1XM9A

Structure of the armadillo repeat domain of plakophilin 1
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
457
structure length
420
Chain Sequence
GLTIPKAVQYLSSQDEKYQAIGAYYIQHTCFQDESAKQQVYQLGGICKLVDLLRSPNQNVQQAAAGALRNLVFRSTTNKLETRRQNGIREAVSLLRRTGNAEIQKQLTGLLWNLSSTDELKEELIADALPVLADRVIIPFSGWCVVDPEVFFNATGCLRNLSSADAGRQTMRNYSGLIDSLMAYVQNCVAASRCDDKSVENCMCVLHNLSYRLDAEVPTRYRQLEYNALPEEETNPKGSGWLYHSDAIRTYLNLMGKSKKDATLEACAGALQNLTASKGLMSSGMSQLIGLKEKGLPQIARLLQSGNSDVVRSGASLLSNMSRHPLLHRVMGNQVFPEVTRLLTSHTGNTSNSEDILSSACYTVRNLMASQPQLAKQYFSSSMLNNIINLCRSSASPKAAEAARLLLSDMWSSKELQGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords plakophilin 1
publication title Structure of the armadillo repeat domain of plakophilin 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 149
structure length 420
sequence length 457
ec nomenclature
pdb deposition date 2004-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00514 Arm Armadillo/beta-catenin-like repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 1xm9A01
4U5UA 3ZIPA 1EJYI 4UAEA 4D4EA 4U5LA 2JAKA 3AU3A 5BZ5A 2QK1A 3O2QA 1M8ZA 4IMIA 1LUJA 4E4VA 4NEEA 2OT8A 2YJYA 3BSBA 4P6ZG 4UQIB 1EE4A 4UWXA 2Z6GA 3OUXA 4FZDA 4V3RA 3Q0PA 3GRLA 3UKWB 4G3AA 1WA5B 1BK5A 2NYMA 3EG5B 4ADYA 4HTVA 4UAFB 4FZFA 1QZ7A 2RU4B 3ZKVA 2GL7A 4U5VA 4EVAA 5HUYC 3UVUA 2IE3A 3GVOA 3O4XA 3FEXC 2NYLA 4XZRB 3IFQA 2QMRA 4YJLA 3H3DX 4RXHB 5BYMA 2BNXA 2JKRA 1OYZA 4GMOA 1JDHA 3V6YA 1XM9A 1I7WA 3ZHPA 4O27A 2IAEB 2P8QA 4CT7B 1M5NS 3OQSA 4PLQA 5LSWA 3ZINA 3K7VA 1Q1TC 3GS3A 3ZIRA 4FZAA 4R10A 2NPPA 4I2WA 1UPLA 4DBAA 4YGXA 4B8PA 3Q0SA 3O2SA 3VWAA 4U54A 5EWPA 3L6YA 1M8WA 4PVZA 4LACA 4R11A 3UL1B 2IE4A 3FGAB 3ODRA 1O6PA 2IX3A 3UKYB 4YI0C 4CRVB 3L6XA 5BZVA 2C1MA 3IBVA 2JKTB 4H3KA 2BKUB 1TH1A 1HO8A 4ZDUA 2X1GF 5B56A 3BSXA 4B8OA 3Q5UA 4PLSA 3TJZB 1I7XA 3GAEA 1W63A 1BK6A 5EKFA 4FQ3A 4L7MA 4OO6A 3BX3A 1B3UA 5SVZA 3ODSA 2IWHA 4OIHA 4U5NA 2NYMB 3UKXB 1Z2CB 2PKGA 5KLTB 4I2ZA 4V3OA 3LTJA 5H2XA 4UADA 4EV9A 1U6GC 4U3JC 5JJAA 4EVTA 4UQIA 1QGRA 4D49A 4HNMA 4FFBC 4H3HA 1QBKB 1IALA 4HM9A 3ZIOA 3KNDA 2RU4A 4DVGB 2X19B 3BTRC 2H4MA 4DJSA 3BWTA 1IB2A 4MFVA 3PSPA 4CT6B 1WA5C 3K5ZA 4JW2B 1QGKA 3V71A 1EJLI 3GVTA 2YNRA 2Z5MA 4V3QA 3GNIA 3OBVA 5KLRB 1UKLA 4MFUA 4TNMA 4CRUB 3TX7A 3NMZA 1XQSA 4GMNA 1EE5A 2VGLA 1Q1SC 4I5LA 4CB9A 3K5YA 4HXTA 3QGBA 3L3FX 3Q0MA 2YNSA 2XA7B 3C2GA 3WYFC 4U58A 3FEYC 3WPTA 4FDDA 3QMLC 3T7UA 1M1EA 3Q0LA 5BZ1A 3L3QA 4Y5JA 2Q5DA 5SWFA 3QGCA 3LTMA 3ND2A 3VE6A 3C2HA 3BCTA 3FGAA 5K6SA 3RZXA 3QG9A 1PJMB 1JPWA 3TT9A 3GQ2A 5HHGE 4RV1A 