA 4E4VA 2NPPA 2NYLA 2XOAA 3ZILA 3VLFA 2BCTA 3ZINA 5BZ1A 4L7MA 3VLEA 2NPPB 3EG5B 3NMXA 1PJMB 4A3VA 5J3VA 3GB8A 4PLRA 2P8QA 2Z6HA 1QZ7A 5CL6A 1LUJA 4GMOA 4TNMA 1OYZA 5KL8A 3OQSA 1M8XA 5AEIA 2X19B 4I2ZA 1LRVA 2VGLB 4R10A 3RZXA 5CL7A 2QNAA 5LSWA 2XA7A 5KLTB 1EJYI 5CLBA 5KUBA 1O6PA 4FP7A 4I6IA 2XA7B 4U2XD 3UVUA 4FFBC 3K61A 4V3RA 4YJEA 3DW8A 3O2QA 3T7UA 3BSXA 2YNSA 2JAKA 4CT7B 4O27A 1M8WA 4RXHB 1PJNB 4B8PA 1UN0A 2JKTA 5FC8E 5CL8A 3O2TA 3Q0PA 4V3OA 3L6YA 4OIHA 1QGKA 2C1TA 5SW9A 3ODRA 1M8ZA 4I2SA 2Z6GA 3TPOA 4I8MA 4H3HA 3BTRC 4PLSA 5EKFA 4CRVB 4D49A 3QGBA 3PSPA 4EV8A 4EVTA 3WYFC 3ZIRA 3BSBA 4FZFA 3RZ9A 4UAFB 3JY1A 1EE5A 3FEXC 4H3KA 3BX2A 4JKQA 3ZIPA 3L3QA 3JXYA 4U5OA 1UKLA 3NMZA 4R0ZA 3GQ2A 4UADA 4MZ5E 3TT9A 4D4EA 1T08A 3TJ3A 1I7WA 2DB0A 4FQ3A 5CTTA 3AU3A 4R11A 1HO8A 1QBKB 4G3AA 3QMLC 4JW2A 3K5ZA 3Q0RA 3OUXA 1F59A 2WTKA 2NYLB 1GCJA 4PLQA 1TE4A 1IQ1C 3UKWB 3DADA 3FEYC 4L4IA 3K64A 3JX7A 3LTJA 3WPTA 4A3TA 2C1MA 3Q0MA 4WV6A 5B56A 4HM9A 1BK6A 5K6SA 4CT6B 3L3FX 2Z5JA 5H2WA 3EBBA 3NOWA 3ND2A 1M5NS 2Q5DA 3BCTA 2IX3A 1G3JA 2H4MA 1UPKA 3UKZB 3Q0SA 4U5VA 3H3DX 1Q1SC 4BPLA 3BX3A 3TPMA 3BWTA 4I2WA 2RU4A 5DN7A 5SVZA 5HUYC 5BZVA 4DJSA 4U5UA 5EKGA 4A0CA 1U6GC 4EVAA 3C2HA 3ZIKA 3OUWA 3IFQA 2Z5OA 3K7VA 3K62A 3ZHPA 4KZGA 1EE4A 4I96A 4QMJA 1V18A 5CL3A 3C5WA 2JKTB 2PKGA 4EV9A 4DB6A 3OPBA 4YI0C 3UKXB 3L6XA 3PSTA 1WA5C 4GMNA 4HXTA 3ZIQA 5KL1A 4QMIA 5JJAA 3ZIOA 3UKYB 4FZDA 3GVOA 4XZRB 1M1EA 1W9CA 4CBAA 4MFVA 1XQSA 3GRLA 3LWWA 3Q5UA 5E6QB 5CL4A 4IMIA 3A6PA 3K5QA 2W3CA 2OF3A 4V3QA 3VWAA 4Y5JA 3O4XA 1JDHA 2IE3A 2Z5MA 4JW3C 4UWXA 3TX7A 4I5LA 4P6ZB 3V6YA 3K4EA 3OBVA 2QK1A 4I3NA 4U5SA 1IALA 3QHEA 4MFUA 3ODSA 3JXZA 4U58A 2X1GF 4U5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HHG E;  3VE6 A;  4JLQ A;  2Z5N A;  3GS3 A;  4UAE A;  2QK2 A;  4CB9 A;  1M8Y A;  4EVP A;  4PVZ A;  4JW2 B;  3QGC A;  1IB2 A;  3Q0L A;  1I7X A;  4RZP A;  1XQR A;  4NZW A;  2JKR A;  5D5K C;  3GVT A;  3V74 A;  1QGR A;  2JDQ A;  2QMR A;  2JKR B;  5KLR B;  1JPW A;  1BK5 A;  5H2X A;  1Q1T C;  2VGL A;  4I5N A;  4RV1 A;  3UL1 B;  3Q0O A;  4K6J A;  4DZS A;  2OT8 A;  4B18 A;  5HUW C;  4CB8 A;  4DB8 A;  2IW3 A;  4NEE A;  3ZKV A;  4HNM A;  5BZU A;  1EJL I;  3W3U A;  3LTM A;  4B8J