3VLEA

Crystal structure of yeast proteasome interacting protein
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
456
structure length
435
Chain Sequence
NLLTQLENELNEDTLLRKCSLNLVTVMDVKPLLATIKRFLTSDYLLDVVDKLVPMADFDDVLEVYSAEDLVKALRSEIDPLKVAACRVIENSQPKGLFATSNIIDILLDILFDEKVENDKLITAIEKALERLSTDELIRRRLFDNNLPYLVSVKGRMETVSFVRLIDFLTIEFQFISGPEFKDIIFCFTKEEILKSVEDILVFIELVNYYTKFLLEIRNQDKYWALRHVKKILPVFAQLFEDTENYPDVRAFSTNCLLQLFAEVSRIEEDEYSLFKTMDKDSLKIGSEAKLITEWLELINPQYLVKYHKDVVENYFHVSGYSIGMLRNLSADEECFNAIRNKFSAEIVLRLPYLEQMQVVETLTRYEYTSKFLLNEMPKVMGSLIGDGSAGAIIDLETVHYRNSALRNLLDKGEEKLSVWYEPLLREYSKAVNGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords DNA mismatch repair protein HSM3
publication title Structural basis for specific recognition of Rpt1, an ATPase subunit of the 26S proteasome, by a proteasome-dedicated chaperone Hsm3
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 167
structure length 435
sequence length 456
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18794 HSM3_C DNA mismatch repair protein HSM3, C terminal domain
A PF18795 HSM3_N DNA mismatch repair protein HSM3, N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.50 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 3vleA01
1.25.40.580 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3vleA02
3VLEA 3VLDA 3VLFA 4A3VA 4A3TA 4FP7A
chains in the Genus database with same CATH superfamily
1OWLA 2FULA 3OXLA 4WWNA 5CLCA 2VGEA 3G2UA 5AARA 4Q69A 3JQ0A 2GRRB 4YDWA 3NMZA 4B94A 3O2SA 4KXKB 3FGAA 3ULEG 3QGCA 5E6QB 3WOYA 4EV9A 1Z2CB 1F59A 4L7TA 2AVPA 1G3JA 4GMOA 4PLSA 1EJLI 3AU5A 3DXMG 3IKOB 3L08A 4I6JA 3PUKA 4I37A 4K03A 1ELKA 5KJNA 2HR2A 5LCWC 1TH1A 5KJMA 3MGBA 1V55E 1QGRA 5G55A 2C0LA 3RO2A 3PE3A 2W3CA 3ASDA 4KZGA 4FA6A 3SI5A 1HE8A 1BLXB 2B6CA 2B0OE 4EZKA 3TXNA 1FVHA 2QK1A 1LD8A 3EA5B 4AIFA 4BESA 4E6HA 2XEEA 2GL7A 5LCWJ 5B3SE 2X3MA 3RIBA 3S7JA 4FFBC 1OXJA 2QNAA 3ZHEA 3NF1A 3CHOA 3FUEA 1TN8A 1IQUA 2BKGA 3RRMB 1PJNB 1RW2A 3FEYC 5HRYA 3ZIRA 1YA0A 3G2VA 1L5JA 2OCCE 2PQRA 3CHRA 2J8SD 4UWLA 3B7UX 1QBQA 5JA4D 1K1BA 2KXPC 1GCJA 3APDA 1Q1TC 4I43A 5G04J 2LAIA 4BPLA 3HXFA 4WUYA 3UXGA 4OVUA 4N3BA 3CVNA 2XGOA 3VLFA 1ELWA 5BZVA 2WQHA 4DI4A 3OXGA 3FUDA 1T08A 3NAWA 4Y6CA 3NBNB 4N3AA 3B13A 3SBSA 3JXIA 4MZ6E 4GCNA 2YNQA 2R03A 3I4GA 1UJJA 4CEMA 3UT8A 3U66A 4IN3B 5SVZA 3OQSA 3UJ0A 2BAPA 3E33A 5BXUA 5G2NA 4DX2A 4I5NA 2XS8A 4CDNA 2YJYA 4GMNA 4WNEA 5J08A 3KSQA 5JJ7A 2IOSA 3TGOA 5EKQD 1HX8A 3IHYA 5ENSD 1WA5B 3ABME 1NA0A 4EVAA 3L82A 4DVGB 2XQ0A 4UWXA 3DADA 1M8WA 1M8ZA 4E4VA 3IEGA 2QMRA 3C2GA 5T4YA 4R7LA 3LEWA 2ETAA 1N94A 4APOA 3TJPA 4I2WA 2R59A 1A5EA 2ZISA 3UINC 4TXRA 3D9MA 2OVFA 3T8MA 2R02A 4NIKA 3KSLA 4HOTA 3OUWA 4HXIA 1MQSA 2JEKA 2OVBA 4U0UA 2WXIA 3Q0NA 5EN5D 3Q73A 1EE5A 5AQ9A 1BI8B 3TWWA 4ILGA 4XE0A 3CKCA 5K9SA 2WXQA 4KBQA 4HB5A 5LP0A 3P1UA 1XNFA 3IFQA 4I5LA 4HLLA 3HVEB 5AJLA 5FZQA 4BT9A 1SZ9A 2F0YA 4YDOA 3ZPJA 1QNFA 4BFRA 1TNYA 5BZ1A 2R17C 3AU4A 1FVFA 1FCHA 2VGLB 2XENA 4BETA 3FU3A 3LVQE 3LVRE 3W9FA 1N52A 3L6XA 4LNBA 2XRYA 3Q5MA 1N4SA 2L9BA 4GZ3A 4B8CB 3UM3A 5EKFA 4PUCA 4M3OA 3I3NA 4J8FA 4CT7B 4GZDA 2IEJA 3D9IA 4BSXA 3QG9A 4OAUC 4F6RD 3MV2B 5AIJA 4U0SA 3CSTA 3CV0A 2VJ8A 1ZU2A 3G2WA 3HXBA 4ZHBA 3Q75A 3QB2A 5B1BE 2E2EA 3EBBA 2DVWA 5SW9A 4B8JA 4A63B 1TE4A 4JPSA 4KZ0A 4HVBA 2I2OA 5K6SA 3Q0PA 2DZOA 3LJ3A 4Y5JA 2A5EA 4Y6WA 3D9NA 4MS6A 1NI1A 2E0IA 4V3QA 4W9RA 4MBGA 4ACLA 2IW3A 4J7WA 2KM4A 2QYUA 3FHEA 4FHJA 3UM0A 4DJSA 3FP3A 3FDHA 2CG3A 3SQVA 4KMOA 2J08A 4BTAA 3BWTA 5D0QD 4D4EA 1N95A 4G26A 4LNGA 3JY1A 4U8HA 3SD5A 4BWRA 4AOFA 3LKUA 3SNXA 1DCEA 4DBAA 3ASHA 5BV0A 2Z6HA 4P6ZB 4AEZC 1IALA 1NA3A 3Q78A 4X8QA 3MJWA 3QWWA 4HRMB 4QMHA 3DEPA 2FV2A 4JEHA 2X38A 3P2BA 1V18A 2FI7A 2V0PA 1XQSA 2GROB 4CGWA 3JUIA 2BNXA 2Y69E 3U4TA 3PZ3A 3UKRG 2ZIRA 2I1KA 1W9CA 2BUGA 4A1SA 4GTPA 3D9HA 2H6IA 2J4BA 3UIPC 3ZVVA 1OYZA 2WXHA 4KZCA 2IO2C 3BX2A 3CVPA 4APFA 1AWCB 2FO7A 2VGXA 2XZDG 2XZTG 3TWSA 2V5FA 2BKUB 5CL8A 3LCAA 4HBDA 3QARA 4CT6B 3SO8A 1OY3D 1LRVA 1SZAA 3ASFA 5JMND 4JHKA 3JYSA 4GMJA 1OWMA 1O1TA 3SLAA 3PZDA 4ACKA 4FJYA 2WXPA 5CMWA 4ANXA 4N5QA 1JWGA 3DSVA 5HS0A 4CB9A 1KZOA 4UUCA 5H7PA 5E76A 3WPTA 3SZ7A 2FO1E 3PDNA 4YGXA 2V5QC 4FULA 3QMLC 1Z3YA 2IE3A 4N2QA 3ZIKA 3TG5A 2X6IA 3B7TA 4DZSA 5LOZA 5AQAA 4TXQA 4GA0A 4HRLA 1EPUA 4NRHB 4UWHA 3ZW3A 3EUVA 1OUVA 5FZSA 2HM8A 5HKPA 4CT4A 1OCCE 3L3QA 4EZLA 3V74A 5D2MC 3Q5UA 5AJDA 4GTOA 5JHAA 5KNHD 3Q7FA 1JCRA 5DIZA 3QKYA 3Q15A 2KATA 4URKA 1HG5A 3EHQA 4LACA 3Q0MA 4KVOA 2L0IA 2Y3AA 3ZYKA 1XM9A 4G3AA 3MKQB 3UKZB 1RZ4A 1HF8A 1SA5A 3DSTA 2DCPA 3KD7A 2XPZA 4AV7A 4JL0A 2GRPB 4CGVA 1NP7A 2AWIA 4JW1A 4K5BA 3VE6A 3RK6A 4TXPA 2RD0A 4GU5A 5EWPA 1TR4A 2NYMA 2LO6A 2JKRA 3ZIQA 3ZUVB 1TEZA 4P29A 3NOGD 2IQCA 1Y6IA 2KCLA 1TN7A 4HOUA 4JVSA 2XCCA 3RRNB 3PSTA 4LRZA 3FTWA 5BPPA 3Q0LA 2RU4B 4DX6D 3ISMC 2WXLA 3E4BA 2A5UA 4AY6A 1SQMA 2PM6A 3BVSA 3MEKA 5BV1A 1N4PA 2MOWA 4UQIA 3O2QA 2VSXE 2P9UG 4B18A 2A4ZA 4RSYA 3QHEA 5AEIA 1H19A 4FLBA 3ENEA 3AS4A 5KLTB 3V30A 5D5KC 2C1TA 3CVLA 4F53A 3TWUA 4GMLA 2YHCA 4L2YA 5G05J 5IY5E 4DI3A 3NZUA 2VGYA 3CK8A 4UQZA 3FH7A 1N0QA 2NPPA 4CZ2D 3JXZA 5LX8A 5ENQD 1MHQA 3K5QA 2DBAA 1W63A 3UKUG 4HM9A 4BY6A 4EVPA 4P6ZG 3MZLB 3AJIA 1A17A 2KBXA 2F31A 3D9PA 4C9BB 4FZFA 3C5WA 2VGXB 2R2LA 3ZEFA 2PM7A 1IXVA 3ASNE 3ML9A 3URZA 3CHMA 2P8QA 3WG7E 4HI8A 3ZNGA 2J4DA 1KPSB 5ENTD 4FDDA 3UKYB 2Y0BG 1QGKA 1E7VA 4KT6B 4DLQA 3CVQA 1N54A 3KEZA 4HS2A 5CHEE 1UG3A 4K5CA 3HXCA 4MFVA 3E32A 3TG4A 3ONKA 4I1MA 4FU3A 1NFIE 4LEUA 3GNIA 4U96D 5FZRA 4JW3C 3GZ2A 2WMNA 3KAEA 5CL3A 5AQ7A 5AN8A 3U3WA 1IQRA 2MHKA 1FT2A 2JDQA 4NZWA 4YK6A 5M72A 5EKGA 3TWQA 3TL5A 4PS3A 3PEUB 5CLBA 2GRLA 3T5VA 5CL5A 5SWFA 2QFCA 4JC8A 2EILE 3H3DX 3T9KA 3ZIOA 4H3KA 1U2VG 2KZTA 5EIBE 4U04A 1HXIA 3ZYQA 1H6PA 2C1MA 3TWVA 1XQRA 1OT8A 4I6EA 4GZ5A 1TJFA 2QY7A 4QMJA 3E37A 4I1AA 3CVUA 3ASOE 2NSZA 2F37A 3SHFA 4DB9A 4V3IA 3C3OA 1IBRB 1D8EA 2OEWA 1H2UA 4C0MA 4FZDA 5CBOA 2IAEB 3FUIA 4JLQA 4CV5B 1H6OA 2WVIA 3D9LA 3SBTB 3ZHPA 4HLEA 