2JKTA 1IBRB 3GB8A 5HUWC 2BAPA 1F59A 4CV5B 2PF4A 3Q0OA 1UN0A 5H2WA 2IW3A 4QMIA 1W9CA 2QNAA 2Z5NA 3UKZB 3PSTA 1M8XA 3DW8A 2JDQA 3Q0QA 3K5QA 4DB9A 4JLQA 3Q0NA 3K61A 5D5KC 1Y2AC 3NOWA 2Z6HA 3K49A 2QK2A 4DB6A 2NYLB 5E6QB 3RZ9A 1XQRA 5SW9A 5DN7A 3W3UA 4P6ZB 4R0ZA 5CTTA 3K7WA 4K92A 2JKRB 3O2TA 3TPMA 4WV6A 1UPKA 4KZGA 4CB8A 3Q0RA 3TPOA 4RZPA 1LRVA 4QMHA 4A0CA 4BPLA 2Z5KA 4MZ6E 3ZIQA 3NMWA 2NPPB 5K9SA 3A6PA 2W3CA 2F31A 1JPPA 2OF3A 2VGLB 5KL1A 3TJ3A 5BZUA 1GCJA 4I5NA 3QHEA 3BX2A 2Z5OA 2WTKA 4CBAA 1G3JA 3EBBA 4BA3A 1O6OA 4MZ5E 5KLAA 3OPBA 1PJNB 2IAEA 4DZSA 4EV8A 4IMJA 2BCTA 5KL8A 5J3VA 3V74A 4U5SA 3EA5B 4NZWA 1V18A 4U5OA 3DADA 3OUWA 4BQKA 4B18A 1IQ1C 4K6JA 5AEIA 2DB0A 3K64A 5EKGA 4PLRA 3LWWA 4DB8A 3K62A 2FV2A 3NMXA 3WOZA 1W63B 4YK6A 2XA7A 4QMJA 4YJEA 2C1TA 4B8JA 4EVPA 1M8YA 3K4EA 3WOYA 1T08A 3C5WA 5FC8E 3UL0B 2Z5JA
chains in the Genus database with same CATH superfamily
4U5UA 3ZIPA 1EJYI 4UAEA 4D4EA 5KUBA 4U5LA 2JAKA 3AU3A 5BZ5A 2QK1A 3O2QA 1M8ZA 4IMIA 1LUJA 4E4VA 4NEEA 2OT8A 2YJYA 3BSBA 4P6ZG 4UQIB 1EE4A 4UWXA 2Z6GA 3OUXA 4FZDA 4V3RA 3Q0PA 3GRLA 3UKWB 4G3AA 5CL3A 1WA5B 1BK5A 2NYMA 4L4HA 3EG5B 4ADYA 4HTVA 4UAFB 3SL9A 4FZFA 1QZ7A 2RU4B 3ZKVA 2GL7A 4U5VA 4EVAA 5HUYC 3ZIKA 3UVUA 2IE3A 3GVOA 3O4XA 3FEXC 2NYLA 4XZRB 3IFQA 2QMRA 4YJLA 3H3DX 4RXHB 5BYMA 2BNXA 2JKRA 1OYZA 4GMOA 5CLDA 1JDHA 3V6YA 1XM9A 1I7WA 3ZHPA 4I3NA 4O27A 3VLEA 2IAEB 2P8QA 4CT7B 1M5NS 3OQSA 4PLQA 5LSWA 3ZINA 3K7VA 1Q1TC 3GS3A 3ZIRA 4FZAA 4R10A 2NPPA 4I2WA 1UPLA 4DBAA 4YGXA 4I7IA 4B8PA 3Q0SA 3O2SA 3VWAA 4U54A 5EWPA 3L6YA 1M8WA 4PVZA 4LACA 4R11A 3VLFA 3BVSA 3UL1B 2IE4A 3FGAB 5CLEA 3ODRA 1O6PA 2IX3A 3UKYB 4YI0C 4CRVB 3L6XA 5BZVA 2C1MA 3IBVA 2JKTB 4H3KA 3JXZA 4A3TA 1LSHA 2BKUB 1TH1A 3VLDA 1HO8A 4ZDUA 2X1GF 5B56A 3BSXA 4B8OA 3Q5UA 4I8MA 4PLSA 1TE4A 3TJZB 1I7XA 4I37A 3GAEA 1W63A 1BK6A 5EKFA 4FQ3A 4L7MA 4OO6A 3BX3A 1B3UA 5SVZA 3ODSA 2IWHA 4OIHA 4U5NA 2NYMB 3UKXB 3JY1A 1Z2CB 2PKGA 3UJ0A 5KLTB 4I2ZA 5CL8A 4V3OA 3LTJA 5H2XA 4UADA 4EV9A 1U6GC 4U3JC 5JJAA 4EVTA 4UQIA 1QGRA 4D49A 4HNMA 4FFBC 4H3HA 1QBKB 1IALA 4HM9A 3ZIOA 3KNDA 2RU4A 4U2XD 4DVGB 2X19B 3BTRC 2H4MA 4DJSA 3BWTA 1IB2A 4MFVA 3PSPA 4CT6B 1WA5C 3K5ZA 4JW2B 1QGKA 3V71A 1EJLI 3GVTA 2YNRA 2Z5MA 4V3QA 3GNIA 3OBVA 5KLRB 1UKLA 4MFUA 4I6IA 4TNMA 4CRUB 3TX7A 3NMZA 1XQSA 4GMNA 1EE5A 2VGLA 1Q1SC 5CL9A 4I5LA 4CB9A 3K5YA 4HXTA 3QGBA 3L3FX 3Q0MA 5CLBA 2YNSA 2XA7B 3C2GA 3WYFC 4U58A 3FEYC 3WPTA 4FDDA 3QMLC 3T7UA 1M1EA 3Q0LA 5BZ1A 3L3QA 4Y5JA 3T8SA 2Q5DA 5SWFA 3ZILA 3QGCA 3LTMA 3ND2A 3VE6A 3C2HA 3BCTA 3FGAA 5K6SA 3RZXA 3QG9A 1PJMB 1JPWA 3TT9A 