4KZGA

Crystal structure of zebrafish mo25
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
325
structure length
316
Chain Sequence
AMAPADIVKNLKDNMTILEKDKKAEKASEEVSKSLLSMKEILYGTQTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNDILRRQIGTRTPTVEYLCTQQNILFMLLKGYESPDIALNCGIMLRECIRHEPLAKITLCSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKVLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTPPILDILLKNQTKLIEFLSKFQNDRAEDEQFSDEKTYLIKQIRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Zgc:86716
publication title Structure of zebrafish MO25
pubmed doi rcsb
source organism Danio rerio
total genus 114
structure length 316
sequence length 325
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 4kzgA00
2BNXA 3O4XA 4I2ZA 1M5NS 4CB8A 1WA5C 3L3QA 4D49A 5J3VA 5BZ1A 4YJEA 3UVUA 4CT6B 3L3FX 4CRVB 1TH1A 3K49A 3NMWA 2IAEB 4U3JC 4PLRA 1V18A 3EBBA 3W3UA 5SWFA 3C5WA 4DB9A 3OBVA 3K5ZA 3TPOA 3FGAB 1U6GC 3KNDA 5H2XA 1M1EA 4PLSA 4B18A 4RXHB 4U5OA 3IFQA 5D5KC 3ZIPA 5BZVA 1IB2A 2NYLB 1XQSA 5HHGE 4FFBC 4CRUB 2IE4A 2H4MA 1EJLI 4KZGA 3GQ2A 3UKXB 3FEYC 3ZKVA 3WOZA 4EV9A 4NZWA 3BTRC 1UKLA 5SVZA 4R0ZA 3UKYB 2NYLA 5JJAA 5SW9A 3O2QA 4B8OA 3ZIQA 1OYZA 4O27A 4MFUA 2NYMB 3TPMA 4QMJA 1PJNB 2QK2A 3FEXC 3LTMA 3NMZA 1B3UA 4ADYA 2NYMA 5HUYC 5KL1A 2Z5JA 4MFVA 1WA5B 5KL8A 3NOWA 2W3CA 3V74A 4UWXA 1JPPA 2IWHA 4FZAA 1Q1SC 2PKGA 4YI0C 2NPPB 4U58A 4EVPA 1EJYI 1UN0A 1W9CA 4B8JA 3V71A 4DJSA 1JDHA 5K9SA 3TX7A 4MZ6E 1XM9A 4IMJA 2Z6GA 3C2GA 4EVAA 2FV2A 2GL7A 4QMIA 4U5NA 4Y5JA 3EG5B 3Q0MA 1QBKB 2NPPA 1O6OA 4R10A 1IBRB 3BSBA 3OUWA 2X19B 3QG9A 4DVGB 3LTJA 4U5LA 3K7WA 1G3JA 1EE5A 3Q0OA 1BK6A 3K5QA 2JKTB 3Q0NA 1I7XA 3ODSA 5HUWC 5BYMA 3GAEA 4JLQA 5BZUA 3GB8A 3C2HA 4HTVA 1O6PA 4CBAA 1W63B 3OQSA 5E6QB 4K6JA 1I7WA 3WYFC 4FDDA 3H3DX 3K4EA 2RU4A 3GVOA 2QMRA 3BSXA 5FC8E 5EKFA 5KLAA 3EA5B 4DBAA 2JKTA 2P8QA 3ZHPA 4B8PA 1W63A 4H3HA 3TT9A 2BAPA 4P6ZG 3VE6A 4YK6A 3WPTA 3L6YA 4OO6A 3BCTA 3A6PA 3PSPA 2VGLB 3IBVA 4IMIA 2Z5NA 2JAKA 4TNMA 3UL0B 3ZIOA 4RZPA 4UQIA 2YNRA 2Z5OA 4HNMA 1IQ1C 1IALA 4HM9A 3RZ9A 3V6YA 4P6ZB 4PLQA 3PSTA 1UPLA 4WV6A 4DB6A 3ND2A 2QK1A 1QZ7A 4NEEA 2XA7B 2VGLA 3TJZB 3QGBA 1LRVA 1QGKA 3LWWA 4EVTA 5H2WA 5BZ5A 1F59A 4FZFA 4V3RA 1GCJA 3BWTA 2Z5MA 3BX2A 3OUXA 3UL1B 4XZRB 2XA7A 4DZSA 4CT7B 3AU3A 1M8YA 4A0CA 4E4VA 3K64A 2X1GF 4RV1A 2OT8A 4I2WA 2WTKA 5DN7A 1M8ZA 4JW2B 4PVZA 3O2TA 1Q1TC 3DW8A 4U5VA 4BQKA 3K62A 4UAFB 1Z2CB 4I5LA 2RU4B 4DB8A 2JKRA 5LSWA 5B56A 5EWPA 2IE3A 3ZINA 3GRLA 4D4EA 3UKZB 3Q5UA 3ODRA 5EKGA 2IX3A 4OIHA 1JPWA 