A;  2BKU B;  3V71 A;  2PF4 A;  1XM9 A;  2RU4 B;  2YJY A;  4P6Z G;  5KLA A;  1O6O A;  3WOZ A;  1WA5 B;  3KND A;  2IWH A;  4YGX A;  1JPP A;  4FDD A;  5K9S A;  2F31 A;  3TJZ B;  1B3U A;  4YK6 A;  2GL7 A;  4FZA A;  4U3J C;  4CV5 B;  2FV2 A;  4BA3 A;  2BAP A;  4DBA A;  2YNR A;  1Y2A C;  4IMJ A;  3FGA A;  3O2S A;  3C2G A;  3K49 A;  3Q0N A;  4YJL A;  2IE4 A;  3NMW A;  3GNI A;  1IBR B;  1W63 A;  1TH1 A;  3K5Y A;  3FGA B;  5SWF A;  4BQK A;  3QG9 A;  5BYM A;  4DB9 A;  4ZDU A;  4HTV A;  4LAC A;  4B8O A;  4DVG B;  4UQI A;  2IAE A;  4CRU B;  3EA5 B;  1W63 B;  4ADY A;  2NYM A;  3WOY A;  5BZ5 A;  4U54 A;  1Z2C B;  3UL0 B;  2BNX A;  4OO6 A;  2Z5K A;  4K92 A;  1UPL A;  4UQI B;  2IAE B;  3K7W A;  3Q0Q A;  3IBV A;  4U5L A;  2NYM B;  4MZ6 E;  4QMH A;  3GAE A;  5EWP A;  4E4V A;  2NPP A;  2NYL A;  2BCT A;  3ZIN A;  5BZ1 A;  4L7M A;  2NPP B;  3EG5 B;  3NMX A;  1PJM B;  5J3V A;  3GB8 A;  4PLR A;  2P8Q A;  2Z6H A;  1QZ7 A;  1LUJ A;  4GMO A;  4TNM A;  1OYZ A;  5KL8 A;  3OQS A;  1M8X A;  5AEI A;  2X19 B;  4I2Z A;  1LRV A;  2VGL B;  4R10 A;  3RZX A;  2QNA A;  5LSW A;  2XA7 A;  5KLT B;  1EJY I;  1O6P A;  2XA7 B;  3UVU A;  4FFB C;  3K61 A;  4V3R A;  4YJE A;  3DW8 A;  3O2Q A;  3T7U A;  3BSX A;  2YNS A;  2JAK A;  4CT7 B;  4O27 A;  1M8W A;  4RXH B;  1PJN B;  4B8P A;  1UN0 A;  2JKT A;  5FC8 E;  3O2T A;  3Q0P A;  4V3O A;  3L6Y A;  4OIH A;  1QGK A;  2C1T A;  5SW9 A;  3ODR A;  1M8Z A;  2Z6G A;  3TPO A;  4H3H A;  3BTR C;  4PLS A;  5EKF A;  4CRV B;  4D49 A;  3QGB A;  3PSP A;  4EV8 A;  4EVT A;  3WYF C;  3ZIR A;  3BSB A;  4FZF A;  3RZ9 A;  4UAF B;  1EE5 A;  3FEX C;  4H3K A;  3BX2 A;  3ZIP A;  3L3Q A;  4U5O A;  1UKL A;  3NMZ A;  4R0Z A;  3GQ2 A;  4UAD A;  4MZ5 E;  3TT9 A;  4D4E A;  1T08 A;  3TJ3 A;  1I7W A;  2DB0 A;  4FQ3 A;  5CTT A;  3AU3 A;  4R11 A;  1HO8 A;  1QBK B;  4G3A A;  3QML C;  3K5Z A;  3Q0R A;  3OUX A;  1F59 A;  2WTK A;  2NYL B;  1GCJ A;  4PLQ A;  1IQ1 C;  3UKW B;  3DAD A;  3FEY C;  3K64 A;  3LTJ A;  3WPT A;  3Q0M A;  2C1M A;  4WV6 A;  5B56 A;  4HM9 A;  1BK6 A;  5K6S A;  4CT6 B;  3L3F X;  2Z5J A;  5H2W A;  3EBB A;  3NOW A;  3ND2 A;  1M5N S;  2Q5D A;  3BCT A;  2IX3 A;  1G3J A;  2H4M A;  1UPK A;  3UKZ B;  3Q0S A;  4U5V A;  3H3D X;  1Q1S C;  