3GQ2A 5HHGE 4RV1A 2JKTA 1IBRB 3GB8A 5HUWC 2BAPA 1F59A 4CV5B 2PF4A 3Q0OA 1UN0A 5H2WA 2IW3A 4QMIA 1W9CA 2QNAA 2Z5NA 3UKZB 3PSTA 5CLAA 1M8XA 3DW8A 2JDQA 3Q0QA 3K5QA 4DB9A 4JLQA 3Q0NA 3K61A 5D5KC 5CL6A 1Y2AC 3NOWA 2Z6HA 3K49A 2QK2A 4DB6A 2NYLB 5E6QB 3JX7A 4I1EA 3RZ9A 1XQRA 5SW9A 5DN7A 3W3UA 4P6ZB 4R0ZA 5CTTA 3K7WA 4K92A 2JKRB 3O2TA 3TPMA 4WV6A 4I96A 1UPKA 4KZGA 4CB8A 3Q0RA 3TPOA 4RZPA 3UJ4A 1LRVA 4QMHA 4A0CA 4BPLA 2Z5KA 4MZ6E 3ZIQA 3NMWA 2XOAA 2NPPB 5K9SA 3A6PA 2W3CA 2F31A 5CL5A 1JPPA 2OF3A 2VGLB 5KL1A 3TJ3A 5BZUA 1GCJA 4I5NA 3QHEA 3BX2A 2Z5OA 2WTKA 1G3JA 3EBBA 4CBAA 4BA3A 1O6OA 4MZ5E 5KLAA 3OPBA 5CL7A 5CL4A 1PJNB 2IAEA 4JW2A 3SLAA 4DZSA 1N4KA 4EV8A 4IMJA 5CLCA 2BCTA 5KL8A 5J3VA 4A3VA 3V74A 4U5SA 3EA5B 4NZWA 4JW3C 1V18A 4U5OA 4I0YA 3DADA 3OUWA 4BQKA 4B18A 1IQ1C 4K6JA 5AEIA 2DB0A 3K64A 5EKGA 4PLRA 3LWWA 4DB8A 3K62A 2FV2A 3NMXA 3WOZA 1W63B 4YK6A 2XA7A 4FP7A 4I2SA 4QMJA 4YJEA 2C1TA 4B8JA 3JXYA 4EVPA 1M8YA 3K4EA 3WOYA 1T08A 4L4IA 3C5WA 4JKQA 5FC8E 3UL0B 2Z5JA
chains in the Genus database with same CATH topology
4U5UA 3ZIPA 1EJYI 4UAEA 4D4EA 5KUBA 4U5LA 2JAKA 3AU3A 5BZ5A 2QK1A 3O2QA 1M8ZA 4IMIA 1LUJA 4E4VA 4NEEA 2OT8A 2YJYA 3BSBA 4P6ZG 4UQIB 1EE4A 4UWXA 2Z6GA 3OUXA 4FZDA 4V3RA 3Q0PA 3GRLA 3UKWB 4G3AA 5CL3A 1WA5B 1BK5A 2NYMA 4L4HA 3EG5B 4ADYA 4HTVA 4UAFB 3SL9A 4FZFA 1QZ7A 2RU4B 3ZKVA 2GL7A 4U5VA 4EVAA 5HUYC 3ZIKA 3UVUA 2IE3A 3GVOA 3O4XA 3FEXC 2NYLA 4XZRB 3IFQA 2QMRA 4YJLA 3H3DX 4RXHB 5BYMA 2BNXA 2JKRA 1OYZA 4GMOA 5CLDA 1JDHA 3V6YA 1XM9A 1I7WA 3ZHPA 4I3NA 4O27A 3VLEA 2IAEB 2P8QA 4CT7B 1M5NS 3OQSA 4PLQA 5LSWA 3ZINA 3K7VA 1Q1TC 3GS3A 3ZIRA 4FZAA 4R10A 2NPPA 4I2WA 1UPLA 4DBAA 4YGXA 4I7IA 4B8PA 3Q0SA 3O2SA 3VWAA 4U54A 5EWPA 3L6YA 1M8WA 4PVZA 4LACA 4R11A 3VLFA 3BVSA 3UL1B 2IE4A 3FGAB 5CLEA 3ODRA 1O6PA 2IX3A 3UKYB 4YI0C 4CRVB 3L6XA 5BZVA 2C1MA 3IBVA 2JKTB 4H3KA 3JXZA 4A3TA 2BKUB 1TH1A 3VLDA 1HO8A 4ZDUA 2X1GF 5B56A 3BSXA 4B8OA 3Q5UA 4I8MA 4PLSA 1TE4A 3TJZB 1I7XA 4I37A 3GAEA 1W63A 1BK6A 5EKFA 4FQ3A 4L7MA 4OO6A 3BX3A 1B3UA 5SVZA 3ODSA 2IWHA 4OIHA 4U5NA 2NYMB 3UKXB 3JY1A 1Z2CB 2PKGA 5KLTB 4I2ZA 5CL8A 4V3OA 3LTJA 5H2XA 4UADA 4EV9A 1U6GC 4U3JC 5JJAA 4EVTA 4UQIA 1QGRA 4D49A 4HNMA 4FFBC 4H3HA 1QBKB 1IALA 4HM9A 3ZIOA 3KNDA 2RU4A 4U2XD 4DVGB 2X19B 3BTRC 2H4MA 4DJSA 3BWTA 1IB2A 4MFVA 3PSPA 4CT6B 1WA5C 3K5ZA 4JW2B 1QGKA 3V71A 1EJLI 3GVTA 2YNRA 2Z5MA 4V3QA 3GNIA 3OBVA 5KLRB 1UKLA 4MFUA 4I6IA 4TNMA 4CRUB 3TX7A 3NMZA 1XQSA 4GMNA 1EE5A 2VGLA 1Q1SC 5CL9A 4I5LA 4CB9A 3K5YA 4HXTA 3QGBA 3L3FX 3Q0MA 5CLBA 2YNSA 2XA7B 3C2GA 3WYFC 4U58A 3FEYC 3WPTA 4FDDA 3QMLC 