4PLSA

Crystal structures of designed armadillo repeat proteins: implications of construct design and crystallization conditions on overall structure.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
280
structure length
280
Chain Sequence
ELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWTLGNIASGGNEQKQAVKEAGAEPALEQLQSSPNEKIQKEAQEALEKIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding protein
molecule keywords Arm00010
publication title Crystal Structures of Designed Armadillo Repeat Proteins: Implications of Construct Design and Crystallization Conditions on Overall Structure.
pubmed doi rcsb
source organism Synthetic construct
total genus 107
structure length 280
sequence length 280
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 4plsA00
1UPLA 1JPWA 3C5WA 1WA5B 4MFUA 4UQIB 4CB8A 2GL7A 3ZIOA 2IE4A 4U5LA 3WOYA 1I7WA 1XQRA 1IB2A 4KZGA 4CT6B 3OBVA 2BNXA 5SWFA 4PVZA 4BPLA 4ADYA 5BYMA 3BCTA 4PLQA 1QZ7A 1UPKA 1HO8A 4JLQA 3EA5B 3GRLA 4G3AA 3UL1B 3WYFC 5FC8E 5H2WA 4CT7B 1PJNB 4L7MA 5D5KC 4TNMA 1EE4A 3BWTA 5EWPA 3Q0QA 1LUJA 1M8XA 3FEYC 1IALA 3ODRA 2NPPA 5LSWA 2QNAA 3BSXA 5B56A 1OYZA 4XZRB 4FZFA 3QMLC 4DVGB 1W9CA 3ZHPA 3UVUA 4NZWA 2Z5MA 4BA3A 4UADA 4BQKA 3DADA 3OUWA 5J3VA 2OF3A 3GB8A 3ODSA 4EVTA 1F59A 2NYMB 3LTMA 3EBBA 3WOZA 1JPPA 1O6PA 4CB9A 4U5OA 3O2TA 3BX3A 3OUXA 4HM9A 3Q0OA 4U5NA 1M1EA 3TX7A 2JKTB 2Z6GA 4LACA 1WA5C 4MFVA 4O27A 2Z5KA 2JKTA 4HXTA 3TJ3A 3O2SA 1XM9A 3FEXC 5EKFA 4WV6A 4P6ZG 2XA7A 5BZVA 1W63A 1Q1SC 1QGKA 3WPTA 3C2HA 1I7XA 2VGLA 1EJYI 3K64A 3IBVA 4HNMA 4DZSA 4U5SA 2W3CA 3Q0LA 4EVPA 3Q0NA 3UKXB 4EVAA 1IBRB 3K7WA 2PF4A 2FV2A 5E6QB 2YNRA 3V74A 3ND2A 4R0ZA 4UQIA 1PJMB 4DB6A 3VWAA 4HTVA 4CBAA 1QBKB 4V3QA 4OO6A 3GS3A 4P6ZB 1Q1TC 3TT9A 4GMNA 3L6YA 4ZDUA 4DB8A 1U6GC 3A6PA 4A0CA 1GCJA 1V18A 4QMHA 4MZ5E 3NOWA 5KLRB 5K9SA 1TH1A 4U3JC 3AU3A 3K5QA 2IW3A 4YI0C 2RU4B 3O4XA 1XQSA 4B8JA 3GQ2A 4R10A 4FZAA 2X19B 5KL1A 4D49A 1JDHA 4UAFB 2IAEB 3FGAB 4V3OA 2Z6HA 3Q0PA 2BAPA 2X1GF 2BKUB 3TPMA 4R11A 2IE3A 3FGAA 4I2ZA 4B8OA 3KNDA 4U5UA 2C1TA 2YJYA 2Q5DA 3V71A 4V3RA 5KL8A 3LWWA 2NYMA 2IWHA 3DW8A 2P8QA 3UKYB 3NMXA 4RZPA 3PSPA 3BX2A 3ZIQA 3RZ9A 3OQSA 3L3QA 5H2XA 5AEIA 5DN7A 2QK1A 4EV9A 3UKZB 4K92A 4YGXA 2JKRB 5HUYC 3K5YA 1BK6A 3UKWB 1QGRA 1IQ1C 2NYLB 5JJAA 1LRVA 3OPBA 1G3JA 2Z5JA 4GMOA 4EV8A 3BTRC 3T7UA 1UKLA 4YK6A 1M8YA 3QGBA 4NEEA 5BZUA 4UWXA 4Y5JA 2OT8A 3RZXA 3K62A 3PSTA 4PLSA 2WTKA 5BZ5A 4D4EA 4QMJA 4CRUB 3L3FX 3Q0MA 4U54A 3TJZB 3K4EA 3K5ZA 4H3KA 4QMIA 3NMWA 3H3DX 5HUWC 5KLTB 3IFQA 2BCTA 