4R11A 1BK5A 2YNSA 2JDQA 3K7VA 2IAEA 2C1TA 1EE4A 4UQIB 3FGAA 3DADA 4GMOA 3Q0QA 3NMXA 4YGXA 1M8XA 3Q0LA 3QMLC 3K5YA 2Z5KA 3TJ3A 3WOYA 2F31A 5KLTB 4FZDA 4LACA 4K92A 4CB9A 4G3AA 4YJLA 2BCTA 4U54A 3GVTA 2DB0A 2BKUB 3Q0SA 4ZDUA 4V3OA 3T7UA 1Y2AC 3L6XA 4UAEA 4U5UA 3K61A 3Q0RA 2YJYA 1T08A 3VWAA 3QGCA 4U5SA 4GMNA 4I5NA 4MZ5E 1M8WA 4BPLA 4HXTA 3ZIRA 3GS3A 1LUJA 5AEIA 2Z6HA 3Q0PA 4FQ3A 3QHEA 2Q5DA 2OF3A 5CTTA 3GNIA 5K6SA 1PJMB 3OPBA 4V3QA 3O2SA 2IW3A 1QGRA 4BA3A 4EV8A 2QNAA 4H3KA 1XQRA 4QMHA 3RZXA 1UPKA 5KLRB 2PF4A 4L7MA 4UADA 3UKWB 2C1MA 2JKRB 4CV5B 1HO8A 3BX3A
chains in the Genus database with same CATH superfamily
2BNXA 3O4XA 2XOAA 4I7IA 4I2ZA 1M5NS 4CB8A 1WA5C 3L3QA 4D49A 5J3VA 5BZ1A 4YJEA 4L4HA 3UVUA 4CT6B 3L3FX 4CRVB 1TH1A 3K49A 3NMWA 2IAEB 4U3JC 4FP7A 4PLRA 1V18A 3EBBA 3W3UA 5SWFA 3C5WA 4DB9A 3OBVA 3K5ZA 3TPOA 3FGAB 1U6GC 3KNDA 5H2XA 1M1EA 3SL9A 4PLSA 4B18A 4RXHB 4U5OA 5CL8A 3IFQA 5D5KC 3ZIPA 5BZVA 1IB2A 2NYLB 1XQSA 5HHGE 4FFBC 4CRUB 3JX7A 4I37A 2IE4A 2H4MA 1EJLI 4KZGA 3GQ2A 3UKXB 3FEYC 3ZKVA 3WOZA 4EV9A 4NZWA 3BTRC 1UKLA 5SVZA 4R0ZA 4I8MA 3UKYB 2NYLA 5JJAA 5SW9A 3O2QA 1TE4A 4B8OA 3ZIQA 1OYZA 5CL4A 4O27A 5CLEA 4MFUA 4JKQA 2NYMB 3TPMA 4QMJA 1PJNB 2QK2A 3FEXC 3LTMA 3NMZA 1B3UA 4ADYA 2NYMA 5HUYC 5CLDA 5KL1A 2Z5JA 4MFVA 1WA5B 5KL8A 3NOWA 4I0YA 2W3CA 3UJ4A 3V74A 4UWXA 3JXZA 1JPPA 2IWHA 4I1EA 4FZAA 1Q1SC 2PKGA 4YI0C 2NPPB 4U58A 4EVPA 1EJYI 1UN0A 1W9CA 4A3VA 4B8JA 3V71A 4DJSA 1JDHA 5K9SA 3TX7A 4MZ6E 1XM9A 4IMJA 2Z6GA 3VLFA 3C2GA 4EVAA 2FV2A 2GL7A 4QMIA 4U5NA 4Y5JA 3EG5B 3Q0MA 1QBKB 2NPPA 1O6OA 4R10A 1IBRB 3BSBA 3OUWA 3UJ0A 2X19B 3QG9A 4DVGB 3LTJA 4U5LA 3K7WA 1G3JA 1EE5A 3Q0OA 1BK6A 3K5QA 2JKTB 3Q0NA 1I7XA 3ODSA 5HUWC 5BYMA 3GAEA 4JLQA 5BZUA 5CL9A 3GB8A 5CLAA 3C2HA 4HTVA 1O6PA 4CBAA 1W63B 3OQSA 5E6QB 4K6JA 1I7WA 3WYFC 1N4KA 4FDDA 3BVSA 3H3DX 4I2SA 3K4EA 2RU4A 3GVOA 2QMRA 3BSXA 5FC8E 5EKFA 5KLAA 3EA5B 4DBAA 2JKTA 4I3NA 2P8QA 3ZHPA 4B8PA 1W63A 4H3HA 3TT9A 2BAPA 4P6ZG 3VE6A 4YK6A 3WPTA 3L6YA 4OO6A 3BCTA 3A6PA 3PSPA 2VGLB 3IBVA 4IMIA 2Z5NA 2JAKA 4TNMA 3UL0B 3ZIOA 4RZPA 4UQIA 2YNRA 2Z5OA 4HNMA 1IQ1C 1IALA 4HM9A 3RZ9A 3V6YA 4P6ZB 4L4IA 4PLQA 3PSTA 1UPLA 4WV6A 4DB6A 3ND2A 2QK1A 1QZ7A 4NEEA 2XA7B 2VGLA 3TJZB 3QGBA 1LRVA 1QGKA 3LWWA 4EVTA 5H2WA 5BZ5A 1F59A 4FZFA 4V3RA 1GCJA 3BWTA 2Z5MA 3BX2A 3OUXA 3UL1B 4XZRB 2XA7A 4DZSA 4CT7B 3AU3A 1M8YA 4A0CA 4E4VA 5CL7A 3K64A 2X1GF 3JY1A 5CL6A 4RV1A 2OT8A 4I2WA 2WTKA 5DN7A 3VLDA 1M8ZA 4JW2B 4PVZA 3O2TA 5CLCA 1Q1TC 3DW8A 4U5VA 4BQKA 3K62A 4UAFB 1Z2CB 4I5LA 2RU4B 4DB8A 2JKRA 