4BPL A;  3BX3 A;  3TPM A;  3BWT A;  4I2W A;  2RU4 A;  5DN7 A;  5SVZ A;  5HUY C;  5BZV A;  4DJS A;  4U5U A;  5EKG A;  4A0C A;  1U6G C;  4EVA A;  3C2H A;  3OUW A;  3IFQ A;  2Z5O A;  3K7V A;  3K62 A;  3ZHP A;  4KZG A;  1EE4 A;  4QMJ A;  1V18 A;  3C5W A;  2JKT B;  2PKG A;  4EV9 A;  4DB6 A;  3OPB A;  4YI0 C;  3UKX B;  3L6X A;  3PST A;  1WA5 C;  4GMN A;  4HXT A;  3ZIQ A;  5KL1 A;  4QMI A;  5JJA A;  3ZIO A;  3UKY B;  4FZD A;  3GVO A;  4XZR B;  1M1E A;  1W9C A;  4CBA A;  4MFV A;  1XQS A;  3GRL A;  3LWW A;  3Q5U A;  5E6Q B;  4IMI A;  3A6P A;  3K5Q A;  2W3C A;  2OF3 A;  4V3Q A;  3VWA A;  4Y5J A;  3O4X A;  1JDH A;  2IE3 A;  2Z5M A;  4UWX A;  3TX7 A;  4I5L A;  4P6Z B;  3V6Y A;  3K4E A;  3OBV A;  2QK1 A;  4U5S A;  1IAL A;  3QHE A;  4MFU A;  3ODS A;  4U58 A;  2X1G F;  4U5N A; 
#chains in the Genus database with same CATH topology
 5HHG E;  3VE6 A;  1N4K A;  4JLQ A;  2Z5N A;  3GS3 A;  4UAE A;  2QK2 A;  4CB9 A;  1M8Y A;  4EVP A;  4PVZ A;  3VLD A;  4JW2 B;  5CLA A;  3QGC A;  1IB2 A;  3Q0L A;  1I7X A;  4RZP A;  1XQR A;  4NZW A;  2JKR A;  5D5K C;  3UJ4 A;  3GVT A;  3V74 A;  3BVS A;  1QGR A;  2JDQ A;  2QMR A;  2JKR B;  5KLR B;  1JPW A;  1BK5 A;  5H2X A;  1Q1T C;  2VGL A;  4I5N A;  4RV1 A;  3UL1 B;  3Q0O A;  4K6J A;  4DZS A;  2OT8 A;  4B18 A;  5HUW C;  4CB8 A;  4DB8 A;  2IW3 A;  4NEE A;  3ZKV A;  5CLE A;  4HNM A;  5BZU A;  1EJL I;  3W3U A;  3LTM A;  4B8J A;  2BKU B;  4I37 A;  3V71 A;  2PF4 A;  1XM9 A;  5CLD A;  2RU4 B;  2YJY A;  4P6Z G;  5KLA A;  4I7I A;  1O6O A;  3WOZ A;  1WA5 B;  3KND A;  2IWH A;  4YGX A;  1JPP A;  4FDD A;  5K9S A;  2F31 A;  5CL5 A;  3TJZ B;  4I0Y A;  1B3U A;  4YK6 A;  2GL7 A;  4FZA A;  4U3J C;  4CV5 B;  2FV2 A;  4BA3 A;  2BAP A;  4I1E A;  4DBA A;  2YNR A;  1Y2A C;  4IMJ A;  3FGA A;  3O2S A;  3C2G A;  3K49 A;  5CLC A;  3SL9 A;  3Q0N A;  4YJL A;  2IE4 A;  3NMW A;  3GNI A;  1IBR B;  1W63 A;  1TH1 A;  3K5Y A;  3FGA B;  5SWF A;  4BQK A;  3QG9 A;  5BYM A;  4DB9 A;  4ZDU A;  4HTV A;  4LAC A;  4B8O A;  4DVG B;  4UQI A;  2IAE A;  4CRU B;  3EA5 B;  1W63 B;  4ADY A;  2NYM A;  3WOY A;  5BZ5 A;  4U54 A;  1Z2C B;  3UL0 B;  2BNX A;  4OO6 A;  4L4H A;  2Z5K A;  4K92 A;  5CL9 A;  1UPL A;  4UQI B;  2IAE B;  3K7W A;  3Q0Q A;  