1EJLI 4B8PA 5CTTA 2F31A 1T08A 1EE5A 3O2QA 3GAEA 4K6JA 3K7VA 3K61A 3Q5UA 5KLAA 4DB9A 2C1MA 3C2GA 4YJEA 4PLRA 4DBAA 2RU4A 2NPPB 3EG5B 3ZIRA 4JW2B 3ZIPA 1M8WA 4FDDA 4I2WA 4CRVB 4U58A 4IMJA 5SVZA 4B18A 4IMIA 2PKGA 5EKGA 5K6SA 2IAEA 4FQ3A 3UL0B 2QMRA 4DJSA 3GVOA 1M8ZA 4OIHA 3TPOA 5SW9A 1Y2AC 5HHGE 1B3UA 2Z5NA 3QGCA 2Z5OA 3VE6A 2H4MA 4E4VA 2DB0A 3V6YA 3ZINA 3GVTA 3Q0SA 5BZ1A 2JAKA 2JDQA 3LTJA 4FZDA 4RXHB 3K49A 4U5VA 4MZ6E 4CV5B 3NMZA 1BK5A 4FFBC 2JKRA 3BSBA 1UN0A 2QK2A 3GNIA 4RV1A 3W3UA 4YJLA 2IX3A 4H3HA 2NYLA 2XA7B 4I5LA 1W63B 3Q0RA 2VGLB 1O6OA 3QG9A 3L6XA 1M5NS 3ZKVA 4UAEA 3QHEA 1Z2CB 4I5NA 2YNSA
chains in the Genus database with same CATH superfamily
1UPLA 1JPWA 3C5WA 1WA5B 4MFUA 4UQIB 4CB8A 2GL7A 3ZIOA 2IE4A 4U5LA 3WOYA 1I7WA 1XQRA 1IB2A 4KZGA 4CT6B 3OBVA 2BNXA 5SWFA 4PVZA 4BPLA 4ADYA 5BYMA 3BCTA 3VLFA 4PLQA 1QZ7A 3VLDA 1UPKA 1HO8A 4JLQA 3EA5B 3GRLA 4G3AA 3UL1B 3BVSA 3WYFC 5FC8E 5H2WA 4CT7B 1PJNB 4L7MA 5D5KC 3UJ4A 4TNMA 1EE4A 3BWTA 5EWPA 3Q0QA 1LUJA 1M8XA 3FEYC 1IALA 3ODRA 2NPPA 4L4HA 4JW2A 5LSWA 2QNAA 3BSXA 5B56A 1OYZA 4XZRB 4FZFA 4FP7A 3QMLC 4DVGB 1W9CA 3ZHPA 3UVUA 4NZWA 2Z5MA 4BA3A 4UADA 4BQKA 3DADA 3OUWA 5J3VA 2OF3A 3GB8A 3ODSA 4EVTA 1F59A 2NYMB 3LTMA 3EBBA 5CLBA 3WOZA 3VLEA 1JPPA 1O6PA 4CB9A 4U5OA 3O2TA 3BX3A 3OUXA 4L4IA 5CL5A 4HM9A 3Q0OA 1LSHA 4U5NA 1M1EA 3TX7A 2JKTB 2Z6GA 4LACA 1WA5C 4MFVA 3JX7A 4I96A 4O27A 2Z5KA 2JKTA 4HXTA 3TJ3A 4A3VA 3O2SA 1XM9A 3FEXC 5EKFA 4WV6A 4P6ZG 2XA7A 5BZVA 1W63A 1Q1SC 4I8MA 1QGKA 3WPTA 3JY1A 3C2HA 1I7XA 2VGLA 1EJYI 3K64A 3IBVA 4HNMA 4DZSA 3T8SA 4U5SA 2W3CA 3Q0LA 4EVPA 3Q0NA 3UKXB 4EVAA 1IBRB 3K7WA 2PF4A 2FV2A 5E6QB 2YNRA 3V74A 3ND2A 4R0ZA 4UQIA 1PJMB 4DB6A 3VWAA 4HTVA 4JW3C 4CBAA 1QBKB 4V3QA 4OO6A 3GS3A 4P6ZB 1Q1TC 3TT9A 4GMNA 3L6YA 4ZDUA 4DB8A 1U6GC 3A6PA 4A0CA 1GCJA 1V18A 4QMHA 4MZ5E 3NOWA 5KLRB 5K9SA 1TH1A 4U3JC 3AU3A 3K5QA 5CLAA 2IW3A 4I2SA 4YI0C 2RU4B 3O4XA 1XQSA 4B8JA 3GQ2A 4R10A 4FZAA 2X19B 5KL1A 4D49A 1JDHA 4UAFB 2IAEB 3FGAB 5CLEA 4V3OA 2Z6HA 3Q0PA 2BAPA 2X1GF 2BKUB 3TPMA 4R11A 2IE3A 3FGAA 4I2ZA 4B8OA 3KNDA 4U5UA 2C1TA 2YJYA 5CL6A 2Q5DA 1N4KA 5KUBA 3V71A 4V3RA 5KL8A 3LWWA 2NYMA 2IWHA 3DW8A 2P8QA 3UKYB 3NMXA 4RZPA 3PSPA 3BX2A 3ZIQA 3RZ9A 3OQSA 3L3QA 5H2XA 5AEIA 5DN7A 2QK1A 4EV9A 3UKZB 4I1EA 4K92A 4YGXA 2JKRB 5HUYC 3K5YA 1BK6A 3UKWB 4JKQA 1QGRA 1IQ1C 2NYLB 5JJAA 1LRVA 3OPBA 1G3JA 2Z5JA 4GMOA 4EV8A 3BTRC 3T7UA 3JXYA 1UKLA 4YK6A 1M8YA 3QGBA 4NEEA 5BZUA 4UWXA 4Y5JA 2OT8A 3RZXA 4I6IA 3K62A 3PSTA 4PLSA 2WTKA 5BZ5A 5CLCA 4D4EA 4QMJA 4CRUB 3L3FX 3Q0MA 4I7IA 3ZILA 