5LSWA 5B56A 5EWPA 2IE3A 3ZINA 3GRLA 4D4EA 3UKZB 3Q5UA 3ZILA 3ODRA 5EKGA 2IX3A 4OIHA 1JPWA 4JW2A 4R11A 1BK5A 2YNSA 2JDQA 3K7VA 2IAEA 2C1TA 1EE4A 5CL5A 4UQIB 5CLBA 3FGAA 3DADA 4GMOA 3Q0QA 5KUBA 3NMXA 4YGXA 3VLEA 1M8XA 3Q0LA 3QMLC 3K5YA 2Z5KA 3TJ3A 3WOYA 2F31A 5KLTB 4FZDA 4LACA 4K92A 4CB9A 4G3AA 4U2XD 4YJLA 2BCTA 4U54A 3JXYA 3GVTA 2DB0A 3SLAA 2BKUB 4I96A 3Q0SA 4ZDUA 4V3OA 3T7UA 1Y2AC 3L6XA 4UAEA 4U5UA 3K61A 3Q0RA 2YJYA 3T8SA 1T08A 3VWAA 4A3TA 3QGCA 4U5SA 4GMNA 4I5NA 4MZ5E 1M8WA 4BPLA 4HXTA 3ZIRA 4I6IA 3GS3A 1LUJA 1LSHA 5AEIA 2Z6HA 3Q0PA 4FQ3A 3ZIKA 3QHEA 2Q5DA 2OF3A 5CTTA 3GNIA 5K6SA 1PJMB 3OPBA 4V3QA 3O2SA 2IW3A 1QGRA 4BA3A 4JW3C 4EV8A 2QNAA 4H3KA 1XQRA 4QMHA 3RZXA 1UPKA 5KLRB 2PF4A 4L7MA 5CL3A 4UADA 3UKWB 2C1MA 2JKRB 4CV5B 1HO8A 3BX3A
chains in the Genus database with same CATH topology
2BNXA 3O4XA 2XOAA 4I7IA 4I2ZA 1M5NS 4CB8A 1WA5C 3L3QA 4D49A 5J3VA 5BZ1A 4YJEA 4L4HA 3UVUA 4CT6B 3L3FX 4CRVB 1TH1A 3K49A 3NMWA 2IAEB 4U3JC 4FP7A 4PLRA 1V18A 3EBBA 3W3UA 5SWFA 3C5WA 4DB9A 3OBVA 3K5ZA 3TPOA 3FGAB 1U6GC 3KNDA 5H2XA 1M1EA 3SL9A 4PLSA 4B18A 4RXHB 4U5OA 5CL8A 3IFQA 5D5KC 3ZIPA 5BZVA 1IB2A 2NYLB 1XQSA 5HHGE 4FFBC 4CRUB 3JX7A 4I37A 2IE4A 2H4MA 1EJLI 4KZGA 3GQ2A 3UKXB 3FEYC 3ZKVA 3WOZA 4EV9A 4NZWA 3BTRC 1UKLA 5SVZA 4R0ZA 4I8MA 3UKYB 2NYLA 5JJAA 5SW9A 3O2QA 1TE4A 4B8OA 3ZIQA 1OYZA 5CL4A 4O27A 5CLEA 4MFUA 4JKQA 2NYMB 3TPMA 4QMJA 1PJNB 2QK2A 3FEXC 3LTMA 3NMZA 1B3UA 4ADYA 2NYMA 5HUYC 5CLDA 5KL1A 2Z5JA 4MFVA 1WA5B 5KL8A 3NOWA 4I0YA 2W3CA 3V74A 4UWXA 3JXZA 1JPPA 2IWHA 4I1EA 4FZAA 1Q1SC 2PKGA 4YI0C 2NPPB 4U58A 4EVPA 1EJYI 1UN0A 1W9CA 4A3VA 4B8JA 3V71A 4DJSA 1JDHA 5K9SA 3TX7A 4MZ6E 1XM9A 4IMJA 2Z6GA 3VLFA 3C2GA 4EVAA 2FV2A 2GL7A 4QMIA 4U5NA 4Y5JA 3EG5B 3Q0MA 1QBKB 2NPPA 1O6OA 4R10A 1IBRB 3BSBA 3OUWA 2X19B 3QG9A 4DVGB 3LTJA 4U5LA 3K7WA 1G3JA 1EE5A 3Q0OA 1BK6A 3K5QA 2JKTB 3Q0NA 1I7XA 3ODSA 5HUWC 5BYMA 3GAEA 4JLQA 5BZUA 5CL9A 3GB8A 5CLAA 3C2HA 4HTVA 1O6PA 4CBAA 1W63B 3OQSA 5E6QB 4K6JA 1I7WA 3WYFC 4FDDA 3BVSA 3H3DX 4I2SA 3K4EA 2RU4A 3GVOA 2QMRA 3BSXA 5FC8E 5EKFA 5KLAA 3EA5B 4DBAA 2JKTA 4I3NA 2P8QA 3ZHPA 4B8PA 1W63A 4H3HA 3TT9A 2BAPA 4P6ZG 3VE6A 4YK6A 3WPTA 3L6YA 4OO6A 3BCTA 3A6PA 3PSPA 2VGLB 3IBVA 4IMIA 2Z5NA 2JAKA 4TNMA 3UL0B 3ZIOA 4RZPA 4UQIA 2YNRA 2Z5OA 4HNMA 1IQ1C 1IALA 4HM9A 3RZ9A 3V6YA 4P6ZB 4L4IA 4PLQA 3PSTA 1UPLA 4WV6A 4DB6A 3ND2A 2QK1A 1QZ7A 4NEEA 2XA7B 2VGLA 3TJZB 3QGBA 1LRVA 1QGKA 3LWWA 4EVTA 5H2WA 5BZ5A 1F59A 4FZFA 4V3RA 1GCJA 3BWTA 2Z5MA 3BX2A 3OUXA 3UL1B 4XZRB 2XA7A 4DZSA 4CT7B 3AU3A 1M8YA 4A0CA 