3DXKG 2KCVA 3ZGQA 3CKBA 1YMPA 4C0EA 4HI9A 2FEZA 5AENA 4RZPA 4NACA 5EX0A 4UAFB 3FTXA 2XA7B 3QJZA 1UPKA 3LY7A 4UI9C 2Z6GA 3V79K 2BKKB 4EHMA 4I7IA 3PE4A 4JEUA 1V54E 4GTTA 4YJEA 3EJNA 1INZA 2OT8A 4G25A 2X6FA 3FUJA 3ULQA 4OYSA 5ITZF 4NURA 4I6IA 4K6JA 3ZIPA 1OWPA 5FQ6A 1QYMA 1B3UA 2ZXWE 3K62A 4EZJA 3L6YA 4U5OA 3LPZA 3LS8A 4Q96A 4LG6A 1ZBPA 3JXJA 3UVUA 4B8AA 2IU1A 3UMVA 4ILHB 3KEAA 5HUWC 2H6FA 2IX3A 1HH8A 3FY4A 2JKTB 4FJZA 4CRUB 4CT0A 1I7WA 2NPPB 1Z6TA 3Q47B 2IFUA 4RG9A 3FUFA 4D10C 2VTBB 3SY2A 3UTMA 5CRUA 4H3HA 3EHMA 4LSZE 5A6CA 4MLPA 1KT1A 2QZAA 3UQ3A 1DC2A 1M5NS 3BSBA 3IBVA 3Q9UC 3C3RA 2JLBA 5JJ6A 2NYLA 2EINE 3TJZB 4B8OA 3FGAB 1E90A 3NZSA 3DSSA 2IOLA 1TNBA 4UWFA 4QFVA 1QZ2A 4UWGA 2X1GF 1MJ0A 1OWOA 3L9TA 3JQ1A 2J09A 4FQ3A 2CHZA 2V4LA 3AS5A 3L13A 1TNUA 4U7EB 5ENOD 2X6KA 1BD8A 3UL1B 4JW2A 1S64A 1JUQA 3Q0OA 4L7MA 3GB8A 3ZN3A 2MYOA 4YVQC 3SF4A 3NB2A 3ND2A 4GA2A 4BEPA 4C48B 4HXTA 3BU8A 3MX3A 5EYLA 5EYPF 3C3QA 1OCOE 2L6BA 1O6PA 2KZTB 4AJWA 1X5BA 3L3FX 4GB9A 3ZHEB 1MX2A 4J8YA 4E85A 2M63A 4IYPA 1E8XA 2WXGA 4RVBA 3WOZA 4UAEA 3CVYA 4ADYA 3OPBA 3FUNA 4ANWA 4OIHA 1VDYA 3BCTA 4A0CA 4RXHB 3JCKC 3UX4A 3OUXA 2HE0A 5A7DB 4U58A 2P9KG 3ZILA 4CBAA 3DEOA 3FEXA 1BI7B 4LERA 3ZINA 5JHBA 3UT7A 3UIOC 4A55A 3APCA 2VQ2A 2ZGDA 2DYRE 5FINA 4JA7A 3J5PA 2CFUA 3J5QB 3GQ2A 2J07A 3N71A 3QOUA 1FT1A 3UKXB 4K92A 1UPLA 4EQFA 1H0AA 4GTVA 4PH4B 2WXRA 3TWRA 2NYJA 4DX1A 2GRNB 4JA9A 3V6YA 2XPIA 3FU6A 4DX5D 2XPYA 5DN7A 1IHGA 1SA4A 3JXYA 2Y4TA 4GPKA 1H2VC 4B89A 5EIDA 4GMRA 2LAHA 3S2AA 3DSWA 3PRZA 4N3CA 3RU0A 2GGFA 2HO1A 3PZ1A 4DB6A 4AVXA 1TNZA 4J6IA 1LUJA 5FIOA 5KL8A 4XI0A 5BYMA 3O2TA 4K0RA 4FP7A 2XGSA 1N4KA 2ZU6B 3ABLE 3CHSA 4ANVA 1ELRA 3K61A 1SW6A 2VSNA 2AXZA 3FH5A 5CRVA 1N4RA 1NZNA 5E75A 1E7UA 5ENPD 2AXVA 3FTYA 3ZKJA 2LSUA 3V31A 1HG2A 2ETCA 3GRLA 3KNDA 4JB8P 4YDYA 3FWVA 1IYGA 3GZ1A 2JABA 1MX6A 3FU0A 5KJKA 2L6JA 3UM2A 4R10A 4YJLA 1KT0A 3Q9NC 4I9EA 3QAQA 2LXLA 3MYVA 1TNOA 2DYSE 2Q5DA 5CBNA 1JDHA 2PF4A 3CVVA 4R11A 4TV3A 2R05A 4G8LA 1KLXA 3CQCB 3HXEA 2MRIA 4YNDA 3R9MA 2Z5MA 1K3ZD 4DK5A 2IONA 3CHQA 4G24A 3DPYA 3SFYA 4FADA 2XEHA 4XEIG 2Z5JA 5JJAA 5AQBA 4WAFA 3GVTA 3CHPA 3UPVA 4GTQA 4CDMA 5HUYC 1G3NB 1PJMB 4EECA 1W3BA 2XEVA 3QWVA 2VYIA 3CVXA 4G23A 2DIWA 4WNGA 4B0ZA 3GVOA 5CL6A 4U5NA 3LWWA 1EF1C 5KLRB 2NXPA 1ZB1A 3L22A 4L2LA 2ONDA 4DX7D 1HFAA 2AW6A 1WDYA 3ZYMA 2XGMA 4F1SA 3FH8A 1E8YA 2NC9A 2CHWA 4ILIA 4MZ5E 3FUKA 4U95D 5C1DA 2YNRA 4WV6A 3HYMB 1HU3A 1IB2A 2QK2A 1WAO1 1D8DA 3W9GA 1E8ZA 3KS2A 3CIAA 3GAEA 1JWFA 3MA5A 5LFAA 4YVOA 3R7RA 3SFZA 2R5SA 4HTVA 2WXOA 4FLHA 2Y1LE 2H4MA 3UKWB 3IHVA 3Q0RA 3HDXA 4H7XA 4HRNA 4UWKA 5BUZA 1UJKA 3LXUX 3IXEA 2DZNA 3RRUA 1PY1A 4TNMA 2GRQB 4I9CA 5BNWA 1QQEA 4DUIA 3FTZA 4JZYA 1BK5A 3VTYA 1P5QA 4UQYA 4KVMA 3JUEA 5KUBA 2Y4UA 1UW4B 3ZFWA 4CRWA 3LY8A 3ZXSA 2F8YA 5KBAA 4U63A 2PL2A 5CL7A 3K5YA 1FPPA 4U5LA 2RKKA 5ANLA 4V3RA 5CL4A 3VTXA 5ARGA 3DSXA 2WQ6A 3ASGA 2KCKA 5CTTA 1N9AA 3PEVB 2P9LG 1O1SA 5T8IA 1U3DA 5BZ5A 3CQGB 4ANUA 2EIME 4AP2A 4I3NA 1Z3XA 1WG0A 3OAWA 3TT9A 3ZXPA 1N0RA 4XKBA 2P9IG 3CK7A 3ODSA 2BEDA 2EIJE 4HOSA 4OVVA 1DVPA 2P9PG 4J8EA 2XS1A 1Z5SC 3EIQC 1YCSB 3WXXA 4XIFA 3DPDA 3FUHA 2V8SE 1S70B 2CG2A 4GYWA 4N5CA 3DBSA 4DPRA 5FQ7A 1E8WA 3HVEA 3O4ZA 4JHRA 3DW8A 2IWHA 4I1OB 4GAAA 1JPPA 2VGLA 2LSVA 4U5SA 4UQXA 3V2XA 5FQ8A 3SFXA 3L16A 3T5XA 4DRXE 4IULA 1PAQA 3R9AB 3ESKA 3I4RB 3UJ4A 3FEXC 2KC7A 2IE4A 2YINA 3A6PA 3CSFA 4K5AB 2VSYA 3B95A 3SGHA 4O1PA 5HQ8A 4PS8A 2RFMA 3K49A 4TUMA 5CLDA 3EHNA 3O48A 4WWOA 4ATZD 3PSPA 3WYFC 4FHKA 5AYWD 5AAOA 1EDUA 3NOWA 1WY6A 3C98A 3AG3E 1QBKB 3F6QA 5B1AE 4FZAA 4G11A 5G04C 5HI7A 3OBVA 1O6OA 5J3VA 3RZ9A 1UN8A 3TX7A 4AY5A 4GCOA 5KNGA 3K4EA 3NOCD 1HS6A 2YHEA 1S0PA 4HNAD 2XCBA 3E30A 5KWDA 3S7DA 1QZ7A 4QMIA 1GW6A 2NYMB 2JKRB 3PH0C 2PNNA 4MKTA 2PQNA 3HIZA 1H6KA 3AG4E 1K8KG 1LD7A 4U8VD 4GA1A 3GZSA 2P2CP 4RLYA 2AXUA 1B89A 2X19B 2P58C 1LF8A 4H7YA 3D9JA 4GYOA 5CECB 3LJNA 3VWAA 4ZDUA 3Q4AB 4UQIB 4BX8A 4UI9J 3PZ2A 2H6HA 2RG8A 5KJLA 4UADA 4BX9A 2YNSA 3K7WA 3LDZA 4CDRA 4U5UA 2L0TB 4EBAA 3ZU7B 4V3OA 5CERB 2F8XK 1BK6A 4CCAA 3BTRC 1S63A 4GYYA 3EIJA 4L9PA 2ZGGA 3VLEA 4WWPA 3TWTA 1N11A 4I2ZA 3HXDA 1IHBA 3OXFA 1W63B 2ILRA 4I96A 3W3UA 3MV3B 4EPZA 4B93B 3BUAA 1WM5A 3CLJA 4PS7A 4XZ4A 5JJTA 3CEQA 3G2SA 3ABKE 1DCQA 3NQPA 3EHRA 3RZXA 3Q79A 1M8XA 4JD2G 4HNMA 4NEEA 4R0ZA 3S7BA 4U3JC 4I1EA 3L54A 4OO6A 2WM9A 2LUHA 2X6JA 3I5PA 3CK9A 1OWNA 4ATGA 3T7UA 2HYZA 1LTXA 3HRAA 4CYMD 2WB2A 3ZYLA 4IMIA 3TWXA 4JKQA 3QDNA 3QWPA 3FTSA 2YQ8A 3CGHA 4CRVB 4G8KA 2EQXA 2QYJA 3PUJA 3QK0A 4B8PA 2Z5NA 3RJVA 2LNIA 5H2XA 1I7XA 5BZUA 1U6GC 3L6AA 1JCQA 3RAUA 5ENNA 1X81A 1SVXA 5J90A 1UN0A 4I8MA 3AS8A 1M8YA 4PVZA 1XGWA 3FTUA 2J49A 5EDSA 3VLDA 3PREA 2Z5KA 3GS3A 3BG1B 3ZRHA 4U0ZA 3ZKVA 3NMXA 3UL0B 1Y8MA 1O1RA 1UKLA 4F7AA 2OV8A 1Q2ZA 1OCRE 3B7BA 1MX4A 1JCSA 2WXFA 1IKND 3LY9A 1KZPA 4KYOB 3ML8A 1YYHA 3Q49B 3S7FA 4Q94A 3FUMA 3PNLB 2ETBA 4XKCA 1TYQG 3V2OA 4D49A 3BEEA 5D0OD 4AM9A 2WPVA 3L17A 5CEDB 3K7VA 3PS6A 2DB0A 3D9KA 5KCMA 4L4HA 4TUUA 3MKQA 3FTVA 3EU9A 3Q0SA 4U5VA 2UY1A 3C5RA 3IBEA 3ODRA 3GW4A 2VSOE 3DRAA 4PLQA 5D66A 4XI9A 5T3RA 2XRZA 4JHJA 4YI0C 3BG0B 3K64A 1UN9A 3GYZA 2CHXA 4BERA 5FJYA 4I0YA 3FEYA 1WA5C 4XZRB 5CCMA 2GW1A 2WMOA 4LNUD 5BT1A 3QNKA 5CLEA 2RU4A 3ULYA 2P9SG 5DBKA 4Z68A 3CVWA 4HQDA 5CCLA 2PKGA 5CMYA 4QQIA 5FTPA 1IQ1C 3Q7AA 3MKRA 5ARFA 3E34A 2Z5OA 3FULA 4MRUA 3UT4A 4N2SA 3K5ZA 4EV8A 3FFLA 5FWQA 3EU5A 3O4XA 3T8KA 1BPOA 4I2SA 3RO3A 1K1AA 1N4QA 4PLRA 3BSXA 3X2QE 3Q0QA 2C0MA 4IMJA 3D9OA 3V71A 3UI2A 4A3VA 1MZCA 4GPMA 4BTBA 4PDXA 3G2TA 4DB8A 4EVTA 2WXNA 5A23A 4GZ6A 4BQKA 4J8SA 4IRUA 2EIKE 1D9SA 4DLOA 2OF3A 4HFGA 3TJ3A 4DJAA 1Y2AC 2NYLB 3B7RL 4UI9K 3ESLA 2C2LA 1M1EA 3D3MA 3T8SA 4BSZB 3RSEG 4O27A 4RG6A 4HORA 1AP7A 5CEAA 1E96B 3OTNA 2J9QA 3SL9A 4GTMA 3NMWA 2LXMA 2OOEA 2WXJA 4BT8A 5KL1A 4GZCA 3ONLA 5H2WA 4JW2B 3R7QA 3IV0A 4ZFHA 1LSHA 4MFUA 4U2XD 4G2VA 5EILA 2JAKA 4F3VA 2I6HA 4WNFA 4XX5A 1PC2A 3QC1A 4TRQA 5BW8C 2QC9A 5CL9A 3FU5A 3U9WA 2BTDA 4GTSA 5FC8E 5EX3A 2BF0X 2IY0C 3PZ4A 4J0UA 2CFZA 1HZ4A 2GRMA 1EE4A 3PVLA 3PNTB 3QGBA 3AG2E 1MYOA 2IO3C 3AAAC 4A3TA 4O1OA 4BA3A 1JPLA 1HO8A 4HOQA 4A1GA 3K9IA 2PZIA 3DWLG 5KLAA 2XHEA 2IF4A 3BX3A 4J8DA 1O5MA 4AXHA 1U3CA 5BXOA 3EG5B 2IJGX 5FT9A 2V4HC 1DNPA 3UUXA 4ME2A 3APFA 4F1PA 3AG1E 2BCTA 2FF4A 3HG0D 3LTMA 4O60A 4NQ0A 2X6HA 1UOHA 2UY1B 2WXMA 3RKVA 3UM1A 2I9CA 2IAEA 3U64A 5LSWA 4CB8A 1BU9A 1NL4A 2WXKA 1Q1SC 4I17A 2XA7A 4U8YD 2AJAA 2FBNA 3JX7A 3EDTB 1OCZE 4WNDA 5FQ4A 2RFAA 4YDEA 3TAXA 3MCXA 5G05C 1H2TC 4RV1A 4M7CA 3HHMA 3AU3A 5B56A 3BQOA 3CR3A 3TXMA 1EJYI 1TJCA 2WTKA 4RQIA 3LYAA 4GTRA 4I6GA 3DSUA 2Q7FA 4FC8A 4JXTA 4OAVB 3B7SA 2OEVA 5ANRA 1JPWA 5ENRD 2XOAA 5HHGE 3TPMA 3TPOA 3C72A 4O6FA 2UWJG 2JKTA 1TN6A 4L4IA 2DWZA 3ZIMA 4EBAG 5CLAA 2I1JA 4U54A 3LTJA 3C2HA 2H6GA 2VTBA 4U07A 1EYHA 4N39A 4L23A 5C2YA 4LCTA 2WQ7A 2P9NG 4ABNA 4L1BA 4LUNU 4G1TA