4U54A 3TJZB 3K4EA 3K5ZA 4H3KA 4QMIA 3NMWA 3H3DX 5HUWC 5KLTB 3IFQA 2BCTA 1EJLI 4B8PA 5CLDA 5CTTA 2F31A 1T08A 1EE5A 3O2QA 3ZIKA 3GAEA 4I0YA 4K6JA 3K7VA 3K61A 3Q5UA 5KLAA 4DB9A 2C1MA 3C2GA 5CL9A 4YJEA 5CL4A 4PLRA 4DBAA 2RU4A 2NPPB 3EG5B 3ZIRA 4JW2B 2XOAA 3ZIPA 1M8WA 4FDDA 4I2WA 4CRVB 4U58A 4IMJA 5SVZA 4B18A 4IMIA 2PKGA 5EKGA 5K6SA 2IAEA 4FQ3A 3UL0B 2QMRA 4DJSA 3GVOA 1M8ZA 4OIHA 5CL8A 3TPOA 5SW9A 5CL3A 1Y2AC 5HHGE 1B3UA 2Z5NA 3QGCA 2Z5OA 3VE6A 2H4MA 4E4VA 2DB0A 3SLAA 3V6YA 3ZINA 1TE4A 3GVTA 3Q0SA 5BZ1A 2JAKA 2JDQA 3LTJA 4FZDA 4RXHB 4I3NA 3K49A 4U5VA 4MZ6E 4U2XD 4CV5B 3NMZA 1BK5A 4FFBC 3SL9A 2JKRA 3BSBA 1UN0A 2QK2A 3GNIA 4RV1A 5CL7A 4I37A 3W3UA 4YJLA 3UJ0A 2IX3A 4H3HA 2NYLA 2XA7B 4I5LA 1W63B 3Q0RA 2VGLB 3JXZA 1O6OA 3QG9A 3L6XA 4A3TA 1M5NS 3ZKVA 4UAEA 3QHEA 1Z2CB 4I5NA 2YNSA
chains in the Genus database with same CATH topology
1UPLA 1JPWA 3C5WA 1WA5B 4MFUA 4UQIB 4CB8A 2GL7A 3ZIOA 2IE4A 4U5LA 3WOYA 1I7WA 1XQRA 1IB2A 4KZGA 4CT6B 3OBVA 2BNXA 5SWFA 4PVZA 4BPLA 4ADYA 5BYMA 3BCTA 3VLFA 4PLQA 1QZ7A 3VLDA 1UPKA 1HO8A 4JLQA 3EA5B 3GRLA 4G3AA 3UL1B 3BVSA 3WYFC 5FC8E 5H2WA 4CT7B 1PJNB 4L7MA 5D5KC 4TNMA 1EE4A 3BWTA 5EWPA 3Q0QA 1LUJA 1M8XA 3FEYC 1IALA 3ODRA 2NPPA 4L4HA 4JW2A 5LSWA 2QNAA 3BSXA 5B56A 1OYZA 4XZRB 4FZFA 4FP7A 3QMLC 4DVGB 1W9CA 3ZHPA 3UVUA 4NZWA 2Z5MA 4BA3A 4UADA 4BQKA 3DADA 3OUWA 5J3VA 2OF3A 3GB8A 3ODSA 4EVTA 1F59A 2NYMB 3LTMA 3EBBA 5CLBA 3WOZA 3VLEA 1JPPA 1O6PA 4CB9A 4U5OA 3O2TA 3BX3A 3OUXA 4L4IA 5CL5A 4HM9A 3Q0OA 4U5NA 1M1EA 3TX7A 2JKTB 2Z6GA 4LACA 1WA5C 4MFVA 3JX7A 4I96A 4O27A 2Z5KA 2JKTA 4HXTA 3TJ3A 4A3VA 3O2SA 1XM9A 3FEXC 5EKFA 4WV6A 4P6ZG 2XA7A 5BZVA 1W63A 1Q1SC 4I8MA 1QGKA 3WPTA 3JY1A 3C2HA 1I7XA 2VGLA 1EJYI 3K64A 3IBVA 4HNMA 4DZSA 4U5SA 2W3CA 3Q0LA 4EVPA 3Q0NA 3UKXB 4EVAA 1IBRB 3K7WA 2PF4A 2FV2A 5E6QB 2YNRA 3V74A 3ND2A 4R0ZA 4UQIA 1PJMB 4DB6A 3VWAA 4HTVA 4JW3C 4CBAA 1QBKB 4V3QA 4OO6A 3GS3A 4P6ZB 1Q1TC 3TT9A 4GMNA 3L6YA 4ZDUA 4DB8A 1U6GC 3A6PA 4A0CA 1GCJA 1V18A 4QMHA 4MZ5E 3NOWA 5KLRB 5K9SA 1TH1A 4U3JC 3AU3A 3K5QA 5CLAA 2IW3A 4I2SA 4YI0C 2RU4B 3O4XA 1XQSA 4B8JA 3GQ2A 4R10A 4FZAA 2X19B 5KL1A 4D49A 1JDHA 4UAFB 2IAEB 3FGAB 5CLEA 4V3OA 2Z6HA 3Q0PA 2BAPA 2X1GF 2BKUB 3TPMA 4R11A 2IE3A 3FGAA 4I2ZA 4B8OA 3KNDA 4U5UA 2C1TA 2YJYA 5CL6A 2Q5DA 3V71A 5KUBA 4V3RA 5KL8A 3LWWA 2NYMA 2IWHA 3DW8A 2P8QA 3UKYB 3NMXA 4RZPA 3PSPA 3BX2A 3ZIQA 3RZ9A 3OQSA 3L3QA 5H2XA 5AEIA 5DN7A 2QK1A 4EV9A 3UKZB 4I1EA 4K92A 4YGXA 2JKRB 5HUYC 3K5YA 1BK6A 3UKWB 4JKQA 1QGRA 1IQ1C 2NYLB 5JJAA 1LRVA 3OPBA 1G3JA 2Z5JA 4GMOA 4EV8A 3BTRC 