4E4VA 5CL7A 3K64A 2X1GF 3JY1A 5CL6A 4RV1A 2OT8A 4I2WA 2WTKA 5DN7A 3VLDA 1M8ZA 4JW2B 4PVZA 3O2TA 5CLCA 1Q1TC 3DW8A 4U5VA 4BQKA 3K62A 4UAFB 1Z2CB 4I5LA 2RU4B 4DB8A 2JKRA 5LSWA 5B56A 5EWPA 2IE3A 3ZINA 3GRLA 4D4EA 3UKZB 3Q5UA 3ZILA 3ODRA 5EKGA 2IX3A 4OIHA 1JPWA 4JW2A 4R11A 1BK5A 2YNSA 2JDQA 3K7VA 2IAEA 2C1TA 1EE4A 5CL5A 4UQIB 5CLBA 3FGAA 3DADA 4GMOA 3Q0QA 5KUBA 3NMXA 4YGXA 3VLEA 1M8XA 3Q0LA 3QMLC 3K5YA 2Z5KA 3TJ3A 3WOYA 2F31A 5KLTB 4FZDA 4LACA 4K92A 4CB9A 4G3AA 4U2XD 4YJLA 2BCTA 4U54A 3JXYA 3GVTA 2DB0A 3SLAA 2BKUB 4I96A 3Q0SA 4ZDUA 4V3OA 3T7UA 1Y2AC 3L6XA 4UAEA 4U5UA 3K61A 3Q0RA 2YJYA 1T08A 3VWAA 4A3TA 3QGCA 4U5SA 4GMNA 4I5NA 4MZ5E 1M8WA 4BPLA 4HXTA 3ZIRA 4I6IA 3GS3A 1LUJA 5AEIA 2Z6HA 3Q0PA 4FQ3A 3ZIKA 3QHEA 2Q5DA 2OF3A 5CTTA 3GNIA 5K6SA 1PJMB 3OPBA 4V3QA 3O2SA 2IW3A 1QGRA 4BA3A 4JW3C 4EV8A 2QNAA 4H3KA 1XQRA 4QMHA 3RZXA 1UPKA 5KLRB 2PF4A 4L7MA 5CL3A 4UADA 3UKWB 2C1MA 2JKRB 4CV5B 1HO8A 3BX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BNX A;  3O4X A;  4I2Z A;  1M5N S;  4CB8 A;  1WA5 C;  3L3Q A;  4D49 A;  5J3V A;  5BZ1 A;  4YJE A;  3UVU A;  4CT6 B;  3L3F X;  4CRV B;  1TH1 A;  3K49 A;  3NMW A;  2IAE B;  4U3J C;  4PLR A;  1V18 A;  3EBB A;  3W3U A;  5SWF A;  3C5W A;  4DB9 A;  3OBV A;  3K5Z A;  3TPO A;  3FGA B;  1U6G C;  3KND A;  5H2X A;  1M1E A;  4PLS A;  4B18 A;  4RXH B;  4U5O A;  3IFQ A;  5D5K C;  3ZIP A;  5BZV A;  1IB2 A;  2NYL B;  1XQS A;  5HHG E;  4FFB C;  4CRU B;  2IE4 A;  2H4M A;  1EJL I;  4KZG A;  3GQ2 A;  3UKX B;  3FEY C;  3ZKV A;  3WOZ A;  4EV9 A;  4NZW A;  3BTR C;  1UKL A;  5SVZ A;  4R0Z A;  3UKY B;  2NYL A;  5JJA A;  5SW9 A;  3O2Q A;  4B8O A;  3ZIQ A;  1OYZ A;  4O27 A;  4MFU A;  2NYM B;  3TPM A;  4QMJ A;  1PJN B;  2QK2 A;  3FEX C;  3LTM A;  3NMZ A;  1B3U A;  4ADY A;  2NYM A;  5HUY C;  5KL1 A;  2Z5J A;  4MFV A;  1WA5 B;  5KL8 A;  3NOW A;  2W3C A;  3V74 A;  4UWX A;  1JPP A;  2IWH A;  4FZA A;  1Q1S C;  2PKG A;  4YI0 C;  2NPP B;  4U58 A;  4EVP A;  1EJY I;  1UN0 A;  1W9C A;  4B8J A;  3V71 A;  4DJS A;  1JDH A;  5K9S A;  3TX7 A;  4MZ6 E;  1XM9 A;  4IMJ A;  2Z6G A;  3C2G A;  4EVA A;  2FV2 A;  2GL7 A;  4QMI A;  4U5N A;  4Y5J A;  3EG5 B;  3Q0M A;  1QBK B;  2NPP A;  1O6O A;  4R10 A;  1IBR B;  3BSB A;  3OUW A;  2X19 B;  3QG9 A;  4DVG B;  3LTJ A;  4U5L A;  3K7W A;  1G3J A;  1EE5 A;  3Q0O A;  1BK6 A;  3K5Q A;  2JKT B;  3Q0N A;  1I7X A;  3ODS A;  5HUW C;  5BYM A;  3GAE A;  4JLQ A;  5BZU A;  3GB8 A;  3C2H A;  4HTV A;  1O6P A;  4CBA A;  1W63 B;  3OQS A;  5E6Q B;  4K6J A;  1I7W A;  3WYF C;  