chains in the Genus database with same CATH topology
1OWLA 2FULA 3OXLA 4WWNA 5CLCA 3G2UA 4Q69A 3JQ0A 3NMZA 4B94A 3O2SA 4KXKB 3FGAA 3QGCA 5E6QB 3WOYA 4EV9A 1Z2CB 1F59A 4L7TA 2AVPA 1G3JA 4GMOA 4PLSA 1EJLI 3AU5A 3IKOB 3L08A 4I6JA 3PUKA 4I37A 4K03A 1ELKA 5KJNA 2HR2A 5LCWC 1TH1A 5KJMA 3MGBA 1QGRA 5G55A 2C0LA 3RO2A 3PE3A 2W3CA 3ASDA 4KZGA 4FA6A 3SI5A 1HE8A 4EZKA 3TXNA 1FVHA 2QK1A 3EA5B 4AIFA 4E6HA 2GL7A 5LCWJ 2X3MA 3RIBA 3S7JA 4FFBC 2QNAA 3ZHEA 3NF1A 3CHOA 3FUEA 1IQUA 3RRMB 1PJNB 3FEYC 3ZIRA 1YA0A 3G2VA 1L5JA 2PQRA 3CHRA 4UWLA 3B7UX 1GCJA 3APDA 1Q1TC 4I43A 5G04J 2LAIA 4BPLA 4WUYA 4OVUA 4N3BA 3CVNA 2XGOA 3VLFA 1ELWA 5BZVA 2WQHA 4DI4A 3OXGA 3FUDA 1T08A 4Y6CA 4N3AA 3B13A 3SBSA 4MZ6E 4GCNA 2YNQA 3I4GA 1UJJA 4CEMA 3UT8A 3U66A 4IN3B 5SVZA 3OQSA 2BAPA 5G2NA 4I5NA 4CDNA 2YJYA 4GMNA 4WNEA 5J08A 5JJ7A 2IOSA 3TGOA 5EKQD 1HX8A 3IHYA 1WA5B 1NA0A 4EVAA 4DVGB 2XQ0A 4UWXA 3DADA 1M8WA 1M8ZA 4E4VA 3IEGA 2QMRA 3C2GA 5T4YA 4R7LA 3LEWA 4APOA 3TJPA 4I2WA 2R59A 3D9MA 2OVFA 3T8MA 4HOTA 3OUWA 4HXIA 1MQSA 2JEKA 2OVBA 4U0UA 2WXIA 3Q0NA 1EE5A 4ILGA 4XE0A 3CKCA 5K9SA 2WXQA 4KBQA 5LP0A 3P1UA 1XNFA 3IFQA 4I5LA 3HVEB 5AJLA 5FZQA 4BT9A 1SZ9A 3ZPJA 1QNFA 4BFRA 5BZ1A 2R17C 3AU4A 1FVFA 1FCHA 2VGLB 3FU3A 3LVQE 3LVRE 1N52A 3L6XA 2XRYA 3Q5MA 2L9BA 4GZ3A 4B8CB 5EKFA 4PUCA 4M3OA 3I3NA 4J8FA 4CT7B 4GZDA 3D9IA 4BSXA 3QG9A 3MV2B 5AIJA 4U0SA 3CSTA 3CV0A 2VJ8A 1ZU2A 3G2WA 3QB2A 2E2EA 3EBBA 5SW9A 4B8JA 1TE4A 4JPSA 4KZ0A 4HVBA 2I2OA 5K6SA 3Q0PA 3LJ3A 4Y5JA 4Y6WA 3D9NA 4MS6A 2E0IA 4V3QA 4W9RA 4ACLA 2IW3A 2KM4A 3FHEA 4FHJA 4DJSA 3FP3A 3FDHA 2CG3A 4KMOA 2J08A 4BTAA 3BWTA 5D0QD 4D4EA 4G26A 3JY1A 4U8HA 3SD5A 4BWRA 4AOFA 3LKUA 3SNXA 4DBAA 3ASHA 5BV0A 2Z6HA 4P6ZB 4AEZC 1IALA 1NA3A 3MJWA 3QWWA 4QMHA 2FV2A 4JEHA 2X38A 3P2BA 1V18A 2FI7A 2V0PA 1XQSA 4CGWA 3JUIA 2BNXA 3U4TA 2I1KA 1W9CA 2BUGA 4A1SA 2J4BA 3ZVVA 1OYZA 2WXHA 4KZCA 3BX2A 3CVPA 4APFA 2FO7A 2VGXA 2V5FA 2BKUB 5CL8A 3LCAA 3QARA 4CT6B 1LRVA 1SZAA 3ASFA 4JHKA 3JYSA 4GMJA 1OWMA 3SLAA 3PZDA 4ACKA 4FJYA 2WXPA 5CMWA 4ANXA 1JWGA 4CB9A 5E76A 3WPTA 3SZ7A 3PDNA 4YGXA 4FULA 3QMLC 1Z3YA 2IE3A 4N2QA 3ZIKA 3TG5A 2X6IA 3B7TA 4DZSA 5LOZA 4GA0A 1EPUA 4NRHB 4UWHA 3ZW3A 1OUVA 5FZSA 2HM8A 4CT4A 3L3QA 4EZLA 3V74A 3Q5UA 5AJDA 5JHAA 5DIZA 3QKYA 3Q15A 2KATA 4URKA 1HG5A 4LACA 3Q0MA 4KVOA 2L0IA 2Y3AA 3ZYKA 1XM9A 4G3AA 3MKQB 3UKZB 1HF8A 2DCPA 3KD7A 2XPZA 4AV7A 4JL0A 4CGVA 1NP7A 2AWIA 4JW1A 3VE6A 3RK6A 2RD0A 4GU5A 5EWPA 2NYMA 2LO6A 2JKRA 3ZIQA 1TEZA 4P29A 2IQCA 1Y6IA 2KCLA 4HOUA 4JVSA 2XCCA 3RRNB 3PSTA 4LRZA 3FTWA 5BPPA 3Q0LA 2RU4B 2WXLA 3E4BA 2A5UA 4AY6A 1SQMA 2PM6A 3BVSA 3MEKA 5BV1A 2MOWA 4UQIA 3O2QA 2VSXE 4B18A 4RSYA 2A4ZA 3QHEA 5AEIA 1H19A 4FLBA 3ENEA 3AS4A 5KLTB 5D5KC 2C1TA 3CVLA 4F53A 4GMLA 2YHCA 4L2YA 5G05J 4DI3A 3NZUA 2VGYA 3CK8A 4UQZA 3FH7A 2NPPA 3JXZA 5LX8A 1MHQA 3K5QA 2DBAA 1W63A 4HM9A 4BY6A 4EVPA 4P6ZG 3MZLB 1A17A 2F31A 3D9PA 4C9BB 4FZFA 3C5WA 2VGXB 3ZEFA 2PM7A 3ML9A 3URZA 3CHMA 2P8QA 2J4DA 4FDDA 3UKYB 1QGKA 1E7VA 4KT6B 4DLQA 3CVQA 5CHEE 1N54A 3KEZA 4HS2A 1UG3A 4MFVA 3TG4A 3ONKA 4I1MA 4FU3A 4LEUA 3GNIA 5FZRA 4JW3C 3GZ2A 2WMNA 3KAEA 5CL3A 3U3WA 1IQRA 2MHKA 2JDQA 4NZWA 4YK6A 5M72A 5EKGA 3TL5A 4PS3A 3PEUB 5CLBA 2GRLA 3T5VA 5CL5A 5SWFA 2QFCA 4JC8A 3H3DX 3ZIOA 4H3KA 2KZTA 4U04A 1HXIA 3ZYQA 2C1MA 1XQRA 4I6EA 4GZ5A 1TJFA 2QY7A 4QMJA 4I1AA 3CVUA 2NSZA 3SHFA 4DB9A 4V3IA 1IBRB 1H2UA 4C0MA 4FZDA 2IAEB 3FUIA 4JLQA 4CV5B 2WVIA 3D9LA 3SBTB 3ZHPA 4HLEA 2KCVA 3ZGQA 3CKBA 4C0EA 2FEZA 5AENA 4RZPA 4NACA 5EX0A 4UAFB 3FTXA 2XA7B 3QJZA 1UPKA 3LY7A 4UI9C 2Z6GA 4I7IA 3PE4A 4JEUA 4YJEA 3EJNA 1INZA 2OT8A 4G25A 2X6FA 3FUJA 3ULQA 4OYSA 4NURA 4I6IA 4K6JA 3ZIPA 1OWPA 5FQ6A 1B3UA 3K62A 4EZJA 3L6YA 4U5OA 3LPZA 3LS8A 4Q96A 1ZBPA 3UVUA 4B8AA 2IU1A 3UMVA 4ILHB 5HUWC 2IX3A 1HH8A 3FY4A 2JKTB 4FJZA 4CRUB 4CT0A 1I7WA 2NPPB 1Z6TA 3Q47B 2IFUA 4RG9A 3FUFA 4D10C 2VTBB 4H3HA 3EHMA 5A6CA 4MLPA 1KT1A 3UQ3A 1M5NS 3BSBA 3IBVA 2JLBA 5JJ6A 2NYLA 3TJZB 4B8OA 3FGAB 1E90A 3NZSA 2IOLA 4UWFA 4QFVA 1QZ2A 4UWGA 2X1GF 1OWOA 3JQ1A 2J09A 4FQ3A 2CHZA 2V4LA 3AS5A 3L13A 2X6KA 3UL1B 4JW2A 1JUQA 3Q0OA 4L7MA 3GB8A 3ZN3A 4YVQC 3SF4A 3ND2A 4GA2A 4HXTA 3MX3A 1O6PA 2KZTB 4AJWA 1X5BA 3L3FX 4GB9A 3ZHEB 4E85A 2M63A 4IYPA 1E8XA 2WXGA 4RVBA 3WOZA 4UAEA 3CVYA 4ADYA 3OPBA 3FUNA 4ANWA 4OIHA 1VDYA 3BCTA 4A0CA 4RXHB 3JCKC 3UX4A 3OUXA 5A7DB 4U58A 3ZILA 4CBAA 3FEXA 4LERA 3ZINA 5JHBA 3UT7A 4A55A 3APCA 2VQ2A 4JA7A 2CFUA 3GQ2A 2J07A 3N71A 3QOUA 3UKXB 4K92A 1UPLA 4EQFA 1H0AA 4PH4B 2WXRA 4JA9A 3V6YA 2XPIA 3FU6A 2XPYA 5DN7A 1IHGA 3JXYA 2Y4TA 4GPKA 1H2VC 4B89A 2LAHA 3S2AA 3PRZA 4N3CA 3RU0A 2GGFA 2HO1A 4DB6A 4AVXA 4J6IA 1LUJA 5KL8A 4XI0A 5BYMA 3O2TA 4K0RA 4FP7A 2XGSA 2ZU6B 3CHSA 4ANVA 1ELRA 3K61A 2VSNA 2AXZA 3FH5A 1NZNA 5E75A 1E7UA 2AXVA 3FTYA 2LSUA 1HG2A 3GRLA 3KNDA 3FWVA 1IYGA 3GZ1A 3FU0A 5KJKA 2L6JA 4R10A 4YJLA 1KT0A 4I9EA 3QAQA 3MYVA 2Q5DA 1JDHA 2PF4A 3CVVA 4R11A 4TV3A 1KLXA 3CQCB 2MRIA 4YNDA 2Z5MA 4DK5A 2IONA 3CHQA 4G24A 4FADA 2Z5JA 5JJAA 4WAFA 3GVTA 3CHPA 3UPVA 4CDMA 5HUYC 1PJMB 4EECA 1W3BA 2XEVA 3QWVA 2VYIA 3CVXA 4G23A 2DIWA 4WNGA 4B0ZA 3GVOA 5CL6A 4U5NA 3LWWA 1EF1C 5KLRB 2NXPA 3L22A 4L2LA 2ONDA 1HFAA 2AW6A 3ZYMA 