3T7UA 3JXYA 1UKLA 4YK6A 1M8YA 3QGBA 4NEEA 5BZUA 4UWXA 4Y5JA 2OT8A 3RZXA 4I6IA 3K62A 3PSTA 4PLSA 2WTKA 5BZ5A 5CLCA 4D4EA 4QMJA 4CRUB 3L3FX 3Q0MA 4I7IA 3ZILA 4U54A 3TJZB 3K4EA 3K5ZA 4H3KA 4QMIA 3NMWA 3H3DX 5HUWC 5KLTB 3IFQA 2BCTA 1EJLI 4B8PA 5CLDA 5CTTA 2F31A 1T08A 1EE5A 3O2QA 3ZIKA 3GAEA 4I0YA 4K6JA 3K7VA 3K61A 3Q5UA 5KLAA 4DB9A 2C1MA 3C2GA 5CL9A 4YJEA 5CL4A 4PLRA 4DBAA 2RU4A 2NPPB 3EG5B 3ZIRA 4JW2B 2XOAA 3ZIPA 1M8WA 4FDDA 4I2WA 4CRVB 4U58A 4IMJA 5SVZA 4B18A 4IMIA 2PKGA 5EKGA 5K6SA 2IAEA 4FQ3A 3UL0B 2QMRA 4DJSA 3GVOA 1M8ZA 4OIHA 5CL8A 3TPOA 5SW9A 5CL3A 1Y2AC 5HHGE 1B3UA 2Z5NA 3QGCA 2Z5OA 3VE6A 2H4MA 4E4VA 2DB0A 3SLAA 3V6YA 3ZINA 1TE4A 3GVTA 3Q0SA 5BZ1A 2JAKA 2JDQA 3LTJA 4FZDA 4RXHB 4I3NA 3K49A 4U5VA 4MZ6E 4U2XD 4CV5B 3NMZA 1BK5A 4FFBC 3SL9A 2JKRA 3BSBA 1UN0A 2QK2A 3GNIA 4RV1A 5CL7A 4I37A 3W3UA 4YJLA 2IX3A 4H3HA 2NYLA 2XA7B 4I5LA 1W63B 3Q0RA 2VGLB 3JXZA 1O6OA 3QG9A 3L6XA 4A3TA 1M5NS 3ZKVA 4UAEA 3QHEA 1Z2CB 4I5NA 2YNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UPL A;  1JPW A;  3C5W A;  1WA5 B;  4MFU A;  4UQI B;  4CB8 A;  2GL7 A;  3ZIO A;  2IE4 A;  4U5L A;  3WOY A;  1I7W A;  1XQR A;  1IB2 A;  4KZG A;  4CT6 B;  3OBV A;  2BNX A;  5SWF A;  4PVZ A;  4BPL A;  4ADY A;  5BYM A;  3BCT A;  4PLQ A;  1QZ7 A;  1UPK A;  1HO8 A;  4JLQ A;  3EA5 B;  3GRL A;  4G3A A;  3UL1 B;  3WYF C;  5FC8 E;  5H2W A;  4CT7 B;  1PJN B;  4L7M A;  5D5K C;  4TNM A;  1EE4 A;  3BWT A;  5EWP A;  3Q0Q A;  1LUJ A;  1M8X A;  3FEY C;  1IAL A;  3ODR A;  2NPP A;  5LSW A;  2QNA A;  3BSX A;  5B56 A;  1OYZ A;  4XZR B;  4FZF A;  3QML C;  4DVG B;  1W9C A;  3ZHP A;  3UVU A;  4NZW A;  2Z5M A;  4BA3 A;  4UAD A;  4BQK A;  3DAD A;  3OUW A;  5J3V A;  2OF3 A;  3GB8 A;  3ODS A;  4EVT A;  1F59 A;  2NYM B;  3LTM A;  3EBB A;  3WOZ A;  1JPP A;  1O6P A;  4CB9 A;  4U5O A;  3O2T A;  3BX3 A;  3OUX A;  4HM9 A;  3Q0O A;  4U5N A;  1M1E A;  3TX7 A;  2JKT B;  2Z6G A;  4LAC A;  1WA5 C;  4MFV A;  4O27 A;  2Z5K A;  2JKT A;  4HXT A;  3TJ3 A;  3O2S A;  1XM9 A;  3FEX C;  5EKF A;  4WV6 A;  4P6Z G;  2XA7 A;  5BZV A;  1W63 A;  1Q1S C;  1QGK A;  3WPT A;  3C2H A;  1I7X A;  2VGL A;  1EJY I;  3K64 A;  3IBV A;  4HNM A;  4DZS A;  4U5S A;  2W3C A;  3Q0L A;  4EVP A;  3Q0N A;  3UKX B;  4EVA A;  1IBR B;  3K7W A;  2PF4 A;  2FV2 A;  5E6Q B;  2YNR A;  3V74 A;  3ND2 A;  4R0Z A;  4UQI A;  1PJM B;  4DB6 A;  3VWA A;  4HTV A;  4CBA A;  1QBK B;  4V3Q A;  4OO6 A;  3GS3 A;  4P6Z B;  1Q1T C;  3TT9 A;  4GMN A;  3L6Y A;  4ZDU A;  4DB8 A;  1U6G C;  3A6P A;  4A0C A;  1GCJ A;  1V18 A;  4QMH