4FDD A;  3H3D X;  3K4E A;  2RU4 A;  3GVO A;  2QMR A;  3BSX A;  5FC8 E;  5EKF A;  5KLA A;  3EA5 B;  4DBA A;  2JKT A;  2P8Q A;  3ZHP A;  4B8P A;  1W63 A;  4H3H A;  3TT9 A;  2BAP A;  4P6Z G;  3VE6 A;  4YK6 A;  3WPT A;  3L6Y A;  4OO6 A;  3BCT A;  3A6P A;  3PSP A;  2VGL B;  3IBV A;  4IMI A;  2Z5N A;  2JAK A;  4TNM A;  3UL0 B;  3ZIO A;  4RZP A;  4UQI A;  2YNR A;  2Z5O A;  4HNM A;  1IQ1 C;  1IAL A;  4HM9 A;  3RZ9 A;  3V6Y A;  4P6Z B;  4PLQ A;  3PST A;  1UPL A;  4WV6 A;  4DB6 A;  3ND2 A;  2QK1 A;  1QZ7 A;  4NEE A;  2XA7 B;  2VGL A;  3TJZ B;  3QGB A;  1LRV A;  1QGK A;  3LWW A;  4EVT A;  5H2W A;  5BZ5 A;  1F59 A;  4FZF A;  4V3R A;  1GCJ A;  3BWT A;  2Z5M A;  3BX2 A;  3OUX A;  3UL1 B;  4XZR B;  2XA7 A;  4DZS A;  4CT7 B;  3AU3 A;  1M8Y A;  4A0C A;  4E4V A;  3K64 A;  2X1G F;  4RV1 A;  2OT8 A;  4I2W A;  2WTK A;  5DN7 A;  1M8Z A;  4JW2 B;  4PVZ A;  3O2T A;  1Q1T C;  3DW8 A;  4U5V A;  4BQK A;  3K62 A;  4UAF B;  1Z2C B;  4I5L A;  2RU4 B;  4DB8 A;  2JKR A;  5LSW A;  5B56 A;  5EWP A;  2IE3 A;  3ZIN A;  3GRL A;  4D4E A;  3UKZ B;  3Q5U A;  3ODR A;  5EKG A;  2IX3 A;  4OIH A;  1JPW A;  4R11 A;  1BK5 A;  2YNS A;  2JDQ A;  3K7V A;  2IAE A;  2C1T A;  1EE4 A;  4UQI B;  3FGA A;  3DAD A;  4GMO A;  3Q0Q A;  3NMX A;  4YGX A;  1M8X A;  3Q0L A;  3QML C;  3K5Y A;  2Z5K A;  3TJ3 A;  3WOY A;  2F31 A;  5KLT B;  4FZD A;  4LAC A;  4K92 A;  4CB9 A;  4G3A A;  4YJL A;  2BCT A;  4U54 A;  3GVT A;  2DB0 A;  2BKU B;  3Q0S A;  4ZDU A;  4V3O A;  3T7U A;  1Y2A C;  3L6X A;  4UAE A;  4U5U A;  3K61 A;  3Q0R A;  2YJY A;  1T08 A;  3VWA A;  3QGC A;  4U5S A;  4GMN A;  4I5N A;  4MZ5 E;  1M8W A;  4BPL A;  4HXT A;  3ZIR A;  3GS3 A;  1LUJ A;  5AEI A;  2Z6H A;  3Q0P A;  4FQ3 A;  3QHE A;  2Q5D A;  2OF3 A;  5CTT A;  3GNI A;  5K6S A;  1PJM B;  3OPB A;  4V3Q A;  3O2S A;  2IW3 A;  1QGR A;  4BA3 A;  4EV8 A;  2QNA A;  4H3K A;  1XQR A;  4QMH A;  3RZX A;  1UPK A;  5KLR B;  2PF4 A;  4L7M A;  4UAD A;  3UKW B;  2C1M A;  2JKR B;  4CV5 B;  1HO8 A;  3BX3 A; 
#chains in the Genus database with same CATH topology
 2BNX A;  3O4X A;  2XOA A;  4I7I A;  4I2Z A;  1M5N S;  4CB8 A;  1WA5 C;  3L3Q A;  4D49 A;  5J3V A;  5BZ1 A;  4YJE A;  4L4H A;  3UVU A;  4CT6 B;  3L3F X;  4CRV B;  1TH1 A;  3K49 A;  3NMW A;  2IAE B;  4U3J C;  4FP7 A;  4PLR A;  1V18 A;  3EBB A;  3W3U A;  5SWF A;  3C5W A;  4DB9 A;  3OBV A;  3K5Z A;  3TPO A;  3FGA B;  1U6G C;  3KND A;  5H2X A;  1M1E A;  3SL9 A;  4PLS A;  4B18 A;  4RXH B;  4U5O A;  5CL8 A;  3IFQ A;  5D5K C;  3ZIP A;  5BZV A;  1IB2 A;  2NYL B;  