2XGMA 4F1SA 3FH8A 1E8YA 2NC9A 2CHWA 4ILIA 4MZ5E 3FUKA 5C1DA 2YNRA 4WV6A 3HYMB 1HU3A 1IB2A 2QK2A 1WAO1 1E8ZA 3KS2A 3CIAA 3GAEA 1JWFA 3MA5A 5LFAA 4YVOA 3R7RA 3SFZA 2R5SA 4HTVA 2WXOA 4FLHA 2H4MA 3UKWB 3IHVA 3Q0RA 3HDXA 4H7XA 4UWKA 5BUZA 1UJKA 3LXUX 3RRUA 1PY1A 4TNMA 4I9CA 5BNWA 1QQEA 3FTZA 4JZYA 1BK5A 3VTYA 1P5QA 4UQYA 4KVMA 5KUBA 2Y4UA 1UW4B 3ZFWA 4CRWA 3LY8A 3ZXSA 4U63A 2PL2A 5CL7A 3K5YA 4U5LA 5ANLA 4V3RA 5CL4A 3VTXA 5ARGA 2WQ6A 3ASGA 2KCKA 5CTTA 3PEVB 5T8IA 1U3DA 5BZ5A 3CQGB 4ANUA 4AP2A 4I3NA 1Z3XA 3OAWA 3TT9A 4XKBA 3CK7A 3ODSA 4HOSA 4OVVA 1DVPA 4J8EA 3EIQC 3WXXA 4XIFA 3DPDA 3FUHA 2V8SE 4GYWA 2CG2A 4N5CA 3DBSA 4DPRA 5FQ7A 1E8WA 3HVEA 3O4ZA 4JHRA 3DW8A 2IWHA 4I1OB 4GAAA 1JPPA 2VGLA 2LSVA 4U5SA 4UQXA 5FQ8A 3L16A 3T5XA 4IULA 1PAQA 3R9AB 3ESKA 3I4RB 3FEXC 2KC7A 2IE4A 2YINA 3A6PA 3CSFA 2VSYA 3SGHA 5HQ8A 4PS8A 3K49A 5CLDA 3EHNA 3O48A 4WWOA 3PSPA 3WYFC 4FHKA 5AYWD 1EDUA 3NOWA 1WY6A 3C98A 1QBKB 4FZAA 4G11A 5G04C 5HI7A 3OBVA 1O6OA 5J3VA 3RZ9A 1UN8A 3TX7A 4AY5A 4GCOA 3K4EA 1HS6A 2YHEA 1S0PA 2XCBA 3S7DA 1QZ7A 4QMIA 1GW6A 2NYMB 2JKRB 3PH0C 4MKTA 2PQNA 3HIZA 1H6KA 4GA1A 3GZSA 2AXUA 1B89A 2X19B 2P58C 1LF8A 4H7YA 3D9JA 4GYOA 3VWAA 4ZDUA 3Q4AB 4UQIB 4BX8A 4UI9J 2RG8A 5KJLA 4UADA 4BX9A 2YNSA 3K7WA 3LDZA 4CDRA 4U5UA 2L0TB 4EBAA 4V3OA 1BK6A 4CCAA 3BTRC 4GYYA 3EIJA 3VLEA 4WWPA 4I2ZA 3OXFA 1W63B 2ILRA 4I96A 3W3UA 3MV3B 4EPZA 1WM5A 3CLJA 4PS7A 4XZ4A 5JJTA 3CEQA 3G2SA 3NQPA 3RZXA 1M8XA 4HNMA 4NEEA 4R0ZA 3S7BA 4U3JC 4I1EA 3L54A 4OO6A 2WM9A 2X6JA 3I5PA 3CK9A 1OWNA 4ATGA 3T7UA 2HYZA 2WB2A 3ZYLA 4IMIA 4JKQA 3QDNA 3QWPA 3FTSA 2YQ8A 3CGHA 4CRVB 2EQXA 3PUJA 3QK0A 4B8PA 2Z5NA 3RJVA 2LNIA 5H2XA 1I7XA 5BZUA 1U6GC 3L6AA 5ENNA 5J90A 1UN0A 4I8MA 3AS8A 1M8YA 4PVZA 1XGWA 3FTUA 2J49A 5EDSA 3VLDA 3PREA 2Z5KA 3GS3A 3BG1B 3ZRHA 4U0ZA 3ZKVA 3NMXA 3UL0B 1Y8MA 1UKLA 4F7AA 2OV8A 2WXFA 3LY9A 4KYOB 3ML8A 3Q49B 3S7FA 4Q94A 3FUMA 3PNLB 4XKCA 4D49A 3BEEA 5D0OD 4AM9A 2WPVA 3L17A 3K7VA 3PS6A 2DB0A 3D9KA 5KCMA 4L4HA 4TUUA 3MKQA 3FTVA 3Q0SA 4U5VA 2UY1A 3IBEA 3ODRA 3GW4A 2VSOE 4PLQA 4XI9A 5T3RA 2XRZA 4JHJA 4YI0C 3BG0B 3K64A 1UN9A 3GYZA 2CHXA 5FJYA 4I0YA 3FEYA 1WA5C 4XZRB 5CCMA 2GW1A 2WMOA 5BT1A 3QNKA 5CLEA 2RU4A 5DBKA 3CVWA 5CCLA 2PKGA 5CMYA 5FTPA 1IQ1C 3MKRA 5ARFA 2Z5OA 3FULA 4MRUA 3UT4A 4N2SA 3K5ZA 4EV8A 3FFLA 5FWQA 3O4XA 1BPOA 4I2SA 3RO3A 4PLRA 3BSXA 3Q0QA 2C0MA 4IMJA 3D9OA 3V71A 4A3VA 4BTBA 4PDXA 3G2TA 4DB8A 4EVTA 2WXNA 5A23A 4GZ6A 4BQKA 4J8SA 4IRUA 4DLOA 2OF3A 4HFGA 3TJ3A 4DJAA 1Y2AC 2NYLB 3B7RL 4UI9K 3ESLA 2C2LA 1M1EA 3D3MA 4O27A 4RG6A 4HORA 1E96B 3OTNA 2J9QA 3SL9A 3NMWA 2WXJA 2OOEA 4BT8A 5KL1A 4GZCA 3ONLA 5H2WA 4JW2B 3R7QA 3IV0A 4MFUA 4U2XD 4G2VA 2JAKA 4F3VA 2I6HA 4WNFA 4XX5A 1PC2A 3QC1A 4TRQA 5BW8C 5CL9A 3FU5A 3U9WA 2BTDA 5FC8E 5EX3A 2BF0X 4J0UA 2CFZA 1HZ4A 2GRMA 1EE4A 3PVLA 3PNTB 3QGBA 4A3TA 4BA3A 1JPLA 1HO8A 4HOQA 4A1GA 3K9IA 2PZIA 5KLAA 2XHEA 2IF4A 3BX3A 4J8DA 4AXHA 1U3CA 3EG5B 2IJGX 5FT9A 1DNPA 3UUXA 4ME2A 3APFA 2BCTA 2FF4A 3LTMA 4NQ0A 2X6HA 2UY1B 2WXMA 3RKVA 2I9CA 2IAEA 3U64A 5LSWA 4CB8A 2WXKA 1Q1SC 4I17A 2XA7A 2FBNA 3JX7A 3EDTB 4WNDA 5FQ4A 3TAXA 3MCXA 5G05C 1H2TC 4RV1A 3HHMA 3AU3A 5B56A 3CR3A 3TXMA 1EJYI 1TJCA 2WTKA 3LYAA 4I6GA 2Q7FA 4FC8A 4JXTA 3B7SA 5ANRA 1JPWA 2XOAA 5HHGE 3TPMA 3TPOA 4O6FA 2UWJG 2JKTA 4L4IA 3ZIMA 4EBAG 5CLAA 2I1JA 4U54A 3LTJA 3C2HA 2VTBA 4U07A 1EYHA 4N39A 4L23A 5C2YA 4LCTA 2WQ7A 4ABNA 4L1BA 4LUNU 4G1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VLE A;  3VLD A;  3VLF A;  4A3V A;  4A3T A;  4FP7 A; 
#chains in the Genus database with same CATH topology
 1OWL A;  2FUL A;  3OXL A;  4WWN A;  5CLC A;  2VGE A;  3G2U A;  5AAR A;  4Q69 A;  3JQ0 A;  2GRR B;  4YDW A;  3NMZ A;  4B94 A;  3O2S A;  4KXK B;  3FGA A;  3ULE G;  3QGC A;  5E6Q B;  3WOY A;  4EV9 A;  1Z2C B;  1F59 A;  4L7T A;  2AVP A;  1G3J A;  4GMO A;  4PLS A;  1EJL I;  3AU5 A;  3DXM G;  3IKO B;  3L08 A;  4I6J A;  3PUK A;  4I37 A;  4K03 A;  1ELK A;  5KJN A;  2HR2 A;  5LCW C;  1TH1 A;  5KJM A;  3MGB A;  1V55 E;  1QGR A;  5G55 A;  2C0L A;  3RO2 A;  3PE3 A;  2W3C A;  3ASD A;  4KZG A;  4FA6 A;  3SI5 A;  1HE8 A;  1BLX B;  2B6C A;  2B0O E;  4EZK A;  3TXN A;  1FVH A;  2QK1 A;  1LD8 A;  3EA5 B;  4AIF A;  4BES A;  4E6H A;  2XEE A;  2GL7 A;  5LCW J;  5B3S E;  2X3M A;  3RIB A;  3S7J A;  4FFB C;  1OXJ A;  2QNA A;  3ZHE A;  3NF1 A;  3CHO A;  3FUE A;  1TN8 A;  1IQU A;  2BKG A;  3RRM B;  1PJN B;  1RW2 A;  3FEY C;  5HRY A;  3ZIR A;  1YA0 A;  3G2V A;  1L5J A;  2OCC E;  2PQR A;  3CHR A;  2J8S D;  4UWL A;  3B7U X;  1QBQ A;  5JA4 D;  1K1B A;  2KXP C;  1GCJ A;  3APD A;  1Q1T C;  4I43 A;  5G04 J;  2LAI A;  4BPL A;  3HXF A;  4WUY A;  3UXG A;  4OVU A;  4N3B A;  3CVN A;  2XGO A;  3VLF A;  1ELW A;  5BZV A;  2WQH A;  4DI4 A;  3OXG A;  3FUD A;  1T08 A;  3NAW A;  4Y6C A;  3NBN B;  4N3A A;  3B13 A;  3SBS A;  3JXI A;  4MZ6 E;  4GCN A;  2YNQ A;  2R03 A;  3I4G A;  1UJJ A;  4CEM A;  3UT8 A;  3U66 A;  4IN3 B;  5SVZ A;  3OQS A;  3UJ0 A;  2BAP A;  3E33 A;  5BXU A;  5G2N A;  4DX2 A;  4I5N A;  2XS8 A;  4CDN A;  2YJY A;  4GMN A;  4WNE A;  5J08 A;  3KSQ A;  5JJ7 A;  2IOS A;  3TGO A;  5EKQ D;  1HX8 A;  3IHY A;  5ENS D;  1WA5 B;  3ABM E;  1NA0 A;  4EVA A;  3L82 A;  4DVG B;  2XQ0 A;  4UWX A;  3DAD A;  1M8W A;  1M8Z A;  4E4V A;  3IEG A;  2QMR A;  3C2G A;  5T4Y A;  4R7L A;  3LEW A;  2ETA A;  1N94 A;  4APO A;  3TJP A;  4I2W A;  2R59 A;  1A5E A;  2ZIS A;  3UIN C;  4TXR A;  3D9M A;  2OVF A;  3T8M A;  2R02 A;  4NIK A;  3KSL A;  4HOT A;  3OUW A;  4HXI A;  1MQS A;  2JEK A;  2OVB A;  4U0U A;  2WXI A;  3Q0N A;  5EN5 D;  3Q73 A;  1EE5 A;  5AQ9 A;  1BI8 B;  3TWW A;  4ILG A;  4XE0 A;  3CKC A;  5K9S A;  2WXQ A;  4KBQ A;  4HB5 A;  5LP0 A;  3P1U A;  1XNF A;  3IFQ A;  4I5L A;  4HLL A;  3HVE B;  5AJL A;  5FZQ A;  4BT9 A;  1SZ9 A;  2F0Y A;  4YDO A;  3ZPJ A;  1QNF A;  4BFR A;  1TNY A;  5BZ1 A;  2R17 C;  3AU4 A;  1FVF A;  1FCH A;  2VGL B;  2XEN A;  4BET A;  3FU3 A;  3LVQ E;  3LVR E;  3W9F A;  1N52 A;  3L6X A;  4LNB A;  2XRY A;  3Q5M A;  1N4S