A;  4MZ5 E;  3NOW A;  5KLR B;  5K9S A;  1TH1 A;  4U3J C;  3AU3 A;  3K5Q A;  2IW3 A;  4YI0 C;  2RU4 B;  3O4X A;  1XQS A;  4B8J A;  3GQ2 A;  4R10 A;  4FZA A;  2X19 B;  5KL1 A;  4D49 A;  1JDH A;  4UAF B;  2IAE B;  3FGA B;  4V3O A;  2Z6H A;  3Q0P A;  2BAP A;  2X1G F;  2BKU B;  3TPM A;  4R11 A;  2IE3 A;  3FGA A;  4I2Z A;  4B8O A;  3KND A;  4U5U A;  2C1T A;  2YJY A;  2Q5D A;  3V71 A;  4V3R A;  5KL8 A;  3LWW A;  2NYM A;  2IWH A;  3DW8 A;  2P8Q A;  3UKY B;  3NMX A;  4RZP A;  3PSP A;  3BX2 A;  3ZIQ A;  3RZ9 A;  3OQS A;  3L3Q A;  5H2X A;  5AEI A;  5DN7 A;  2QK1 A;  4EV9 A;  3UKZ B;  4K92 A;  4YGX A;  2JKR B;  5HUY C;  3K5Y A;  1BK6 A;  3UKW B;  1QGR A;  1IQ1 C;  2NYL B;  5JJA A;  1LRV A;  3OPB A;  1G3J A;  2Z5J A;  4GMO A;  4EV8 A;  3BTR C;  3T7U A;  1UKL A;  4YK6 A;  1M8Y A;  3QGB A;  4NEE A;  5BZU A;  4UWX A;  4Y5J A;  2OT8 A;  3RZX A;  3K62 A;  3PST A;  4PLS A;  2WTK A;  5BZ5 A;  4D4E A;  4QMJ A;  4CRU B;  3L3F X;  3Q0M A;  4U54 A;  3TJZ B;  3K4E A;  3K5Z A;  4H3K A;  4QMI A;  3NMW A;  3H3D X;  5HUW C;  5KLT B;  3IFQ A;  2BCT A;  1EJL I;  4B8P A;  5CTT A;  2F31 A;  1T08 A;  1EE5 A;  3O2Q A;  3GAE A;  4K6J A;  3K7V A;  3K61 A;  3Q5U A;  5KLA A;  4DB9 A;  2C1M A;  3C2G A;  4YJE A;  4PLR A;  4DBA A;  2RU4 A;  2NPP B;  3EG5 B;  3ZIR A;  4JW2 B;  3ZIP A;  1M8W A;  4FDD A;  4I2W A;  4CRV B;  4U58 A;  4IMJ A;  5SVZ A;  4B18 A;  4IMI A;  2PKG A;  5EKG A;  5K6S A;  2IAE A;  4FQ3 A;  3UL0 B;  2QMR A;  4DJS A;  3GVO A;  1M8Z A;  4OIH A;  3TPO A;  5SW9 A;  1Y2A C;  5HHG E;  1B3U A;  2Z5N A;  3QGC A;  2Z5O A;  3VE6 A;  2H4M A;  4E4V A;  2DB0 A;  3V6Y A;  3ZIN A;  3GVT A;  3Q0S A;  5BZ1 A;  2JAK A;  2JDQ A;  3LTJ A;  4FZD A;  4RXH B;  3K49 A;  4U5V A;  4MZ6 E;  4CV5 B;  3NMZ A;  1BK5 A;  4FFB C;  2JKR A;  3BSB A;  1UN0 A;  2QK2 A;  3GNI A;  4RV1 A;  3W3U A;  4YJL A;  2IX3 A;  4H3H A;  2NYL A;  2XA7 B;  4I5L A;  1W63 B;  3Q0R A;  2VGL B;  1O6O A;  3QG9 A;  3L6X A;  1M5N S;  3ZKV A;  4UAE A;  3QHE A;  1Z2C B;  4I5N A;  2YNS A; 
#chains in the Genus database with same CATH topology
 1UPL A;  1JPW A;  3C5W A;  1WA5 B;  4MFU A;  4UQI B;  4CB8 A;  2GL7 A;  3ZIO A;  2IE4 A;  4U5L A;  3WOY A;  1I7W A;  1XQR A;  1IB2 A;  4KZG A;  4CT6 B;  3OBV A;  2BNX A;  5SWF A;  4PVZ A;  4BPL A;  4ADY A;  5BYM A;  3BCT A;  3VLF A;  4PLQ A;  1QZ7 A;  3VLD A;  1UPK A;  1HO8 A;  4JLQ A;  3EA5 B;  3GRL A;  4G3A A;  3UL1 B;  3BVS A;  3WYF C;  5FC8 E;  5H2W A;  4CT7 B;  1PJN B;  4L7M A;  5D5K C;  3UJ4 A;  4TNM A;  1EE4 A;  3BWT A;  5EWP A;  