1XQS A;  5HHG E;  4FFB C;  4CRU B;  3JX7 A;  4I37 A;  2IE4 A;  2H4M A;  1EJL I;  4KZG A;  3GQ2 A;  3UKX B;  3FEY C;  3ZKV A;  3WOZ A;  4EV9 A;  4NZW A;  3BTR C;  1UKL A;  5SVZ A;  4R0Z A;  4I8M A;  3UKY B;  2NYL A;  5JJA A;  5SW9 A;  3O2Q A;  1TE4 A;  4B8O A;  3ZIQ A;  1OYZ A;  5CL4 A;  4O27 A;  5CLE A;  4MFU A;  4JKQ A;  2NYM B;  3TPM A;  4QMJ A;  1PJN B;  2QK2 A;  3FEX C;  3LTM A;  3NMZ A;  1B3U A;  4ADY A;  2NYM A;  5HUY C;  5CLD A;  5KL1 A;  2Z5J A;  4MFV A;  1WA5 B;  5KL8 A;  3NOW A;  4I0Y A;  2W3C A;  3UJ4 A;  3V74 A;  4UWX A;  3JXZ A;  1JPP A;  2IWH A;  4I1E A;  4FZA A;  1Q1S C;  2PKG A;  4YI0 C;  2NPP B;  4U58 A;  4EVP A;  1EJY I;  1UN0 A;  1W9C A;  4A3V A;  4B8J A;  3V71 A;  4DJS A;  1JDH A;  5K9S A;  3TX7 A;  4MZ6 E;  1XM9 A;  4IMJ A;  2Z6G A;  3VLF A;  3C2G A;  4EVA A;  2FV2 A;  2GL7 A;  4QMI A;  4U5N A;  4Y5J A;  3EG5 B;  3Q0M A;  1QBK B;  2NPP A;  1O6O A;  4R10 A;  1IBR B;  3BSB A;  3OUW A;  3UJ0 A;  2X19 B;  3QG9 A;  4DVG B;  3LTJ A;  4U5L A;  3K7W A;  1G3J A;  1EE5 A;  3Q0O A;  1BK6 A;  3K5Q A;  2JKT B;  3Q0N A;  1I7X A;  3ODS A;  5HUW C;  5BYM A;  3GAE A;  4JLQ A;  5BZU A;  5CL9 A;  3GB8 A;  5CLA A;  3C2H A;  4HTV A;  1O6P A;  4CBA A;  1W63 B;  3OQS A;  5E6Q B;  4K6J A;  1I7W A;  3WYF C;  1N4K A;  4FDD A;  3BVS A;  3H3D X;  4I2S A;  3K4E A;  2RU4 A;  3GVO A;  2QMR A;  3BSX A;  5FC8 E;  5EKF A;  5KLA A;  3EA5 B;  4DBA A;  2JKT A;  4I3N A;  2P8Q A;  3ZHP A;  4B8P A;  1W63 A;  4H3H A;  3TT9 A;  2BAP A;  4P6Z G;  3VE6 A;  4YK6 A;  3WPT A;  3L6Y A;  4OO6 A;  3BCT A;  3A6P A;  3PSP A;  2VGL B;  3IBV A;  4IMI A;  2Z5N A;  2JAK A;  4TNM A;  3UL0 B;  3ZIO A;  4RZP A;  4UQI A;  2YNR A;  2Z5O A;  4HNM A;  1IQ1 C;  1IAL A;  4HM9 A;  3RZ9 A;  3V6Y A;  4P6Z B;  4L4I A;  4PLQ A;  3PST A;  1UPL A;  4WV6 A;  4DB6 A;  3ND2 A;  2QK1 A;  1QZ7 A;  4NEE A;  2XA7 B;  2VGL A;  3TJZ B;  3QGB A;  1LRV A;  1QGK A;  3LWW A;  4EVT A;  5H2W A;  5BZ5 A;  1F59 A;  4FZF A;  4V3R A;  1GCJ A;  3BWT A;  2Z5M A;  3BX2 A;  3OUX A;  3UL1 B;  4XZR B;  2XA7 A;  4DZS A;  4CT7 B;  3AU3 A;  1M8Y A;  4A0C A;  4E4V A;  5CL7 A;  3K64 A;  2X1G F;  3JY1 A;  5CL6 A;  4RV1 A;  2OT8 A;  4I2W A;  2WTK A;  5DN7 A;  3VLD A;  1M8Z A;  4JW2 B;  4PVZ A;  3O2T A;  5CLC A;  1Q1T C;  3DW8 A;  4U5V A;  4BQK A;  3K62 A;  4UAF B;  1Z2C B;  4I5L A;  2RU4 B;  4DB8 A;  2JKR A;  5LSW A;  5B56 A;  5EWP A;  2IE3 A;  3ZIN A;  3GRL A;  4D4E A;  3UKZ B;  3Q5U A;  3ZIL A;  3ODR A;  5EKG A;  2IX3 A;  4OIH A;  1JPW A;  4JW2 A;  4R11 A;  1BK5 A;  