3T7UA 1M1EA 3Q0LA 5BZ1A 3L3QA 4Y5JA 3ZILA 2Q5DA 5SWFA 3QGCA 3LTMA 3ND2A 3VE6A 3C2HA 3BCTA 3FGAA 5K6SA 3RZXA 3QG9A 1PJMB 1JPWA 3TT9A 3GQ2A 5HHGE 4RV1A 2JKTA 1IBRB 3GB8A 5HUWC 2BAPA 1F59A 4CV5B 2PF4A 3Q0OA 1UN0A 5H2WA 2IW3A 4QMIA 1W9CA 2QNAA 2Z5NA 3UKZB 3PSTA 5CLAA 1M8XA 3DW8A 2JDQA 3Q0QA 3K5QA 4DB9A 4JLQA 3Q0NA 3K61A 5D5KC 5CL6A 1Y2AC 3NOWA 2Z6HA 3K49A 2QK2A 4DB6A 2NYLB 5E6QB 3JX7A 4I1EA 3RZ9A 1XQRA 5SW9A 5DN7A 3W3UA 4P6ZB 4R0ZA 5CTTA 3K7WA 4K92A 2JKRB 3O2TA 3TPMA 4WV6A 4I96A 1UPKA 4KZGA 4CB8A 3Q0RA 3TPOA 4RZPA 1LRVA 4QMHA 4A0CA 4BPLA 2Z5KA 4MZ6E 3ZIQA 3NMWA 2XOAA 2NPPB 5K9SA 3A6PA 2W3CA 2F31A 5CL5A 1JPPA 2OF3A 2VGLB 5KL1A 3TJ3A 5BZUA 1GCJA 4I5NA 3QHEA 3BX2A 2Z5OA 2WTKA 1G3JA 3EBBA 4CBAA 4BA3A 1O6OA 4MZ5E 5KLAA 3OPBA 5CL7A 5CL4A 1PJNB 2IAEA 4JW2A 3SLAA 4DZSA 4EV8A 4IMJA 5CLCA 2BCTA 5KL8A 5J3VA 4A3VA 3V74A 4U5SA 3EA5B 4NZWA 4JW3C 1V18A 4U5OA 4I0YA 3DADA 3OUWA 4BQKA 4B18A 1IQ1C 4K6JA 5AEIA 2DB0A 3K64A 5EKGA 4PLRA 3LWWA 4DB8A 3K62A 2FV2A 3NMXA 3WOZA 1W63B 4YK6A 2XA7A 4FP7A 4I2SA 4QMJA 4YJEA 2C1TA 4B8JA 3JXYA 4EVPA 1M8YA 3K4EA 3WOYA 1T08A 4L4IA 3C5WA 4JKQA 5FC8E 3UL0B 2Z5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5U A;  3ZIP A;  1EJY I;  4UAE A;  4D4E A;  4U5L A;  2JAK A;  3AU3 A;  5BZ5 A;  2QK1 A;  3O2Q A;  1M8Z A;  4IMI A;  1LUJ A;  4E4V A;  4NEE A;  2OT8 A;  2YJY A;  3BSB A;  4P6Z G;  4UQI B;  1EE4 A;  4UWX A;  2Z6G A;  3OUX A;  4FZD A;  4V3R A;  3Q0P A;  3GRL A;  3UKW B;  4G3A A;  1WA5 B;  1BK5 A;  2NYM A;  3EG5 B;  4ADY A;  4HTV A;  4UAF B;  4FZF A;  1QZ7 A;  2RU4 B;  3ZKV A;  2GL7 A;  4U5V A;  4EVA A;  5HUY C;  3UVU A;  2IE3 A;  3GVO A;  3O4X A;  3FEX C;  2NYL A;  4XZR B;  3IFQ A;  2QMR A;  4YJL A;  3H3D X;  4RXH B;  5BYM A;  2BNX A;  2JKR A;  1OYZ A;  4GMO A;  1JDH A;  3V6Y A;  1XM9 A;  1I7W A;  3ZHP A;  4O27 A;  2IAE B;  2P8Q A;  4CT7 B;  1M5N S;  3OQS A;  4PLQ A;  5LSW A;  3ZIN A;  3K7V A;  1Q1T C;  3GS3 A;  3ZIR A;  4FZA A;  4R10 A;  2NPP A;  4I2W A;  1UPL A;  4DBA A;  4YGX A;  4B8P A;  3Q0S A;  3O2S A;  3VWA A;  4U54 A;  5EWP A;  3L6Y A;  1M8W A;  4PVZ A;  4LAC A;  4R11 A;  3UL1 B;  2IE4 A;  3FGA B;  3ODR A;  1O6P A;  2IX3 A;  3UKY B;  4YI0 C;  4CRV B;  3L6X A;  5BZV A;  2C1M A;  3IBV A;  2JKT B;  4H3K A;  2BKU B;  1TH1 A;  1HO8 A;  4ZDU A;  2X1G F;  5B56 A;  3BSX A;  4B8O A;  3Q5U A;  4PLS A;  3TJZ B;  1I7X A;  3GAE A;  1W63 A;  1BK6 A;  5EKF A;  4FQ3 A;  4L7M A;  4OO6 A;  3BX3 A;  1B3U A;  5SVZ A;  3ODS A;  2IWH A;  4OIH A;  4U5N A;  2NYM B;  3UKX B;  1Z2C B;  2PKG A;  5KLT B;  4I2Z A;  4V3O A;  3LTJ A;  