A;  2L9B A;  4GZ3 A;  4B8C B;  3UM3 A;  5EKF A;  4PUC A;  4M3O A;  3I3N A;  4J8F A;  4CT7 B;  4GZD A;  2IEJ A;  3D9I A;  4BSX A;  3QG9 A;  4OAU C;  4F6R D;  3MV2 B;  5AIJ A;  4U0S A;  3CST A;  3CV0 A;  2VJ8 A;  1ZU2 A;  3G2W A;  3HXB A;  4ZHB A;  3Q75 A;  3QB2 A;  5B1B E;  2E2E A;  3EBB A;  2DVW A;  5SW9 A;  4B8J A;  4A63 B;  1TE4 A;  4JPS A;  4KZ0 A;  4HVB A;  2I2O A;  5K6S A;  3Q0P A;  2DZO A;  3LJ3 A;  4Y5J A;  2A5E A;  4Y6W A;  3D9N A;  4MS6 A;  1NI1 A;  2E0I A;  4V3Q A;  4W9R A;  4MBG A;  4ACL A;  2IW3 A;  4J7W A;  2KM4 A;  2QYU A;  3FHE A;  4FHJ A;  3UM0 A;  4DJS A;  3FP3 A;  3FDH A;  2CG3 A;  3SQV A;  4KMO A;  2J08 A;  4BTA A;  3BWT A;  5D0Q D;  4D4E A;  1N95 A;  4G26 A;  4LNG A;  3JY1 A;  4U8H A;  3SD5 A;  4BWR A;  4AOF A;  3LKU A;  3SNX A;  1DCE A;  4DBA A;  3ASH A;  5BV0 A;  2Z6H A;  4P6Z B;  4AEZ C;  1IAL A;  1NA3 A;  3Q78 A;  4X8Q A;  3MJW A;  3QWW A;  4HRM B;  4QMH A;  3DEP A;  2FV2 A;  4JEH A;  2X38 A;  3P2B A;  1V18 A;  2FI7 A;  2V0P A;  1XQS A;  2GRO B;  4CGW A;  3JUI A;  2BNX A;  2Y69 E;  3U4T A;  3PZ3 A;  3UKR G;  2ZIR A;  2I1K A;  1W9C A;  2BUG A;  4A1S A;  4GTP A;  3D9H A;  2H6I A;  2J4B A;  3UIP C;  3ZVV A;  1OYZ A;  2WXH A;  4KZC A;  2IO2 C;  3BX2 A;  3CVP A;  4APF A;  1AWC B;  2FO7 A;  2VGX A;  2XZD G;  2XZT G;  3TWS A;  2V5F A;  2BKU B;  5CL8 A;  3LCA A;  4HBD A;  3QAR A;  4CT6 B;  3SO8 A;  1OY3 D;  1LRV A;  1SZA A;  3ASF A;  5JMN D;  4JHK A;  3JYS A;  4GMJ A;  1OWM A;  1O1T A;  3SLA A;  3PZD A;  4ACK A;  4FJY A;  2WXP A;  5CMW A;  4ANX A;  4N5Q A;  1JWG A;  3DSV A;  5HS0 A;  4CB9 A;  1KZO A;  4UUC A;  5H7P A;  5E76 A;  3WPT A;  3SZ7 A;  2FO1 E;  3PDN A;  4YGX A;  2V5Q C;  4FUL A;  3QML C;  1Z3Y A;  2IE3 A;  4N2Q A;  3ZIK A;  3TG5 A;  2X6I A;  3B7T A;  4DZS A;  5LOZ A;  5AQA A;  4TXQ A;  4GA0 A;  4HRL A;  1EPU A;  4NRH B;  4UWH A;  3ZW3 A;  3EUV A;  1OUV A;  5FZS A;  2HM8 A;  5HKP A;  4CT4 A;  1OCC E;  3L3Q A;  4EZL A;  3V74 A;  5D2M C;  3Q5U A;  5AJD A;  4GTO A;  5JHA A;  5KNH D;  3Q7F A;  1JCR A;  5DIZ A;  3QKY A;  3Q15 A;  2KAT A;  4URK A;  1HG5 A;  3EHQ A;  4LAC A;  3Q0M A;  4KVO A;  2L0I A;  2Y3A A;  3ZYK A;  1XM9 A;  4G3A A;  3MKQ B;  3UKZ B;  1RZ4 A;  1HF8 A;  1SA5 A;  3DST A;  2DCP A;  3KD7 A;  2XPZ A;  4AV7 A;  4JL0 A;  2GRP B;  4CGV A;  1NP7 A;  2AWI A;  4JW1 A;  4K5B A;  3VE6 A;  3RK6 A;  4TXP A;  2RD0 A;  4GU5 A;  5EWP A;  1TR4 A;  2NYM A;  2LO6 A;  2JKR A;  3ZIQ A;  3ZUV B;  1TEZ A;  4P29 A;  3NOG D;  2IQC A;  1Y6I A;  2KCL A;  1TN7 A;  4HOU A;  4JVS A;  2XCC A;  3RRN B;  3PST A;  4LRZ A;  3FTW A;  5BPP A;  3Q0L A;  2RU4 B;  4DX6 D;  3ISM C;  2WXL A;  3E4B A;  2A5U A;  4AY6 A;  1SQM A;  2PM6 A;  3BVS A;  3MEK A;  5BV1 A;  1N4P A;  2MOW A;  4UQI A;  3O2Q A;  2VSX E;  2P9U G;  4B18 A;  2A4Z A;  4RSY A;  3QHE A;  5AEI A;  1H19 A;  4FLB A;  3ENE A;  3AS4 A;  5KLT B;  3V30 A;  5D5K C;  2C1T A;  3CVL A;  4F53 A;  3TWU A;  4GML A;  2YHC A;  4L2Y A;  5G05 J;  5IY5 E;  4DI3 A;  3NZU A;  2VGY A;  3CK8 A;  4UQZ A;  3FH7 A;  1N0Q A;  2NPP A;  4CZ2 D;  3JXZ A;  5LX8 A;  5ENQ D;  1MHQ A;  3K5Q A;  2DBA A;  1W63 A;  3UKU G;  4HM9 A;  4BY6 A;  4EVP A;  4P6Z G;  3MZL B;  3AJI A;  1A17 A;  2KBX A;  2F31 A;  3D9P A;  4C9B B;  4FZF A;  3C5W A;  2VGX B;  2R2L A;  3ZEF A;  2PM7 A;  1IXV A;  3ASN E;  3ML9 A;  3URZ A;  3CHM A;  2P8Q A;  3WG7 E;  4HI8 A;  3ZNG A;  2J4D A;  1KPS B;  5ENT D;  4FDD A;  3UKY B;  2Y0B G;  1QGK A;  1E7V A;  4KT6 B;  4DLQ A;  3CVQ A;  1N54 A;  3KEZ A;  4HS2 A;  5CHE E;  1UG3 A;  4K5C A;  3HXC A;  4MFV A;  3E32 A;  3TG4 A;  3ONK A;  4I1M A;  4FU3 A;  1NFI E;  4LEU A;  3GNI A;  4U96 D;  5FZR A;  4JW3 C;  3GZ2 A;  2WMN A;  3KAE A;  5CL3 A;  5AQ7 A;  5AN8 A;  3U3W A;  1IQR A;  2MHK A;  1FT2 A;  2JDQ A;  4NZW A;  4YK6 A;  5M72 A;  5EKG A;  3TWQ A;  3TL5 A;  4PS3 A;  3PEU B;  5CLB A;  2GRL A;  3T5V A;  5CL5 A;  5SWF A;  2QFC A;  4JC8 A;  2EIL E;  3H3D X;  3T9K A;  3ZIO A;  4H3K A;  1U2V G;  2KZT A;  5EIB E;  4U04 A;  1HXI A;  3ZYQ A;  1H6P A;  2C1M A;  3TWV A;  1XQR A;  1OT8 A;  4I6E A;  4GZ5 A;  1TJF A;  2QY7 A;  4QMJ A;  3E37 A;  4I1A A;  3CVU A;  3ASO E;  2NSZ A;  2F37 A;  3SHF A;  4DB9 A;  4V3I A;  3C3O A;  1IBR B;  1D8E A;  2OEW A;  1H2U A;  4C0M A;  4FZD A;  5CBO A;  2IAE B;  3FUI A;  4JLQ A;  4CV5 B;  1H6O A;  2WVI A;  3D9L A;  3SBT B;  3ZHP A;  4HLE A;  3DXK G;  2KCV A;  3ZGQ A;  3CKB A;  1YMP A;  4C0E A;  4HI9 A;  2FEZ A;  5AEN A;  4RZP A;  4NAC A;  5EX0 A;  4UAF B;  3FTX A;  2XA7 B;  3QJZ A;  1UPK A;  3LY7 A;  4UI9 C;  2Z6G A;  3V79 K;  2BKK B;  4EHM A;  4I7I A;  3PE4 A;  4JEU A;  1V54 E;  4GTT A;  4YJE A;  3EJN A;  1INZ A;  2OT8 A;  4G25 A;  2X6F A;  3FUJ A;  3ULQ A;  4OYS A;  5ITZ F;  4NUR A;  4I6I A;  4K6J A;  3ZIP A;  1OWP A;  5FQ6 A;  1QYM A;  1B3U A;  2ZXW E;  3K62 A;  4EZJ A;  3L6Y A;  4U5O A;  3LPZ A;  3LS8 A;  4Q96 A;  4LG6 A;  1ZBP A;  3JXJ A;  3UVU A;  4B8A A;  2IU1 A;  3UMV A;  4ILH B;  3KEA A;  5HUW C;  2H6F A;  2IX3 A;  1HH8 A;  3FY4 A;  2JKT B;  4FJZ A;  4CRU B;  4CT0 A;  1I7W A;  2NPP B;  1Z6T A;  3Q47 B;  2IFU A;  4RG9 A;  3FUF A;  4D10 C;  2VTB B;  3SY2 A;  3UTM A;  5CRU A;  4H3H A;  3EHM A;  4LSZ E;  5A6C A;  4MLP A;  1KT1 A;  2QZA A;  3UQ3 A;  1DC2 A;  1M5N S;  3BSB A;  3IBV A;  3Q9U C;  3C3R A;  2JLB A;  5JJ6 A;  2NYL A;  2EIN E;  3TJZ B;  4B8O A;  3FGA B;  1E90 A;  3NZS A;  3DSS A;  2IOL A;  1TNB A;  4UWF A;  4QFV A;  1QZ2 A;  4UWG A;  2X1G F;  1MJ0 A;  1OWO A;  3L9T A;  3JQ1 A;  2J09 A;  4FQ3 A;  2CHZ A;  2V4L A;  3AS5 A;  3L13 A;  1TNU A;  4U7E B;  5ENO D;  2X6K A;  1BD8 A;  3UL1 B;  4JW2 A;  1S64 A;  1JUQ A;  3Q0O A;  4L7M A;  3GB8 A;  3ZN3 A;  2MYO A;  4YVQ C;  3SF4 A;  3NB2 A;  3ND2 A;  4GA2 A;  4BEP A;  4C48 B;  4HXT A;  3BU8 A;  3MX3 A;  5EYL A;  5EYP F;  3C3Q A;  1OCO E;  2L6B A;  1O6P A;  2KZT B;  4AJW A;  1X5B A;  3L3F X;  4GB9 A;  3ZHE B;  1MX2 A;  4J8Y A;  4E85 A;  2M63 A;  4IYP A;  1E8X A;  2WXG A;  4RVB A;  3WOZ A;  4UAE A;  