3IBV A;  4U5L A;  2NYM B;  3SLA A;  4MZ6 E;  4QMH A;  3GAE A;  5EWP A;  4E4V A;  2NPP A;  2NYL A;  2XOA A;  3ZIL A;  3VLF A;  2BCT A;  3ZIN A;  5BZ1 A;  4L7M A;  3VLE A;  2NPP B;  3EG5 B;  3NMX A;  1PJM B;  4A3V A;  5J3V A;  3GB8 A;  4PLR A;  2P8Q A;  2Z6H A;  1QZ7 A;  5CL6 A;  1LUJ A;  4GMO A;  4TNM A;  1OYZ A;  5KL8 A;  3OQS A;  1M8X A;  5AEI A;  2X19 B;  4I2Z A;  1LRV A;  2VGL B;  4R10 A;  3RZX A;  5CL7 A;  2QNA A;  5LSW A;  2XA7 A;  5KLT B;  1EJY I;  5CLB A;  5KUB A;  1O6P A;  4FP7 A;  4I6I A;  2XA7 B;  4U2X D;  3UVU A;  4FFB C;  3K61 A;  4V3R A;  4YJE A;  3DW8 A;  3O2Q A;  3T7U A;  3BSX A;  2YNS A;  2JAK A;  4CT7 B;  4O27 A;  1M8W A;  4RXH B;  1PJN B;  4B8P A;  1UN0 A;  2JKT A;  5FC8 E;  5CL8 A;  3O2T A;  3Q0P A;  4V3O A;  3L6Y A;  4OIH A;  1QGK A;  2C1T A;  5SW9 A;  3ODR A;  1M8Z A;  4I2S A;  2Z6G A;  3TPO A;  4I8M A;  4H3H A;  3BTR C;  4PLS A;  5EKF A;  4CRV B;  4D49 A;  3QGB A;  3PSP A;  4EV8 A;  4EVT A;  3WYF C;  3ZIR A;  3BSB A;  4FZF A;  3RZ9 A;  4UAF B;  3JY1 A;  1EE5 A;  3FEX C;  4H3K A;  3BX2 A;  4JKQ A;  3T8S A;  3ZIP A;  3L3Q A;  3JXY A;  4U5O A;  1UKL A;  3NMZ A;  4R0Z A;  3GQ2 A;  4UAD A;  4MZ5 E;  3TT9 A;  4D4E A;  1T08 A;  3TJ3 A;  1I7W A;  2DB0 A;  4FQ3 A;  5CTT A;  3AU3 A;  4R11 A;  1HO8 A;  1QBK B;  4G3A A;  3QML C;  4JW2 A;  3K5Z A;  3Q0R A;  3OUX A;  1F59 A;  2WTK A;  2NYL B;  1GCJ A;  4PLQ A;  1TE4 A;  1IQ1 C;  3UKW B;  3DAD A;  3FEY C;  4L4I A;  3K64 A;  3JX7 A;  3LTJ A;  3WPT A;  4A3T A;  2C1M A;  3Q0M A;  4WV6 A;  5B56 A;  4HM9 A;  1BK6 A;  5K6S A;  4CT6 B;  3L3F X;  2Z5J A;  5H2W A;  3EBB A;  1LSH A;  3NOW A;  3ND2 A;  1M5N S;  2Q5D A;  3BCT A;  2IX3 A;  1G3J A;  2H4M A;  1UPK A;  3UKZ B;  3Q0S A;  4U5V A;  3H3D X;  1Q1S C;  4BPL A;  3BX3 A;  3TPM A;  3BWT A;  4I2W A;  2RU4 A;  5DN7 A;  5SVZ A;  5HUY C;  5BZV A;  4DJS A;  4U5U A;  5EKG A;  4A0C A;  1U6G C;  4EVA A;  3C2H A;  3ZIK A;  3OUW A;  3IFQ A;  2Z5O A;  3K7V A;  3K62 A;  3ZHP A;  4KZG A;  1EE4 A;  4I96 A;  4QMJ A;  1V18 A;  3UJ0 A;  5CL3 A;  3C5W A;  2JKT B;  2PKG A;  4EV9 A;  4DB6 A;  3OPB A;  4YI0 C;  3UKX B;  3L6X A;  3PST A;  1WA5 C;  4GMN A;  4HXT A;  3ZIQ A;  5KL1 A;  4QMI A;  5JJA A;  3ZIO A;  3UKY B;  4FZD A;  