3Q0Q A;  1LUJ A;  1M8X A;  3FEY C;  1IAL A;  3ODR A;  2NPP A;  4L4H A;  4JW2 A;  5LSW A;  2QNA A;  3BSX A;  5B56 A;  1OYZ A;  4XZR B;  4FZF A;  4FP7 A;  3QML C;  4DVG B;  1W9C A;  3ZHP A;  3UVU A;  4NZW A;  2Z5M A;  4BA3 A;  4UAD A;  4BQK A;  3DAD A;  3OUW A;  5J3V A;  2OF3 A;  3GB8 A;  3ODS A;  4EVT A;  1F59 A;  2NYM B;  3LTM A;  3EBB A;  5CLB A;  3WOZ A;  3VLE A;  1JPP A;  1O6P A;  4CB9 A;  4U5O A;  3O2T A;  3BX3 A;  3OUX A;  4L4I A;  5CL5 A;  4HM9 A;  3Q0O A;  1LSH A;  4U5N A;  1M1E A;  3TX7 A;  2JKT B;  2Z6G A;  4LAC A;  1WA5 C;  4MFV A;  3JX7 A;  4I96 A;  4O27 A;  2Z5K A;  2JKT A;  4HXT A;  3TJ3 A;  4A3V A;  3O2S A;  1XM9 A;  3FEX C;  5EKF A;  4WV6 A;  4P6Z G;  2XA7 A;  5BZV A;  1W63 A;  1Q1S C;  4I8M A;  1QGK A;  3WPT A;  3JY1 A;  3C2H A;  1I7X A;  2VGL A;  1EJY I;  3K64 A;  3IBV A;  4HNM A;  4DZS A;  3T8S A;  4U5S A;  2W3C A;  3Q0L A;  4EVP A;  3Q0N A;  3UKX B;  4EVA A;  1IBR B;  3K7W A;  2PF4 A;  2FV2 A;  5E6Q B;  2YNR A;  3V74 A;  3ND2 A;  4R0Z A;  4UQI A;  1PJM B;  4DB6 A;  3VWA A;  4HTV A;  4JW3 C;  4CBA A;  1QBK B;  4V3Q A;  4OO6 A;  3GS3 A;  4P6Z B;  1Q1T C;  3TT9 A;  4GMN A;  3L6Y A;  4ZDU A;  4DB8 A;  1U6G C;  3A6P A;  4A0C A;  1GCJ A;  1V18 A;  4QMH A;  4MZ5 E;  3NOW A;  5KLR B;  5K9S A;  1TH1 A;  4U3J C;  3AU3 A;  3K5Q A;  5CLA A;  2IW3 A;  4I2S A;  4YI0 C;  2RU4 B;  3O4X A;  1XQS A;  4B8J A;  3GQ2 A;  4R10 A;  4FZA A;  2X19 B;  5KL1 A;  4D49 A;  1JDH A;  4UAF B;  2IAE B;  3FGA B;  5CLE A;  4V3O A;  2Z6H A;  3Q0P A;  2BAP A;  2X1G F;  2BKU B;  3TPM A;  4R11 A;  2IE3 A;  3FGA A;  4I2Z A;  4B8O A;  3KND A;  4U5U A;  2C1T A;  2YJY A;  5CL6 A;  2Q5D A;  1N4K A;  5KUB A;  3V71 A;  4V3R A;  5KL8 A;  3LWW A;  2NYM A;  2IWH A;  3DW8 A;  2P8Q A;  3UKY B;  3NMX A;  4RZP A;  3PSP A;  3BX2 A;  3ZIQ A;  3RZ9 A;  3OQS A;  3L3Q A;  5H2X A;  5AEI A;  5DN7 A;  2QK1 A;  4EV9 A;  3UKZ B;  4I1E A;  4K92 A;  4YGX A;  2JKR B;  5HUY C;  3K5Y A;  1BK6 A;  3UKW B;  4JKQ A;  1QGR A;  1IQ1 C;  2NYL B;  5JJA A;  1LRV A;  3OPB A;  1G3J A;  2Z5J A;  4GMO A;  4EV8 A;  3BTR C;  3T7U A;  3JXY A;  1UKL A;  4YK6 A;  1M8Y A;  3QGB A;  4NEE A;  5BZU A;  4UWX A;  4Y5J A;  2OT8 A;  3RZX A;  4I6I A;  3K62 A;  3PST A;  4PLS A;  2WTK A;  5BZ5 A;  5CLC A;  4D4E A;  4QMJ A;  4CRU B;  3L3F X;  3Q0M A;  4I7I A;  3ZIL A;  4U54 A;  3TJZ B;  3K4E A;  3K5Z A;  4H3K A;  4QMI A;  3NMW A;  3H3D X;  5HUW C;  5KLT B;  3IFQ A;  2BCT A;  1EJL I;  4B8P A;  5CLD A;  5CTT A;  2F31 A;  1T08 A;  1EE5 A;  3O2Q A;  3ZIK A;  3GAE A;  4I0Y