3CVY A;  4ADY A;  3OPB A;  3FUN A;  4ANW A;  4OIH A;  1VDY A;  3BCT A;  4A0C A;  4RXH B;  3JCK C;  3UX4 A;  3OUX A;  2HE0 A;  5A7D B;  4U58 A;  2P9K G;  3ZIL A;  4CBA A;  3DEO A;  3FEX A;  1BI7 B;  4LER A;  3ZIN A;  5JHB A;  3UT7 A;  3UIO C;  4A55 A;  3APC A;  2VQ2 A;  2ZGD A;  2DYR E;  5FIN A;  4JA7 A;  3J5P A;  2CFU A;  3J5Q B;  3GQ2 A;  2J07 A;  3N71 A;  3QOU A;  1FT1 A;  3UKX B;  4K92 A;  1UPL A;  4EQF A;  1H0A A;  4GTV A;  4PH4 B;  2WXR A;  3TWR A;  2NYJ A;  4DX1 A;  2GRN B;  4JA9 A;  3V6Y A;  2XPI A;  3FU6 A;  4DX5 D;  2XPY A;  5DN7 A;  1IHG A;  1SA4 A;  3JXY A;  2Y4T A;  4GPK A;  1H2V C;  4B89 A;  5EID A;  4GMR A;  2LAH A;  3S2A A;  3DSW A;  3PRZ A;  4N3C A;  3RU0 A;  2GGF A;  2HO1 A;  3PZ1 A;  4DB6 A;  4AVX A;  1TNZ A;  4J6I A;  1LUJ A;  5FIO A;  5KL8 A;  4XI0 A;  5BYM A;  3O2T A;  4K0R A;  4FP7 A;  2XGS A;  1N4K A;  2ZU6 B;  3ABL E;  3CHS A;  4ANV A;  1ELR A;  3K61 A;  1SW6 A;  2VSN A;  2AXZ A;  3FH5 A;  5CRV A;  1N4R A;  1NZN A;  5E75 A;  1E7U A;  5ENP D;  2AXV A;  3FTY A;  3ZKJ A;  2LSU A;  3V31 A;  1HG2 A;  2ETC A;  3GRL A;  3KND A;  4JB8 P;  4YDY A;  3FWV A;  1IYG A;  3GZ1 A;  2JAB A;  1MX6 A;  3FU0 A;  5KJK A;  2L6J A;  3UM2 A;  4R10 A;  4YJL A;  1KT0 A;  3Q9N C;  4I9E A;  3QAQ A;  2LXL A;  3MYV A;  1TNO A;  2DYS E;  2Q5D A;  5CBN A;  1JDH A;  2PF4 A;  3CVV A;  4R11 A;  4TV3 A;  2R05 A;  4G8L A;  1KLX A;  3CQC B;  3HXE A;  2MRI A;  4YND A;  3R9M A;  2Z5M A;  1K3Z D;  4DK5 A;  2ION A;  3CHQ A;  4G24 A;  3DPY A;  3SFY A;  4FAD A;  2XEH A;  4XEI G;  2Z5J A;  5JJA A;  5AQB A;  4WAF A;  3GVT A;  3CHP A;  3UPV A;  4GTQ A;  4CDM A;  5HUY C;  1G3N B;  1PJM B;  4EEC A;  1W3B A;  2XEV A;  3QWV A;  2VYI A;  3CVX A;  4G23 A;  2DIW A;  4WNG A;  4B0Z A;  3GVO A;  5CL6 A;  4U5N A;  3LWW A;  1EF1 C;  5KLR B;  2NXP A;  1ZB1 A;  3L22 A;  4L2L A;  2OND A;  4DX7 D;  1HFA A;  2AW6 A;  1WDY A;  3ZYM A;  2XGM A;  4F1S A;  3FH8 A;  1E8Y A;  2NC9 A;  2CHW A;  4ILI A;  4MZ5 E;  3FUK A;  4U95 D;  5C1D A;  2YNR A;  4WV6 A;  3HYM B;  1HU3 A;  1IB2 A;  2QK2 A;  1WAO 1;  1D8D A;  3W9G A;  1E8Z A;  3KS2 A;  3CIA A;  3GAE A;  1JWF A;  3MA5 A;  5LFA A;  4YVO A;  3R7R A;  3SFZ A;  2R5S A;  4HTV A;  2WXO A;  4FLH A;  2Y1L E;  2H4M A;  3UKW B;  3IHV A;  3Q0R A;  3HDX A;  4H7X A;  4HRN A;  4UWK A;  5BUZ A;  1UJK A;  3LXU X;  3IXE A;  2DZN A;  3RRU A;  1PY1 A;  4TNM A;  2GRQ B;  4I9C A;  5BNW A;  1QQE A;  4DUI A;  3FTZ A;  4JZY A;  1BK5 A;  3VTY A;  1P5Q A;  4UQY A;  4KVM A;  3JUE A;  5KUB A;  2Y4U A;  1UW4 B;  3ZFW A;  4CRW A;  3LY8 A;  3ZXS A;  2F8Y A;  5KBA A;  4U63 A;  2PL2 A;  5CL7 A;  3K5Y A;  1FPP A;  4U5L A;  2RKK A;  5ANL A;  4V3R A;  5CL4 A;  3VTX A;  5ARG A;  3DSX A;  2WQ6 A;  3ASG A;  2KCK A;  5CTT A;  1N9A A;  3PEV B;  2P9L G;  1O1S A;  5T8I A;  1U3D A;  5BZ5 A;  3CQG B;  4ANU A;  2EIM E;  4AP2 A;  4I3N A;  1Z3X A;  1WG0 A;  3OAW A;  3TT9 A;  3ZXP A;  1N0R A;  4XKB A;  2P9I G;  3CK7 A;  3ODS A;  2BED A;  2EIJ E;  4HOS A;  4OVV A;  1DVP A;  2P9P G;  4J8E A;  2XS1 A;  1Z5S C;  3EIQ C;  1YCS B;  3WXX A;  4XIF A;  3DPD A;  3FUH A;  2V8S E;  1S70 B;  2CG2 A;  4GYW A;  4N5C A;  3DBS A;  4DPR A;  5FQ7 A;  1E8W A;  3HVE A;  3O4Z A;  4JHR A;  3DW8 A;  2IWH A;  4I1O B;  4GAA A;  1JPP A;  2VGL A;  2LSV A;  4U5S A;  4UQX A;  3V2X A;  5FQ8 A;  3SFX A;  3L16 A;  3T5X A;  4DRX E;  4IUL A;  1PAQ A;  3R9A B;  3ESK A;  3I4R B;  3UJ4 A;  3FEX C;  2KC7 A;  2IE4 A;  2YIN A;  3A6P A;  3CSF A;  4K5A B;  2VSY A;  3B95 A;  3SGH A;  4O1P A;  5HQ8 A;  4PS8 A;  2RFM A;  3K49 A;  4TUM A;  5CLD A;  3EHN A;  3O48 A;  4WWO A;  4ATZ D;  3PSP A;  3WYF C;  4FHK A;  5AYW D;  5AAO A;  1EDU A;  3NOW A;  1WY6 A;  3C98 A;  3AG3 E;  1QBK B;  3F6Q A;  5B1A E;  4FZA A;  4G11 A;  5G04 C;  5HI7 A;  3OBV A;  1O6O A;  5J3V A;  3RZ9 A;  1UN8 A;  3TX7 A;  4AY5 A;  4GCO A;  5KNG A;  3K4E A;  3NOC D;  1HS6 A;  2YHE A;  1S0P A;  4HNA D;  2XCB A;  3E30 A;  5KWD A;  3S7D A;  1QZ7 A;  4QMI A;  1GW6 A;  2NYM B;  2JKR B;  3PH0 C;  2PNN A;  4MKT A;  2PQN A;  3HIZ A;  1H6K A;  3AG4 E;  1K8K G;  1LD7 A;  4U8V D;  4GA1 A;  3GZS A;  2P2C P;  4RLY A;  2AXU A;  1B89 A;  2X19 B;  2P58 C;  1LF8 A;  4H7Y A;  3D9J A;  4GYO A;  5CEC B;  3LJN A;  3VWA A;  4ZDU A;  3Q4A B;  4UQI B;  4BX8 A;  4UI9 J;  3PZ2 A;  2H6H A;  2RG8 A;  5KJL A;  4UAD A;  4BX9 A;  2YNS A;  3K7W A;  3LDZ A;  4CDR A;  4U5U A;  2L0T B;  4EBA A;  3ZU7 B;  4V3O A;  5CER B;  2F8X K;  1BK6 A;  4CCA A;  3BTR C;  1S63 A;  4GYY A;  3EIJ A;  4L9P A;  2ZGG A;  3VLE A;  4WWP A;  3TWT A;  1N11 A;  4I2Z A;  3HXD A;  1IHB A;  3OXF A;  1W63 B;  2ILR A;  4I96 A;  3W3U A;  3MV3 B;  4EPZ A;  4B93 B;  3BUA A;  1WM5 A;  3CLJ A;  4PS7 A;  4XZ4 A;  5JJT A;  3CEQ A;  3G2S A;  3ABK E;  1DCQ A;  3NQP A;  3EHR A;  3RZX A;  3Q79 A;  1M8X A;  4JD2 G;  4HNM A;  4NEE A;  4R0Z A;  3S7B A;  4U3J C;  4I1E A;  3L54 A;  4OO6 A;  2WM9 A;  2LUH A;  2X6J A;  3I5P A;  3CK9 A;  1OWN A;  4ATG A;  3T7U A;  2HYZ A;  1LTX A;  3HRA A;  4CYM D;  2WB2 A;  3ZYL A;  4IMI A;  3TWX A;  4JKQ A;  3QDN A;  3QWP A;  3FTS A;  2YQ8 A;  3CGH A;  4CRV B;  4G8K A;  2EQX A;  2QYJ A;  3PUJ A;  3QK0 A;  4B8P A;  2Z5N A;  3RJV A;  2LNI A;  5H2X A;  1I7X A;  5BZU A;  1U6G C;  3L6A A;  1JCQ A;  3RAU A;  5ENN A;  1X81 A;  1SVX A;  5J90 A;  1UN0 A;  4I8M A;  3AS8 A;  1M8Y A;  4PVZ A;  1XGW A;  3FTU A;  2J49 A;  5EDS A;  3VLD A;  3PRE A;  2Z5K A;  3GS3 A;  3BG1 B;  3ZRH A;  4U0Z A;  3ZKV A;  3NMX A;  3UL0 B;  1Y8M A;  1O1R A;  1UKL A;  4F7A A;  2OV8 A;  1Q2Z A;  1OCR E;  3B7B A;  1MX4 A;  1JCS A;  2WXF A;  1IKN D;  3LY9 A;  1KZP A;  4KYO B;  3ML8 A;  1YYH A;  3Q49 B;  3S7F A;  4Q94 A;  3FUM A;  3PNL B;  2ETB A;  4XKC A;  1TYQ G;  3V2O A;  4D49 A;  3BEE A;  5D0O D;  4AM9 A;  2WPV A;  3L17 A;  5CED B;  3K7V A;  3PS6 A;  2DB0 A;  3D9K A;  5KCM A;  4L4H A;  4TUU A;  3MKQ A;  3FTV A;  3EU9 A;  3Q0S A;  4U5V A;  2UY1 A;  3C5R A;  3IBE A;  3ODR A;  3GW4 A;  2VSO E;  3DRA A;  4PLQ A;  5D66 A;  