3GVO A;  4XZR B;  1M1E A;  1W9C A;  4CBA A;  4MFV A;  1XQS A;  3GRL A;  3LWW A;  3Q5U A;  5E6Q B;  5CL4 A;  4IMI A;  3A6P A;  3K5Q A;  2W3C A;  2OF3 A;  4V3Q A;  3VWA A;  4Y5J A;  3O4X A;  1JDH A;  2IE3 A;  2Z5M A;  4JW3 C;  4UWX A;  3TX7 A;  4I5L A;  4P6Z B;  3V6Y A;  3K4E A;  3OBV A;  2QK1 A;  4I3N A;  4U5S A;  1IAL A;  3QHE A;  4MFU A;  3ODS A;  3JXZ A;  4U58 A;  2X1G F;  4U5N A; 
#chains in the Genus database with same CATH homology
 5HHG E;  3VE6 A;  4JLQ A;  2Z5N A;  3GS3 A;  4UAE A;  2QK2 A;  4CB9 A;  1M8Y A;  4EVP A;  4PVZ A;  3VLD A;  4JW2 B;  5CLA A;  3QGC A;  1IB2 A;  3Q0L A;  1I7X A;  4RZP A;  1XQR A;  4NZW A;  2JKR A;  5D5K C;  3GVT A;  3V74 A;  3BVS A;  1QGR A;  2JDQ A;  2QMR A;  2JKR B;  5KLR B;  1JPW A;  1BK5 A;  5H2X A;  1Q1T C;  2VGL A;  4I5N A;  4RV1 A;  3UL1 B;  3Q0O A;  4K6J A;  4DZS A;  2OT8 A;  4B18 A;  5HUW C;  4CB8 A;  4DB8 A;  2IW3 A;  4NEE A;  3ZKV A;  5CLE A;  4HNM A;  5BZU A;  1EJL I;  3W3U A;  3LTM A;  4B8J A;  2BKU B;  4I37 A;  3V71 A;  2PF4 A;  1XM9 A;  5CLD A;  2RU4 B;  2YJY A;  4P6Z G;  5KLA A;  4I7I A;  1O6O A;  3WOZ A;  1WA5 B;  3KND A;  2IWH A;  4YGX A;  1JPP A;  4FDD A;  5K9S A;  2F31 A;  5CL5 A;  3TJZ B;  4I0Y A;  1B3U A;  4YK6 A;  2GL7 A;  4FZA A;  4U3J C;  4CV5 B;  2FV2 A;  4BA3 A;  2BAP A;  4I1E A;  4DBA A;  2YNR A;  1Y2A C;  4IMJ A;  3FGA A;  3O2S A;  3C2G A;  3K49 A;  5CLC A;  3SL9 A;  3Q0N A;  4YJL A;  2IE4 A;  3NMW A;  3GNI A;  1IBR B;  1W63 A;  1TH1 A;  3K5Y A;  3FGA B;  5SWF A;  4BQK A;  3QG9 A;  5BYM A;  4DB9 A;  4ZDU A;  4HTV A;  4LAC A;  4B8O A;  4DVG B;  4UQI A;  2IAE A;  4CRU B;  3EA5 B;  1W63 B;  4ADY A;  2NYM A;  3WOY A;  5BZ5 A;  4U54 A;  1Z2C B;  3UL0 B;  2BNX A;  4OO6 A;  4L4H A;  2Z5K A;  4K92 A;  5CL9 A;  1UPL A;  4UQI B;  2IAE B;  3K7W A;  3Q0Q A;  3IBV A;  4U5L A;  2NYM B;  3SLA A;  4MZ6 E;  4QMH A;  3GAE A;  5EWP A;  4E4V A;  2NPP A;  2NYL A;  2XOA A;  3ZIL A;  3VLF A;  2BCT A;  3ZIN A;  5BZ1 A;  4L7M A;  3VLE A;  2NPP B;  3EG5 B;  3NMX A;  1PJM B;  4A3V A;  5J3V A;  3GB8 A;  4PLR A;  2P8Q A;  2Z6H A;  1QZ7 A;  5CL6 A;  1LUJ A;  4GMO A;  4TNM A;  1OYZ A;  5KL8 A;  3OQS A;  1M8X A;  5AEI A;  2X19 B;  4I2Z A;  1LRV A;  2VGL B;  4R10 A;  3RZX A;  5CL7 