2YNS A;  2JDQ A;  3K7V A;  2IAE A;  2C1T A;  1EE4 A;  5CL5 A;  4UQI B;  5CLB A;  3FGA A;  3DAD A;  4GMO A;  3Q0Q A;  5KUB A;  3NMX A;  4YGX A;  3VLE A;  1M8X A;  3Q0L A;  3QML C;  3K5Y A;  2Z5K A;  3TJ3 A;  3WOY A;  2F31 A;  5KLT B;  4FZD A;  4LAC A;  4K92 A;  4CB9 A;  4G3A A;  4U2X D;  4YJL A;  2BCT A;  4U54 A;  3JXY A;  3GVT A;  2DB0 A;  3SLA A;  2BKU B;  4I96 A;  3Q0S A;  4ZDU A;  4V3O A;  3T7U A;  1Y2A C;  3L6X A;  4UAE A;  4U5U A;  3K61 A;  3Q0R A;  2YJY A;  3T8S A;  1T08 A;  3VWA A;  4A3T A;  3QGC A;  4U5S A;  4GMN A;  4I5N A;  4MZ5 E;  1M8W A;  4BPL A;  4HXT A;  3ZIR A;  4I6I A;  3GS3 A;  1LUJ A;  1LSH A;  5AEI A;  2Z6H A;  3Q0P A;  4FQ3 A;  3ZIK A;  3QHE A;  2Q5D A;  2OF3 A;  5CTT A;  3GNI A;  5K6S A;  1PJM B;  3OPB A;  4V3Q A;  3O2S A;  2IW3 A;  1QGR A;  4BA3 A;  4JW3 C;  4EV8 A;  2QNA A;  4H3K A;  1XQR A;  4QMH A;  3RZX A;  1UPK A;  5KLR B;  2PF4 A;  4L7M A;  5CL3 A;  4UAD A;  3UKW B;  2C1M A;  2JKR B;  4CV5 B;  1HO8 A;  3BX3 A; 
#chains in the Genus database with same CATH homology
 2BNX A;  3O4X A;  2XOA A;  4I7I A;  4I2Z A;  1M5N S;  4CB8 A;  1WA5 C;  3L3Q A;  4D49 A;  5J3V A;  5BZ1 A;  4YJE A;  4L4H A;  3UVU A;  4CT6 B;  3L3F X;  4CRV B;  1TH1 A;  3K49 A;  3NMW A;  2IAE B;  4U3J C;  4FP7 A;  4PLR A;  1V18 A;  3EBB A;  3W3U A;  5SWF A;  3C5W A;  4DB9 A;  3OBV A;  3K5Z A;  3TPO A;  3FGA B;  1U6G C;  3KND A;  5H2X A;  1M1E A;  3SL9 A;  4PLS A;  4B18 A;  4RXH B;  4U5O A;  5CL8 A;  3IFQ A;  5D5K C;  3ZIP A;  5BZV A;  1IB2 A;  2NYL B;  1XQS A;  5HHG E;  4FFB C;  4CRU B;  3JX7 A;  4I37 A;  2IE4 A;  2H4M A;  1EJL I;  4KZG A;  3GQ2 A;  3UKX B;  3FEY C;  3ZKV A;  3WOZ A;  4EV9 A;  4NZW A;  3BTR C;  1UKL A;  5SVZ A;  4R0Z A;  4I8M A;  3UKY B;  2NYL A;  5JJA A;  5SW9 A;  3O2Q A;  1TE4 A;  4B8O A;  3ZIQ A;  1OYZ A;  5CL4 A;  4O27 A;  5CLE A;  4MFU A;  4JKQ A;  2NYM B;  3TPM A;  4QMJ A;  1PJN B;  2QK2 A;  3FEX C;  3LTM A;  3NMZ A;  1B3U A;  4ADY A;  2NYM A;  5HUY C;  5CLD A;  5KL1 A;  2Z5J A;  4MFV A;  1WA5 B;  5KL8 A;  3NOW A;  4I0Y A;  2W3C A;  3V74 A;  4UWX A;  3JXZ A;  1JPP A;  2IWH A;  4I1E A;  4FZA A;  1Q1S C;  2PKG A;  4YI0 C;  2NPP B;  4U58 A;  4EVP A;  1EJY I;  1UN0 A;  1W9C A;  4A3V A;  4B8J A;  3V71 A;  4DJS A;  1JDH A;  5K9S A;  3TX7 A;  4MZ6 E;  1XM9 A;  4IMJ A;  2Z6G A;  3VLF A;  3C2G A;  4EVA A;  2FV2 A;  2GL7 A;  4QMI A;  4U5N A;  4Y5J A;  3EG5 B;  3Q0M A;  1QBK B;  2NPP A;  1O6O A;  4R10 A;  1IBR B;  3BSB A;  3OUW A;  2X19 B;  3QG9 A;  4DVG B;  3LTJ A;  4U5L A;  3K7W