4XI9 A;  5T3R A;  2XRZ A;  4JHJ A;  4YI0 C;  3BG0 B;  3K64 A;  1UN9 A;  3GYZ A;  2CHX A;  4BER A;  5FJY A;  4I0Y A;  3FEY A;  1WA5 C;  4XZR B;  5CCM A;  2GW1 A;  2WMO A;  4LNU D;  5BT1 A;  3QNK A;  5CLE A;  2RU4 A;  3ULY A;  2P9S G;  5DBK A;  4Z68 A;  3CVW A;  4HQD A;  5CCL A;  2PKG A;  5CMY A;  4QQI A;  5FTP A;  1IQ1 C;  3Q7A A;  3MKR A;  5ARF A;  3E34 A;  2Z5O A;  3FUL A;  4MRU A;  3UT4 A;  4N2S A;  3K5Z A;  4EV8 A;  3FFL A;  5FWQ A;  3EU5 A;  3O4X A;  3T8K A;  1BPO A;  4I2S A;  3RO3 A;  1K1A A;  1N4Q A;  4PLR A;  3BSX A;  3X2Q E;  3Q0Q A;  2C0M A;  4IMJ A;  3D9O A;  3V71 A;  3UI2 A;  4A3V A;  1MZC A;  4GPM A;  4BTB A;  4PDX A;  3G2T A;  4DB8 A;  4EVT A;  2WXN A;  5A23 A;  4GZ6 A;  4BQK A;  4J8S A;  4IRU A;  2EIK E;  1D9S A;  4DLO A;  2OF3 A;  4HFG A;  3TJ3 A;  4DJA A;  1Y2A C;  2NYL B;  3B7R L;  4UI9 K;  3ESL A;  2C2L A;  1M1E A;  3D3M A;  3T8S A;  4BSZ B;  3RSE G;  4O27 A;  4RG6 A;  4HOR A;  1AP7 A;  5CEA A;  1E96 B;  3OTN A;  2J9Q A;  3SL9 A;  4GTM A;  3NMW A;  2LXM A;  2OOE A;  2WXJ A;  4BT8 A;  5KL1 A;  4GZC A;  3ONL A;  5H2W A;  4JW2 B;  3R7Q A;  3IV0 A;  4ZFH A;  1LSH A;  4MFU A;  4U2X D;  4G2V A;  5EIL A;  2JAK A;  4F3V A;  2I6H A;  4WNF A;  4XX5 A;  1PC2 A;  3QC1 A;  4TRQ A;  5BW8 C;  2QC9 A;  5CL9 A;  3FU5 A;  3U9W A;  2BTD A;  4GTS A;  5FC8 E;  5EX3 A;  2BF0 X;  2IY0 C;  3PZ4 A;  4J0U A;  2CFZ A;  1HZ4 A;  2GRM A;  1EE4 A;  3PVL A;  3PNT B;  3QGB A;  3AG2 E;  1MYO A;  2IO3 C;  3AAA C;  4A3T A;  4O1O A;  4BA3 A;  1JPL A;  1HO8 A;  4HOQ A;  4A1G A;  3K9I A;  2PZI A;  3DWL G;  5KLA A;  2XHE A;  2IF4 A;  3BX3 A;  4J8D A;  1O5M A;  4AXH A;  1U3C A;  5BXO A;  3EG5 B;  2IJG X;  5FT9 A;  2V4H C;  1DNP A;  3UUX A;  4ME2 A;  3APF A;  4F1P A;  3AG1 E;  2BCT A;  2FF4 A;  3HG0 D;  3LTM A;  4O60 A;  4NQ0 A;  2X6H A;  1UOH A;  2UY1 B;  2WXM A;  3RKV A;  3UM1 A;  2I9C A;  2IAE A;  3U64 A;  5LSW A;  4CB8 A;  1BU9 A;  1NL4 A;  2WXK A;  1Q1S C;  4I17 A;  2XA7 A;  4U8Y D;  2AJA A;  2FBN A;  3JX7 A;  3EDT B;  1OCZ E;  4WND A;  5FQ4 A;  2RFA A;  4YDE A;  3TAX A;  3MCX A;  5G05 C;  1H2T C;  4RV1 A;  4M7C A;  3HHM A;  3AU3 A;  5B56 A;  3BQO A;  3CR3 A;  3TXM A;  1EJY I;  1TJC A;  2WTK A;  4RQI A;  3LYA A;  4GTR A;  4I6G A;  3DSU A;  2Q7F A;  4FC8 A;  4JXT A;  4OAV B;  3B7S A;  2OEV A;  5ANR A;  1JPW A;  5ENR D;  2XOA A;  5HHG E;  3TPM A;  3TPO A;  3C72 A;  4O6F A;  2UWJ G;  2JKT A;  1TN6 A;  4L4I A;  2DWZ A;  3ZIM A;  4EBA G;  5CLA A;  2I1J A;  4U54 A;  3LTJ A;  3C2H A;  2H6G A;  2VTB A;  4U07 A;  1EYH A;  4N39 A;  4L23 A;  5C2Y A;  4LCT A;  2WQ7 A;  2P9N G;  4ABN A;  4L1B A;  4LUN U;  4G1T A; 
#chains in the Genus database with same CATH homology
 1OWL A;  2FUL A;  3OXL A;  4WWN A;  5CLC A;  3G2U A;  4Q69 A;  3JQ0 A;  3NMZ A;  4B94 A;  3O2S A;  4KXK B;  3FGA A;  3QGC A;  5E6Q B;  3WOY A;  4EV9 A;  1Z2C B;  1F59 A;  4L7T A;  2AVP A;  1G3J A;  4GMO A;  4PLS A;  1EJL I;  3AU5 A;  3IKO B;  3L08 A;  4I6J A;  3PUK A;  4I37 A;  4K03 A;  1ELK A;  5KJN A;  2HR2 A;  5LCW C;  1TH1 A;  5KJM A;  3MGB A;  1QGR A;  5G55 A;  2C0L A;  3RO2 A;  3PE3 A;  2W3C A;  3ASD A;  4KZG A;  4FA6 A;  3SI5 A;  1HE8 A;  4EZK A;  3TXN A;  1FVH A;  2QK1 A;  3EA5 B;  4AIF A;  4E6H A;  2GL7 A;  5LCW J;  2X3M A;  3RIB A;  3S7J A;  4FFB C;  2QNA A;  3ZHE A;  3NF1 A;  3CHO A;  3FUE A;  1IQU A;  3RRM B;  1PJN B;  3FEY C;  3ZIR A;  1YA0 A;  3G2V A;  1L5J A;  2PQR A;  3CHR A;  4UWL A;  3B7U X;  1GCJ A;  3APD A;  1Q1T C;  4I43 A;  5G04 J;  2LAI A;  4BPL A;  4WUY A;  4OVU A;  4N3B A;  3CVN A;  2XGO A;  3VLF A;  1ELW A;  5BZV A;  2WQH A;  4DI4 A;  3OXG A;  3FUD A;  1T08 A;  4Y6C A;  4N3A A;  3B13 A;  3SBS A;  4MZ6 E;  4GCN A;  2YNQ A;  3I4G A;  1UJJ A;  4CEM A;  3UT8 A;  3U66 A;  4IN3 B;  5SVZ A;  3OQS A;  2BAP A;  5G2N A;  4I5N A;  4CDN A;  2YJY A;  4GMN A;  4WNE A;  5J08 A;  5JJ7 A;  2IOS A;  3TGO A;  5EKQ D;  1HX8 A;  3IHY A;  1WA5 B;  1NA0 A;  4EVA A;  4DVG B;  2XQ0 A;  4UWX A;  3DAD A;  1M8W A;  1M8Z A;  4E4V A;  3IEG A;  2QMR A;  3C2G A;  5T4Y A;  4R7L A;  3LEW A;  4APO A;  3TJP A;  4I2W A;  2R59 A;  3D9M A;  2OVF A;  3T8M A;  4HOT A;  3OUW A;  4HXI A;  1MQS A;  2JEK A;  2OVB A;  4U0U A;  2WXI A;  3Q0N A;  1EE5 A;  4ILG A;  4XE0 A;  3CKC A;  5K9S A;  2WXQ A;  4KBQ A;  5LP0 A;  3P1U A;  1XNF A;  3IFQ A;  4I5L A;  3HVE B;  5AJL A;  5FZQ A;  4BT9 A;  1SZ9 A;  3ZPJ A;  1QNF A;  4BFR A;  5BZ1 A;  2R17 C;  3AU4 A;  1FVF A;  1FCH A;  2VGL B;  3FU3 A;  3LVQ E;  3LVR E;  1N52 A;  3L6X A;  2XRY A;  3Q5M A;  2L9B A;  4GZ3 A;  4B8C B;  5EKF A;  4PUC A;  4M3O A;  3I3N A;  4J8F A;  4CT7 B;  4GZD A;  3D9I A;  4BSX A;  3QG9 A;  3MV2 B;  5AIJ A;  4U0S A;  3CST A;  3CV0 A;  2VJ8 A;  1ZU2 A;  3G2W A;  3QB2 A;  2E2E A;  3EBB A;  5SW9 A;  4B8J A;  1TE4 A;  4JPS A;  4KZ0 A;  4HVB A;  2I2O A;  5K6S A;  3Q0P A;  3LJ3 A;  4Y5J A;  4Y6W A;  3D9N A;  4MS6 A;  2E0I A;  4V3Q A;  4W9R A;  4ACL A;  2IW3 A;  2KM4 A;  3FHE A;  4FHJ A;  4DJS A;  3FP3 A;  3FDH A;  2CG3 A;  4KMO A;  2J08 A;  4BTA A;  3BWT A;  5D0Q D;  4D4E A;  4G26 A;  3JY1 A;  4U8H A;  3SD5 A;  4BWR A;  4AOF A;  3LKU A;  3SNX A;  4DBA A;  3ASH A;  5BV0 A;  2Z6H A;  4P6Z B;  4AEZ C;  1IAL A;  1NA3 A;  3MJW A;  3QWW A;  4QMH A;  2FV2 A;  4JEH A;  2X38 A;  3P2B A;  1V18 A;  2FI7 A;  2V0P A;  1XQS A;  4CGW A;  3JUI A;  2BNX A;  3U4T A;  2I1K A;  1W9C A;  2BUG A;  4A1S A;  2J4B A;  3ZVV A;  1OYZ A;  2WXH A;  4KZC A;  3BX2 A;  3CVP A;  4APF A;  2FO7 A;  2VGX A;  2V5F A;  2BKU B;  5CL8 A;  3LCA A;  3QAR A;  4CT6 B;  1LRV A;  1SZA A;  3ASF A;  4JHK A;  3JYS A;  4GMJ A;  1OWM A;  3SLA A;  3PZD A;  4ACK A;  4FJY A;  2WXP A;  5CMW A;  4ANX A;  1JWG A;  4CB9 A;  5E76 A;  3WPT A;  3SZ7 A;  3PDN A;  4YGX A;  4FUL A;  3QML C;  1Z3Y A;  2IE3 A;  4N2Q A;  3ZIK A;  3TG5 A;  2X6I A;  3B7T A;  4DZS A;  5LOZ A;  4GA0 A;  1EPU A;  4NRH B;  4UWH A;  3ZW3 A;  1OUV A;  5FZS A;  2HM8 A;  4CT4 A;  3L3Q A;  4EZL A;  3V74 A;  3Q5U A;  5AJD A;  5JHA