A;  4K6J A;  3K7V A;  3K61 A;  3Q5U A;  5KLA A;  4DB9 A;  2C1M A;  3C2G A;  5CL9 A;  4YJE A;  5CL4 A;  4PLR A;  4DBA A;  2RU4 A;  2NPP B;  3EG5 B;  3ZIR A;  4JW2 B;  2XOA A;  3ZIP A;  1M8W A;  4FDD A;  4I2W A;  4CRV B;  4U58 A;  4IMJ A;  5SVZ A;  4B18 A;  4IMI A;  2PKG A;  5EKG A;  5K6S A;  2IAE A;  4FQ3 A;  3UL0 B;  2QMR A;  4DJS A;  3GVO A;  1M8Z A;  4OIH A;  5CL8 A;  3TPO A;  5SW9 A;  5CL3 A;  1Y2A C;  5HHG E;  1B3U A;  2Z5N A;  3QGC A;  2Z5O A;  3VE6 A;  2H4M A;  4E4V A;  2DB0 A;  3SLA A;  3V6Y A;  3ZIN A;  1TE4 A;  3GVT A;  3Q0S A;  5BZ1 A;  2JAK A;  2JDQ A;  3LTJ A;  4FZD A;  4RXH B;  4I3N A;  3K49 A;  4U5V A;  4MZ6 E;  4U2X D;  4CV5 B;  3NMZ A;  1BK5 A;  4FFB C;  3SL9 A;  2JKR A;  3BSB A;  1UN0 A;  2QK2 A;  3GNI A;  4RV1 A;  5CL7 A;  4I37 A;  3W3U A;  4YJL A;  3UJ0 A;  2IX3 A;  4H3H A;  2NYL A;  2XA7 B;  4I5L A;  1W63 B;  3Q0R A;  2VGL B;  3JXZ A;  1O6O A;  3QG9 A;  3L6X A;  4A3T A;  1M5N S;  3ZKV A;  4UAE A;  3QHE A;  1Z2C B;  4I5N A;  2YNS A; 
#chains in the Genus database with same CATH homology
 1UPL A;  1JPW A;  3C5W A;  1WA5 B;  4MFU A;  4UQI B;  4CB8 A;  2GL7 A;  3ZIO A;  2IE4 A;  4U5L A;  3WOY A;  1I7W A;  1XQR A;  1IB2 A;  4KZG A;  4CT6 B;  3OBV A;  2BNX A;  5SWF A;  4PVZ A;  4BPL A;  4ADY A;  5BYM A;  3BCT A;  3VLF A;  4PLQ A;  1QZ7 A;  3VLD A;  1UPK A;  1HO8 A;  4JLQ A;  3EA5 B;  3GRL A;  4G3A A;  3UL1 B;  3BVS A;  3WYF C;  5FC8 E;  5H2W A;  4CT7 B;  1PJN B;  4L7M A;  5D5K C;  4TNM A;  1EE4 A;  3BWT A;  5EWP A;  3Q0Q A;  1LUJ A;  1M8X A;  3FEY C;  1IAL A;  3ODR A;  2NPP A;  4L4H A;  4JW2 A;  5LSW A;  2QNA A;  3BSX A;  5B56 A;  1OYZ A;  4XZR B;  4FZF A;  4FP7 A;  3QML C;  4DVG B;  1W9C A;  3ZHP A;  3UVU A;  4NZW A;  2Z5M A;  4BA3 A;  4UAD A;  4BQK A;  3DAD A;  3OUW A;  5J3V A;  2OF3 A;  3GB8 A;  3ODS A;  4EVT A;  1F59 A;  2NYM B;  3LTM A;  3EBB A;  5CLB A;  3WOZ A;  3VLE A;  1JPP A;  1O6P A;  4CB9 A;  4U5O A;  3O2T A;  3BX3 A;  3OUX A;  4L4I A;  5CL5 A;  4HM9 A;  3Q0O A;  4U5N A;  1M1E A;  3TX7 A;  2JKT B;  2Z6G A;  4LAC A;  1WA5 C;  4MFV A;  3JX7 A;  4I96 A;  4O27 A;  2Z5K A;  2JKT A;  4HXT A;  3TJ3 A;  4A3V A;  3O2S A;  1XM9 A;  3FEX C;  5EKF A;  4WV6 A;  4P6Z G;  2XA7 A;  5BZV A;  1W63 A;  1Q1S C;  4I8M A;  1QGK A;  3WPT A;  3JY1 A;  3C2H A;  1I7X A;  2VGL A;  1EJY I;  3K64 A;  3IBV A;  4HNM A;  4DZS A;  4U5S A;  2W3C A;  3Q0L A;  4EVP A;  3Q0N A;  3UKX B;  4EVA A;  1IBR B;  3K7W A;  2PF4 A;  2FV2 A;  5E6Q B;  2YNR A;  3V74 A;  3ND2 A;  4R0Z A;  4UQI A;  1PJM B;  4DB6 A;  