5H2X A;  4UAD A;  4EV9 A;  1U6G C;  4U3J C;  5JJA A;  4EVT A;  4UQI A;  1QGR A;  4D49 A;  4HNM A;  4FFB C;  4H3H A;  1QBK B;  1IAL A;  4HM9 A;  3ZIO A;  3KND A;  2RU4 A;  4DVG B;  2X19 B;  3BTR C;  2H4M A;  4DJS A;  3BWT A;  1IB2 A;  4MFV A;  3PSP A;  4CT6 B;  1WA5 C;  3K5Z A;  4JW2 B;  1QGK A;  3V71 A;  1EJL I;  3GVT A;  2YNR A;  2Z5M A;  4V3Q A;  3GNI A;  3OBV A;  5KLR B;  1UKL A;  4MFU A;  4TNM A;  4CRU B;  3TX7 A;  3NMZ A;  1XQS A;  4GMN A;  1EE5 A;  2VGL A;  1Q1S C;  4I5L A;  4CB9 A;  3K5Y A;  4HXT A;  3QGB A;  3L3F X;  3Q0M A;  2YNS A;  2XA7 B;  3C2G A;  3WYF C;  4U58 A;  3FEY C;  3WPT A;  4FDD A;  3QML C;  3T7U A;  1M1E A;  3Q0L A;  5BZ1 A;  3L3Q A;  4Y5J A;  2Q5D A;  5SWF A;  3QGC A;  3LTM A;  3ND2 A;  3VE6 A;  3C2H A;  3BCT A;  3FGA A;  5K6S A;  3RZX A;  3QG9 A;  1PJM B;  1JPW A;  3TT9 A;  3GQ2 A;  5HHG E;  4RV1 A;  2JKT A;  1IBR B;  3GB8 A;  5HUW C;  2BAP A;  1F59 A;  4CV5 B;  2PF4 A;  3Q0O A;  1UN0 A;  5H2W A;  2IW3 A;  4QMI A;  1W9C A;  2QNA A;  2Z5N A;  3UKZ B;  3PST A;  1M8X A;  3DW8 A;  2JDQ A;  3Q0Q A;  3K5Q A;  4DB9 A;  4JLQ A;  3Q0N A;  3K61 A;  5D5K C;  1Y2A C;  3NOW A;  2Z6H A;  3K49 A;  2QK2 A;  4DB6 A;  2NYL B;  5E6Q B;  3RZ9 A;  1XQR A;  5SW9 A;  5DN7 A;  3W3U A;  4P6Z B;  4R0Z A;  5CTT A;  3K7W A;  4K92 A;  2JKR B;  3O2T A;  3TPM A;  4WV6 A;  1UPK A;  4KZG A;  4CB8 A;  3Q0R A;  3TPO A;  4RZP A;  1LRV A;  4QMH A;  4A0C A;  4BPL A;  2Z5K A;  4MZ6 E;  3ZIQ A;  3NMW A;  2NPP B;  5K9S A;  3A6P A;  2W3C A;  2F31 A;  1JPP A;  2OF3 A;  2VGL B;  5KL1 A;  3TJ3 A;  5BZU A;  1GCJ A;  4I5N A;  3QHE A;  3BX2 A;  2Z5O A;  2WTK A;  4CBA A;  1G3J A;  3EBB A;  4BA3 A;  1O6O A;  4MZ5 E;  5KLA A;  3OPB A;  1PJN B;  2IAE A;  4DZS A;  4EV8 A;  4IMJ A;  2BCT A;  5KL8 A;  5J3V A;  3V74 A;  4U5S A;  3EA5 B;  4NZW A;  1V18 A;  4U5O A;  3DAD A;  3OUW A;  4BQK A;  4B18 A;  1IQ1 C;  4K6J A;  5AEI A;  2DB0 A;  3K64 A;  5EKG A;  4PLR A;  3LWW A;  4DB8 A;  3K62 A;  2FV2 A;  3NMX A;  3WOZ A;  1W63 B;  4YK6 A;  2XA7 A;  4QMJ A;  4YJE A;  2C1T A;  4B8J A;  4EVP A;  1M8Y A;  3K4E A;  3WOY A;  1T08 A;  3C5W A;  5FC8 E;  3UL0 B;  2Z5J A; 
#chains in the Genus database with same CATH topology