A;  1G3J A;  1EE5 A;  3Q0O A;  1BK6 A;  3K5Q A;  2JKT B;  3Q0N A;  1I7X A;  3ODS A;  5HUW C;  5BYM A;  3GAE A;  4JLQ A;  5BZU A;  5CL9 A;  3GB8 A;  5CLA A;  3C2H A;  4HTV A;  1O6P A;  4CBA A;  1W63 B;  3OQS A;  5E6Q B;  4K6J A;  1I7W A;  3WYF C;  4FDD A;  3BVS A;  3H3D X;  4I2S A;  3K4E A;  2RU4 A;  3GVO A;  2QMR A;  3BSX A;  5FC8 E;  5EKF A;  5KLA A;  3EA5 B;  4DBA A;  2JKT A;  4I3N A;  2P8Q A;  3ZHP A;  4B8P A;  1W63 A;  4H3H A;  3TT9 A;  2BAP A;  4P6Z G;  3VE6 A;  4YK6 A;  3WPT A;  3L6Y A;  4OO6 A;  3BCT A;  3A6P A;  3PSP A;  2VGL B;  3IBV A;  4IMI A;  2Z5N A;  2JAK A;  4TNM A;  3UL0 B;  3ZIO A;  4RZP A;  4UQI A;  2YNR A;  2Z5O A;  4HNM A;  1IQ1 C;  1IAL A;  4HM9 A;  3RZ9 A;  3V6Y A;  4P6Z B;  4L4I A;  4PLQ A;  3PST A;  1UPL A;  4WV6 A;  4DB6 A;  3ND2 A;  2QK1 A;  1QZ7 A;  4NEE A;  2XA7 B;  2VGL A;  3TJZ B;  3QGB A;  1LRV A;  1QGK A;  3LWW A;  4EVT A;  5H2W A;  5BZ5 A;  1F59 A;  4FZF A;  4V3R A;  1GCJ A;  3BWT A;  2Z5M A;  3BX2 A;  3OUX A;  3UL1 B;  4XZR B;  2XA7 A;  4DZS A;  4CT7 B;  3AU3 A;  1M8Y A;  4A0C A;  4E4V A;  5CL7 A;  3K64 A;  2X1G F;  3JY1 A;  5CL6 A;  4RV1 A;  2OT8 A;  4I2W A;  2WTK A;  5DN7 A;  3VLD A;  1M8Z A;  4JW2 B;  4PVZ A;  3O2T A;  5CLC A;  1Q1T C;  3DW8 A;  4U5V A;  4BQK A;  3K62 A;  4UAF B;  1Z2C B;  4I5L A;  2RU4 B;  4DB8 A;  2JKR A;  5LSW A;  5B56 A;  5EWP A;  2IE3 A;  3ZIN A;  3GRL A;  4D4E A;  3UKZ B;  3Q5U A;  3ZIL A;  3ODR A;  5EKG A;  2IX3 A;  4OIH A;  1JPW A;  4JW2 A;  4R11 A;  1BK5 A;  2YNS A;  2JDQ A;  3K7V A;  2IAE A;  2C1T A;  1EE4 A;  5CL5 A;  4UQI B;  5CLB A;  3FGA A;  3DAD A;  4GMO A;  3Q0Q A;  5KUB A;  3NMX A;  4YGX A;  3VLE A;  1M8X A;  3Q0L A;  3QML C;  3K5Y A;  2Z5K A;  3TJ3 A;  3WOY A;  2F31 A;  5KLT B;  4FZD A;  4LAC A;  4K92 A;  4CB9 A;  4G3A A;  4U2X D;  4YJL A;  2BCT A;  4U54 A;  3JXY A;  3GVT A;  2DB0 A;  3SLA A;  2BKU B;  4I96 A;  3Q0S A;  4ZDU A;  4V3O A;  3T7U A;  1Y2A C;  3L6X A;  4UAE A;  4U5U A;  3K61 A;  3Q0R A;  2YJY A;  1T08 A;  3VWA A;  4A3T A;  3QGC A;  4U5S A;  4GMN A;  4I5N A;  4MZ5 E;  1M8W A;  4BPL A;  4HXT A;  3ZIR A;  4I6I A;  3GS3 A;  1LUJ A;  5AEI A;  2Z6H A;  3Q0P A;  4FQ3 A;  3ZIK A;  3QHE A;  2Q5D A;  2OF3 A;  5CTT A;  3GNI A;  5K6S A;  1PJM B;  3OPB A;  4V3Q A;  3O2S A;  2IW3 A;  1QGR A;  4BA3 A;  4JW3 C;  4EV8 A;  2QNA A;  4H3K A;  1XQR A;  4QMH A;  3RZX A;  1UPK A;  5KLR B;  2PF4 A;  4L7M A;  5CL3 A;  4UAD A;  3UKW B;  2C1M A;  2JKR B;  4CV5 B;  1HO8 A;  3BX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...