A;  2QNA A;  5LSW A;  2XA7 A;  5KLT B;  1EJY I;  5CLB A;  5KUB A;  1O6P A;  4FP7 A;  4I6I A;  2XA7 B;  4U2X D;  3UVU A;  4FFB C;  3K61 A;  4V3R A;  4YJE A;  3DW8 A;  3O2Q A;  3T7U A;  3BSX A;  2YNS A;  2JAK A;  4CT7 B;  4O27 A;  1M8W A;  4RXH B;  1PJN B;  4B8P A;  1UN0 A;  2JKT A;  5FC8 E;  5CL8 A;  3O2T A;  3Q0P A;  4V3O A;  3L6Y A;  4OIH A;  1QGK A;  2C1T A;  5SW9 A;  3ODR A;  1M8Z A;  4I2S A;  2Z6G A;  3TPO A;  4I8M A;  4H3H A;  3BTR C;  4PLS A;  5EKF A;  4CRV B;  4D49 A;  3QGB A;  3PSP A;  4EV8 A;  4EVT A;  3WYF C;  3ZIR A;  3BSB A;  4FZF A;  3RZ9 A;  4UAF B;  3JY1 A;  1EE5 A;  3FEX C;  4H3K A;  3BX2 A;  4JKQ A;  3ZIP A;  3L3Q A;  3JXY A;  4U5O A;  1UKL A;  3NMZ A;  4R0Z A;  3GQ2 A;  4UAD A;  4MZ5 E;  3TT9 A;  4D4E A;  1T08 A;  3TJ3 A;  1I7W A;  2DB0 A;  4FQ3 A;  5CTT A;  3AU3 A;  4R11 A;  1HO8 A;  1QBK B;  4G3A A;  3QML C;  4JW2 A;  3K5Z A;  3Q0R A;  3OUX A;  1F59 A;  2WTK A;  2NYL B;  1GCJ A;  4PLQ A;  1TE4 A;  1IQ1 C;  3UKW B;  3DAD A;  3FEY C;  4L4I A;  3K64 A;  3JX7 A;  3LTJ A;  3WPT A;  4A3T A;  2C1M A;  3Q0M A;  4WV6 A;  5B56 A;  4HM9 A;  1BK6 A;  5K6S A;  4CT6 B;  3L3F X;  2Z5J A;  5H2W A;  3EBB A;  3NOW A;  3ND2 A;  1M5N S;  2Q5D A;  3BCT A;  2IX3 A;  1G3J A;  2H4M A;  1UPK A;  3UKZ B;  3Q0S A;  4U5V A;  3H3D X;  1Q1S C;  4BPL A;  3BX3 A;  3TPM A;  3BWT A;  4I2W A;  2RU4 A;  5DN7 A;  5SVZ A;  5HUY C;  5BZV A;  4DJS A;  4U5U A;  5EKG A;  4A0C A;  1U6G C;  4EVA A;  3C2H A;  3ZIK A;  3OUW A;  3IFQ A;  2Z5O A;  3K7V A;  3K62 A;  3ZHP A;  4KZG A;  1EE4 A;  4I96 A;  4QMJ A;  1V18 A;  5CL3 A;  3C5W A;  2JKT B;  2PKG A;  4EV9 A;  4DB6 A;  3OPB A;  4YI0 C;  3UKX B;  3L6X A;  3PST A;  1WA5 C;  4GMN A;  4HXT A;  3ZIQ A;  5KL1 A;  4QMI A;  5JJA A;  3ZIO A;  3UKY B;  4FZD A;  3GVO A;  4XZR B;  1M1E A;  1W9C A;  4CBA A;  4MFV A;  1XQS A;  3GRL A;  3LWW A;  3Q5U A;  5E6Q B;  5CL4 A;  4IMI A;  3A6P A;  3K5Q A;  2W3C A;  2OF3 A;  4V3Q A;  3VWA A;  4Y5J A;  3O4X A;  1JDH A;  2IE3 A;  2Z5M A;  4JW3 C;  4UWX A;  3TX7 A;  4I5L A;  4P6Z B;  3V6Y A;  3K4E A;  3OBV A;  2QK1 A;  4I3N A;  4U5S A;  1IAL A;  3QHE A;  4MFU A;  3ODS A;  3JXZ A;  4U58 A;  2X1G F;  4U5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...