 4U5U A;  3ZIP A;  1EJY I;  4UAE A;  4D4E A;  5KUB A;  4U5L A;  2JAK A;  3AU3 A;  5BZ5 A;  2QK1 A;  3O2Q A;  1M8Z A;  4IMI A;  1LUJ A;  4E4V A;  4NEE A;  2OT8 A;  2YJY A;  3BSB A;  4P6Z G;  4UQI B;  1EE4 A;  4UWX A;  2Z6G A;  3OUX A;  4FZD A;  4V3R A;  3Q0P A;  3GRL A;  3UKW B;  4G3A A;  5CL3 A;  1WA5 B;  1BK5 A;  2NYM A;  4L4H A;  3EG5 B;  4ADY A;  4HTV A;  4UAF B;  3SL9 A;  4FZF A;  1QZ7 A;  2RU4 B;  3ZKV A;  2GL7 A;  4U5V A;  4EVA A;  5HUY C;  3ZIK A;  3UVU A;  2IE3 A;  3GVO A;  3O4X A;  3FEX C;  2NYL A;  4XZR B;  3IFQ A;  2QMR A;  4YJL A;  3H3D X;  4RXH B;  5BYM A;  2BNX A;  2JKR A;  1OYZ A;  4GMO A;  5CLD A;  1JDH A;  3V6Y A;  1XM9 A;  1I7W A;  3ZHP A;  4I3N A;  4O27 A;  3VLE A;  2IAE B;  2P8Q A;  4CT7 B;  1M5N S;  3OQS A;  4PLQ A;  5LSW A;  3ZIN A;  3K7V A;  1Q1T C;  3GS3 A;  3ZIR A;  4FZA A;  4R10 A;  2NPP A;  4I2W A;  1UPL A;  4DBA A;  4YGX A;  4I7I A;  4B8P A;  3Q0S A;  3O2S A;  3VWA A;  4U54 A;  5EWP A;  3L6Y A;  1M8W A;  4PVZ A;  4LAC A;  4R11 A;  3VLF A;  3BVS A;  3UL1 B;  2IE4 A;  3FGA B;  5CLE A;  3ODR A;  1O6P A;  2IX3 A;  3UKY B;  4YI0 C;  4CRV B;  3L6X A;  5BZV A;  2C1M A;  3IBV A;  2JKT B;  4H3K A;  3JXZ A;  4A3T A;  1LSH A;  2BKU B;  1TH1 A;  3VLD A;  1HO8 A;  4ZDU A;  2X1G F;  5B56 A;  3BSX A;  4B8O A;  3Q5U A;  4I8M A;  4PLS A;  1TE4 A;  3TJZ B;  1I7X A;  4I37 A;  3GAE A;  1W63 A;  1BK6 A;  5EKF A;  4FQ3 A;  4L7M A;  4OO6 A;  3BX3 A;  1B3U A;  5SVZ A;  3ODS A;  2IWH A;  4OIH A;  4U5N A;  2NYM B;  3UKX B;  3JY1 A;  1Z2C B;  2PKG A;  3UJ0 A;  5KLT B;  4I2Z A;  5CL8 A;  4V3O A;  3LTJ A;  5H2X A;  4UAD A;  4EV9 A;  1U6G C;  4U3J C;  5JJA A;  4EVT A;  4UQI A;  1QGR A;  4D49 A;  4HNM A;  4FFB C;  4H3H A;  1QBK B;  1IAL A;  4HM9 A;  3ZIO A;  3KND A;  2RU4 A;  4U2X D;  4DVG B;  2X19 B;  3BTR C;  2H4M A;  4DJS A;  3BWT A;  1IB2 A;  4MFV A;  3PSP A;  4CT6 B;  1WA5 C;  3K5Z A;  4JW2 B;  1QGK A;  3V71 A;  1EJL I;  3GVT A;  2YNR A;  2Z5M A;  4V3Q A;  3GNI A;  3OBV A;  5KLR B;  1UKL A;  4MFU A;  4I6I A;  4TNM A;  4CRU B;  3TX7 A;  3NMZ A;  1XQS A;  4GMN A;  1EE5 A;  2VGL A;  1Q1S C;  5CL9 A;  4I5L A;  4CB9 A;  3K5Y A;  4HXT A;  3QGB A;  3L3F X;  3Q0M A;  5CLB A;  2YNS A;  2XA7 B;  3C2G A;  3WYF C;  4U58 A;  3FEY C;  3WPT A;  4FDD A;  3QML C;  3T7U A;  1M1E A;  3Q0L A;  5BZ1 A;  3L3Q A;  4Y5J A;  3T8S A;  2Q5D A;  5SWF A;  3ZIL A;  3QGC A;  3LTM A;  3ND2 A;  3VE6 A;  3C2H A;  3BCT A;  3FGA A;  5K6S A;  3RZX A;  3QG9 A;  1PJM B;  1JPW A;  3TT9 A;  3GQ2 A;  5HHG E;  4RV1 A;  2JKT A;  1IBR B;  3GB8 A;  5HUW C;  2BAP A;  1F59 A;  4CV5 B;  2PF4 A;  3Q0O A;  1UN0 A;  5H2W A;  2IW3 A;  4QMI A;  1W9C A;  2QNA A;  2Z5N A;  3UKZ B;  3PST A;  5CLA A;  1M8X A;  3DW8 A;  2JDQ A;  3Q0Q A;  3K5Q A;  4DB9 A;  4JLQ A;  3Q0N A;  3K61 A;  5D5K C;  5CL6 A;  1Y2A C;  3NOW A;  2Z6H A;  3K49 A;  2QK2 A;  4DB6 A;  2NYL B;  5E6Q B;  3JX7 A;  4I1E A;  3RZ9 A;  1XQR A;  5SW9 A;  5DN7 