3VWA A;  4HTV A;  4JW3 C;  4CBA A;  1QBK B;  4V3Q A;  4OO6 A;  3GS3 A;  4P6Z B;  1Q1T C;  3TT9 A;  4GMN A;  3L6Y A;  4ZDU A;  4DB8 A;  1U6G C;  3A6P A;  4A0C A;  1GCJ A;  1V18 A;  4QMH A;  4MZ5 E;  3NOW A;  5KLR B;  5K9S A;  1TH1 A;  4U3J C;  3AU3 A;  3K5Q A;  5CLA A;  2IW3 A;  4I2S A;  4YI0 C;  2RU4 B;  3O4X A;  1XQS A;  4B8J A;  3GQ2 A;  4R10 A;  4FZA A;  2X19 B;  5KL1 A;  4D49 A;  1JDH A;  4UAF B;  2IAE B;  3FGA B;  5CLE A;  4V3O A;  2Z6H A;  3Q0P A;  2BAP A;  2X1G F;  2BKU B;  3TPM A;  4R11 A;  2IE3 A;  3FGA A;  4I2Z A;  4B8O A;  3KND A;  4U5U A;  2C1T A;  2YJY A;  5CL6 A;  2Q5D A;  3V71 A;  5KUB A;  4V3R A;  5KL8 A;  3LWW A;  2NYM A;  2IWH A;  3DW8 A;  2P8Q A;  3UKY B;  3NMX A;  4RZP A;  3PSP A;  3BX2 A;  3ZIQ A;  3RZ9 A;  3OQS A;  3L3Q A;  5H2X A;  5AEI A;  5DN7 A;  2QK1 A;  4EV9 A;  3UKZ B;  4I1E A;  4K92 A;  4YGX A;  2JKR B;  5HUY C;  3K5Y A;  1BK6 A;  3UKW B;  4JKQ A;  1QGR A;  1IQ1 C;  2NYL B;  5JJA A;  1LRV A;  3OPB A;  1G3J A;  2Z5J A;  4GMO A;  4EV8 A;  3BTR C;  3T7U A;  3JXY A;  1UKL A;  4YK6 A;  1M8Y A;  3QGB A;  4NEE A;  5BZU A;  4UWX A;  4Y5J A;  2OT8 A;  3RZX A;  4I6I A;  3K62 A;  3PST A;  4PLS A;  2WTK A;  5BZ5 A;  5CLC A;  4D4E A;  4QMJ A;  4CRU B;  3L3F X;  3Q0M A;  4I7I A;  3ZIL A;  4U54 A;  3TJZ B;  3K4E A;  3K5Z A;  4H3K A;  4QMI A;  3NMW A;  3H3D X;  5HUW C;  5KLT B;  3IFQ A;  2BCT A;  1EJL I;  4B8P A;  5CLD A;  5CTT A;  2F31 A;  1T08 A;  1EE5 A;  3O2Q A;  3ZIK A;  3GAE A;  4I0Y A;  4K6J A;  3K7V A;  3K61 A;  3Q5U A;  5KLA A;  4DB9 A;  2C1M A;  3C2G A;  5CL9 A;  4YJE A;  5CL4 A;  4PLR A;  4DBA A;  2RU4 A;  2NPP B;  3EG5 B;  3ZIR A;  4JW2 B;  2XOA A;  3ZIP A;  1M8W A;  4FDD A;  4I2W A;  4CRV B;  4U58 A;  4IMJ A;  5SVZ A;  4B18 A;  4IMI A;  2PKG A;  5EKG A;  5K6S A;  2IAE A;  4FQ3 A;  3UL0 B;  2QMR A;  4DJS A;  3GVO A;  1M8Z A;  4OIH A;  5CL8 A;  3TPO A;  5SW9 A;  5CL3 A;  1Y2A C;  5HHG E;  1B3U A;  2Z5N A;  3QGC A;  2Z5O A;  3VE6 A;  2H4M A;  4E4V A;  2DB0 A;  3SLA A;  3V6Y A;  3ZIN A;  1TE4 A;  3GVT A;  3Q0S A;  5BZ1 A;  2JAK A;  2JDQ A;  3LTJ A;  4FZD A;  4RXH B;  4I3N A;  3K49 A;  4U5V A;  4MZ6 E;  4U2X D;  4CV5 B;  3NMZ A;  1BK5 A;  4FFB C;  3SL9 A;  2JKR A;  3BSB A;  1UN0 A;  2QK2 A;  3GNI A;  4RV1 A;  5CL7 A;  4I37 A;  3W3U A;  4YJL A;  2IX3 A;  4H3H A;  2NYL A;  2XA7 B;  4I5L A;  1W63 B;  3Q0R A;  2VGL B;  3JXZ A;  1O6O A;  3QG9 A;  3L6X A;  4A3T A;  1M5N S;  3ZKV A;  4UAE A;  3QHE A;  1Z2C B;  4I5N A;  2YNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...