A;  3W3U A;  4P6Z B;  4R0Z A;  5CTT A;  3K7W A;  4K92 A;  2JKR B;  3O2T A;  3TPM A;  4WV6 A;  4I96 A;  1UPK A;  4KZG A;  4CB8 A;  3Q0R A;  3TPO A;  4RZP A;  3UJ4 A;  1LRV A;  4QMH A;  4A0C A;  4BPL A;  2Z5K A;  4MZ6 E;  3ZIQ A;  3NMW A;  2XOA A;  2NPP B;  5K9S A;  3A6P A;  2W3C A;  2F31 A;  5CL5 A;  1JPP A;  2OF3 A;  2VGL B;  5KL1 A;  3TJ3 A;  5BZU A;  1GCJ A;  4I5N A;  3QHE A;  3BX2 A;  2Z5O A;  2WTK A;  1G3J A;  3EBB A;  4CBA A;  4BA3 A;  1O6O A;  4MZ5 E;  5KLA A;  3OPB A;  5CL7 A;  5CL4 A;  1PJN B;  2IAE A;  4JW2 A;  3SLA A;  4DZS A;  1N4K A;  4EV8 A;  4IMJ A;  5CLC A;  2BCT A;  5KL8 A;  5J3V A;  4A3V A;  3V74 A;  4U5S A;  3EA5 B;  4NZW A;  4JW3 C;  1V18 A;  4U5O A;  4I0Y A;  3DAD A;  3OUW A;  4BQK A;  4B18 A;  1IQ1 C;  4K6J A;  5AEI A;  2DB0 A;  3K64 A;  5EKG A;  4PLR A;  3LWW A;  4DB8 A;  3K62 A;  2FV2 A;  3NMX A;  3WOZ A;  1W63 B;  4YK6 A;  2XA7 A;  4FP7 A;  4I2S A;  4QMJ A;  4YJE A;  2C1T A;  4B8J A;  3JXY A;  4EVP A;  1M8Y A;  3K4E A;  3WOY A;  1T08 A;  4L4I A;  3C5W A;  4JKQ A;  5FC8 E;  3UL0 B;  2Z5J A; 
#chains in the Genus database with same CATH homology
 4U5U A;  3ZIP A;  1EJY I;  4UAE A;  4D4E A;  5KUB A;  4U5L A;  2JAK A;  3AU3 A;  5BZ5 A;  2QK1 A;  3O2Q A;  1M8Z A;  4IMI A;  1LUJ A;  4E4V A;  4NEE A;  2OT8 A;  2YJY A;  3BSB A;  4P6Z G;  4UQI B;  1EE4 A;  4UWX A;  2Z6G A;  3OUX A;  4FZD A;  4V3R A;  3Q0P A;  3GRL A;  3UKW B;  4G3A A;  5CL3 A;  1WA5 B;  1BK5 A;  2NYM A;  4L4H A;  3EG5 B;  4ADY A;  4HTV A;  4UAF B;  3SL9 A;  4FZF A;  1QZ7 A;  2RU4 B;  3ZKV A;  2GL7 A;  4U5V A;  4EVA A;  5HUY C;  3ZIK A;  3UVU A;  2IE3 A;  3GVO A;  3O4X A;  3FEX C;  2NYL A;  4XZR B;  3IFQ A;  2QMR A;  4YJL A;  3H3D X;  4RXH B;  5BYM A;  2BNX A;  2JKR A;  1OYZ A;  4GMO A;  5CLD A;  1JDH A;  3V6Y A;  1XM9 A;  1I7W A;  3ZHP A;  4I3N A;  4O27 A;  3VLE A;  2IAE B;  2P8Q A;  4CT7 B;  1M5N S;  3OQS A;  4PLQ A;  5LSW A;  3ZIN A;  3K7V A;  1Q1T C;  3GS3 A;  3ZIR A;  4FZA A;  4R10 A;  2NPP A;  4I2W A;  1UPL A;  4DBA A;  4YGX A;  4I7I A;  4B8P A;  3Q0S A;  3O2S A;  3VWA A;  4U54 A;  5EWP A;  3L6Y A;  1M8W A;  4PVZ A;  4LAC A;  4R11 A;  3VLF A;  3BVS A;  3UL1 B;  2IE4 A;  3FGA B;  5CLE A;  3ODR A;  1O6P A;  2IX3 A;  3UKY B;  4YI0 C;  4CRV B;  3L6X A;  5BZV A;  2C1M A;  3IBV A;  2JKT B;  4H3K A;  3JXZ A;  4A3T A;  2BKU B;  1TH1 A;  3VLD A;  1HO8 A;  4ZDU A;  2X1G F;  5B56 A;  3BSX A;  4B8O A;  3Q5U A;  4I8M A;  4PLS A;  1TE4 A;  3TJZ B;  1I7X A;  4I37 A;  3GAE A;  1W63 A;  1BK6 A;  5EKF A;  4FQ3 A;  4L7M A;  4OO6 A;  3BX3 A;  1B3U A;  5SVZ A;  3ODS A;  2IWH A;  4OIH A;  4U5N A;  2NYM B;  3UKX B;  3JY1 A;  1Z2C B;  2PKG A;  5KLT B;  4I2Z A;  5CL8 A;  4V3O A;  3LTJ A;  5H2X A;  4UAD A;  4EV9 A;  1U6G C;  4U3J C;  5JJA A;  4EVT A;  4UQI A;  1QGR A;  4D49 A;  4HNM A;  4FFB C;  4H3H A;  1QBK B;  1IAL A;  4HM9 A;  3ZIO A;  3KND A;  2RU4 A;  4U2X D;  4DVG B;  2X19 B;  3BTR C;  2H4M A;  4DJS A;  3BWT A;  1IB2 A;  4MFV A;  3PSP A;  4CT6 B;  1WA5 C;  3K5Z A;  4JW2 B;  1QGK A;  3V71 A;  1EJL I;  3GVT A;  2YNR A;  2Z5M A;  4V3Q A;  3GNI A;  3OBV A;  5KLR B;  1UKL A;  4MFU A;  4I6I A;  4TNM A;  4CRU B;  3TX7 A;  3NMZ A;  1XQS A;  4GMN A;  1EE5 A;  2VGL A;  1Q1S C;  5CL9 A;  4I5L A;  4CB9 A;  3K5Y A;  4HXT A;  3QGB A;  3L3F X;  3Q0M A;  5CLB A;  2YNS A;  2XA7 B;  3C2G A;  3WYF C;  4U58 A;  3FEY C;  3WPT A;  4FDD A;  3QML C;  3T7U A;  1M1E A;  3Q0L A;  5BZ1 A;  3L3Q A;  4Y5J A;  3ZIL A;  2Q5D A;  5SWF A;  3QGC A;  3LTM A;  3ND2 A;  3VE6 A;  3C2H A;  3BCT A;  3FGA A;  5K6S A;  3RZX A;  3QG9 A;  1PJM B;  1JPW A;  3TT9 A;  3GQ2 A;  5HHG E;  4RV1 A;  2JKT A;  1IBR B;  3GB8 A;  5HUW C;  2BAP A;  1F59 A;  4CV5 B;  2PF4 A;  3Q0O A;  1UN0 A;  5H2W A;  2IW3 A;  4QMI A;  1W9C A;  2QNA A;  2Z5N A;  3UKZ B;  3PST A;  5CLA A;  1M8X A;  3DW8 A;  2JDQ A;  3Q0Q A;  3K5Q A;  4DB9 A;  4JLQ A;  3Q0N A;  3K61 A;  5D5K C;  5CL6 A;  1Y2A C;  3NOW A;  2Z6H A;  3K49 A;  2QK2 A;  4DB6 A;  2NYL B;  5E6Q B;  3JX7 A;  4I1E A;  3RZ9 A;  1XQR A;  5SW9 A;  5DN7 A;  3W3U A;  4P6Z B;  4R0Z A;  5CTT A;  3K7W A;  4K92 A;  2JKR B;  3O2T A;  3TPM A;  4WV6 A;  4I96 A;  1UPK A;  4KZG A;  4CB8 A;  3Q0R A;  3TPO A;  4RZP A;  1LRV A;  4QMH A;  4A0C A;  4BPL A;  2Z5K A;  4MZ6 E;  3ZIQ A;  3NMW A;  2XOA A;  2NPP B;  5K9S A;  3A6P A;  2W3C A;  2F31 A;  5CL5 A;  1JPP A;  2OF3 A;  2VGL B;  5KL1 A;  3TJ3 A;  5BZU A;  1GCJ A;  4I5N A;  3QHE A;  3BX2 A;  2Z5O A;  2WTK A;  1G3J A;  3EBB A;  4CBA A;  4BA3 A;  1O6O A;  4MZ5 E;  5KLA A;  3OPB A;  5CL7 A;  5CL4 A;  1PJN B;  2IAE A;  4JW2 A;  3SLA A;  4DZS A;  4EV8 A;  4IMJ A;  5CLC A;  2BCT A;  5KL8 A;  5J3V A;  4A3V A;  3V74 A;  4U5S A;  3EA5 B;  4NZW A;  4JW3 C;  1V18 A;  4U5O A;  4I0Y A;  3DAD A;  3OUW A;  4BQK A;  4B18 A;  1IQ1 C;  4K6J A;  5AEI A;  2DB0 A;  3K64 A;  5EKG A;  4PLR A;  3LWW A;  4DB8 A;  3K62 A;  2FV2 A;  3NMX A;  3WOZ A;  1W63 B;  4YK6 A;  2XA7 A;  4FP7 A;  4I2S A;  4QMJ A;  4YJE A;  2C1T A;  4B8J A;  3JXY A;  4EVP A;  1M8Y A;  3K4E A;  3WOY A;  1T08 A;  4L4I A;  3C5W A;  4JKQ A;  5FC8 E;  3UL0 B;  2Z5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...