A;  5DIZ A;  3QKY A;  3Q15 A;  2KAT A;  4URK A;  1HG5 A;  4LAC A;  3Q0M A;  4KVO A;  2L0I A;  2Y3A A;  3ZYK A;  1XM9 A;  4G3A A;  3MKQ B;  3UKZ B;  1HF8 A;  2DCP A;  3KD7 A;  2XPZ A;  4AV7 A;  4JL0 A;  4CGV A;  1NP7 A;  2AWI A;  4JW1 A;  3VE6 A;  3RK6 A;  2RD0 A;  4GU5 A;  5EWP A;  2NYM A;  2LO6 A;  2JKR A;  3ZIQ A;  1TEZ A;  4P29 A;  2IQC A;  1Y6I A;  2KCL A;  4HOU A;  4JVS A;  2XCC A;  3RRN B;  3PST A;  4LRZ A;  3FTW A;  5BPP A;  3Q0L A;  2RU4 B;  2WXL A;  3E4B A;  2A5U A;  4AY6 A;  1SQM A;  2PM6 A;  3BVS A;  3MEK A;  5BV1 A;  2MOW A;  4UQI A;  3O2Q A;  2VSX E;  4B18 A;  4RSY A;  2A4Z A;  3QHE A;  5AEI A;  1H19 A;  4FLB A;  3ENE A;  3AS4 A;  5KLT B;  5D5K C;  2C1T A;  3CVL A;  4F53 A;  4GML A;  2YHC A;  4L2Y A;  5G05 J;  4DI3 A;  3NZU A;  2VGY A;  3CK8 A;  4UQZ A;  3FH7 A;  2NPP A;  3JXZ A;  5LX8 A;  1MHQ A;  3K5Q A;  2DBA A;  1W63 A;  4HM9 A;  4BY6 A;  4EVP A;  4P6Z G;  3MZL B;  1A17 A;  2F31 A;  3D9P A;  4C9B B;  4FZF A;  3C5W A;  2VGX B;  3ZEF A;  2PM7 A;  3ML9 A;  3URZ A;  3CHM A;  2P8Q A;  2J4D A;  4FDD A;  3UKY B;  1QGK A;  1E7V A;  4KT6 B;  4DLQ A;  3CVQ A;  5CHE E;  1N54 A;  3KEZ A;  4HS2 A;  1UG3 A;  4MFV A;  3TG4 A;  3ONK A;  4I1M A;  4FU3 A;  4LEU A;  3GNI A;  5FZR A;  4JW3 C;  3GZ2 A;  2WMN A;  3KAE A;  5CL3 A;  3U3W A;  1IQR A;  2MHK A;  2JDQ A;  4NZW A;  4YK6 A;  5M72 A;  5EKG A;  3TL5 A;  4PS3 A;  3PEU B;  5CLB A;  2GRL A;  3T5V A;  5CL5 A;  5SWF A;  2QFC A;  4JC8 A;  3H3D X;  3ZIO A;  4H3K A;  2KZT A;  4U04 A;  1HXI A;  3ZYQ A;  2C1M A;  1XQR A;  4I6E A;  4GZ5 A;  1TJF A;  2QY7 A;  4QMJ A;  4I1A A;  3CVU A;  2NSZ A;  3SHF A;  4DB9 A;  4V3I A;  1IBR B;  1H2U A;  4C0M A;  4FZD A;  2IAE B;  3FUI A;  4JLQ A;  4CV5 B;  2WVI A;  3D9L A;  3SBT B;  3ZHP A;  4HLE A;  2KCV A;  3ZGQ A;  3CKB A;  4C0E A;  2FEZ A;  5AEN A;  4RZP A;  4NAC A;  5EX0 A;  4UAF B;  3FTX A;  2XA7 B;  3QJZ A;  1UPK A;  3LY7 A;  4UI9 C;  2Z6G A;  4I7I A;  3PE4 A;  4JEU A;  4YJE A;  3EJN A;  1INZ A;  2OT8 A;  4G25 A;  2X6F A;  3FUJ A;  3ULQ A;  4OYS A;  4NUR A;  4I6I A;  4K6J A;  3ZIP A;  1OWP A;  5FQ6 A;  1B3U A;  3K62 A;  4EZJ A;  3L6Y A;  4U5O A;  3LPZ A;  3LS8 A;  4Q96 A;  1ZBP A;  3UVU A;  4B8A A;  2IU1 A;  3UMV A;  4ILH B;  5HUW C;  2IX3 A;  1HH8 A;  3FY4 A;  2JKT B;  4FJZ A;  4CRU B;  4CT0 A;  1I7W A;  2NPP B;  1Z6T A;  3Q47 B;  2IFU A;  4RG9 A;  3FUF A;  4D10 C;  2VTB B;  4H3H A;  3EHM A;  5A6C A;  4MLP A;  1KT1 A;  3UQ3 A;  1M5N S;  3BSB A;  3IBV A;  2JLB A;  5JJ6 A;  2NYL A;  3TJZ B;  4B8O A;  3FGA B;  1E90 A;  3NZS A;  2IOL A;  4UWF A;  4QFV A;  1QZ2 A;  4UWG A;  2X1G F;  1OWO A;  3JQ1 A;  2J09 A;  4FQ3 A;  2CHZ A;  2V4L A;  3AS5 A;  3L13 A;  2X6K A;  3UL1 B;  4JW2 A;  1JUQ A;  3Q0O A;  4L7M A;  3GB8 A;  3ZN3 A;  4YVQ C;  3SF4 A;  3ND2 A;  4GA2 A;  4HXT A;  3MX3 A;  1O6P A;  2KZT B;  4AJW A;  1X5B A;  3L3F X;  4GB9 A;  3ZHE B;  4E85 A;  2M63 A;  4IYP A;  1E8X A;  2WXG A;  4RVB A;  3WOZ A;  4UAE A;  3CVY A;  4ADY A;  3OPB A;  3FUN A;  4ANW A;  4OIH A;  1VDY A;  3BCT A;  4A0C A;  4RXH B;  3JCK C;  3UX4 A;  3OUX A;  5A7D B;  4U58 A;  3ZIL A;  4CBA A;  3FEX A;  4LER A;  3ZIN A;  5JHB A;  3UT7 A;  4A55 A;  3APC A;  2VQ2 A;  4JA7 A;  2CFU A;  3GQ2 A;  2J07 A;  3N71 A;  3QOU A;  3UKX B;  4K92 A;  1UPL A;  4EQF A;  1H0A A;  4PH4 B;  2WXR A;  4JA9 A;  3V6Y A;  2XPI A;  3FU6 A;  2XPY A;  5DN7 A;  1IHG A;  3JXY A;  2Y4T A;  4GPK A;  1H2V C;  4B89 A;  2LAH A;  3S2A A;  3PRZ A;  4N3C A;  3RU0 A;  2GGF A;  2HO1 A;  4DB6 A;  4AVX A;  4J6I A;  1LUJ A;  5KL8 A;  4XI0 A;  5BYM A;  3O2T A;  4K0R A;  4FP7 A;  2XGS A;  2ZU6 B;  3CHS A;  4ANV A;  1ELR A;  3K61 A;  2VSN A;  2AXZ A;  3FH5 A;  1NZN A;  5E75 A;  1E7U A;  2AXV A;  3FTY A;  2LSU A;  1HG2 A;  3GRL A;  3KND A;  3FWV A;  1IYG A;  3GZ1 A;  3FU0 A;  5KJK A;  2L6J A;  4R10 A;  4YJL A;  1KT0 A;  4I9E A;  3QAQ A;  3MYV A;  2Q5D A;  1JDH A;  2PF4 A;  3CVV A;  4R11 A;  4TV3 A;  1KLX A;  3CQC B;  2MRI A;  4YND A;  2Z5M A;  4DK5 A;  2ION A;  3CHQ A;  4G24 A;  4FAD A;  2Z5J A;  5JJA A;  4WAF A;  3GVT A;  3CHP A;  3UPV A;  4CDM A;  5HUY C;  1PJM B;  4EEC A;  1W3B A;  2XEV A;  3QWV A;  2VYI A;  3CVX A;  4G23 A;  2DIW A;  4WNG A;  4B0Z A;  3GVO A;  5CL6 A;  4U5N A;  3LWW A;  1EF1 C;  5KLR B;  2NXP A;  3L22 A;  4L2L A;  2OND A;  1HFA A;  2AW6 A;  3ZYM A;  2XGM A;  4F1S A;  3FH8 A;  1E8Y A;  2NC9 A;  2CHW A;  4ILI A;  4MZ5 E;  3FUK A;  5C1D A;  2YNR A;  4WV6 A;  3HYM B;  1HU3 A;  1IB2 A;  2QK2 A;  1WAO 1;  1E8Z A;  3KS2 A;  3CIA A;  3GAE A;  1JWF A;  3MA5 A;  5LFA A;  4YVO A;  3R7R A;  3SFZ A;  2R5S A;  4HTV A;  2WXO A;  4FLH A;  2H4M A;  3UKW B;  3IHV A;  3Q0R A;  3HDX A;  4H7X A;  4UWK A;  5BUZ A;  1UJK A;  3LXU X;  3RRU A;  1PY1 A;  4TNM A;  4I9C A;  5BNW A;  1QQE A;  3FTZ A;  4JZY A;  1BK5 A;  3VTY A;  1P5Q A;  4UQY A;  4KVM A;  5KUB A;  2Y4U A;  1UW4 B;  3ZFW A;  4CRW A;  3LY8 A;  3ZXS A;  4U63 A;  2PL2 A;  5CL7 A;  3K5Y A;  4U5L A;  5ANL A;  4V3R A;  5CL4 A;  3VTX A;  5ARG A;  2WQ6 A;  3ASG A;  2KCK A;  5CTT A;  3PEV B;  5T8I A;  1U3D A;  5BZ5 A;  3CQG B;  4ANU A;  4AP2 A;  4I3N A;  1Z3X A;  3OAW A;  3TT9 A;  4XKB A;  3CK7 A;  3ODS A;  4HOS A;  4OVV A;  1DVP A;  4J8E A;  3EIQ C;  3WXX A;  4XIF A;  3DPD A;  3FUH A;  2V8S E;  4GYW A;  2CG2 A;  4N5C A;  3DBS A;  4DPR A;  5FQ7 A;  1E8W A;  3HVE A;  3O4Z A;  4JHR A;  3DW8 A;  2IWH A;  4I1O B;  4GAA A;  1JPP A;  2VGL A;  2LSV A;  4U5S A;  4UQX A;  5FQ8 A;  3L16 A;  3T5X A;  4IUL A;  1PAQ A;  3R9A B;  3ESK A;  3I4R B;  3FEX C;  2KC7 A;  2IE4 A;  2YIN A;  3A6P A;  3CSF A;  2VSY A;  3SGH A;  5HQ8 A;  4PS8 A;  3K49 A;  5CLD A;  3EHN A;  3O48 A;  4WWO A;  3PSP A;  3WYF C;  4FHK A;  5AYW D;  1EDU A;  3NOW A;  1WY6 A;  3C98 A;  1QBK B;  4FZA A;  4G11 A;  5G04 C;  5HI7 A;  3OBV A;  1O6O A;  5J3V A;  3RZ9 A;  1UN8 A;  3TX7 A;  4AY5 A;  4GCO A;  3K4E A;  1HS6 A;  2YHE A;  1S0P A;  2XCB A;  3S7D A;  1QZ7 A;  4QMI A;  1GW6 A;  2NYM B;  2JKR B;  3PH0 C;  4MKT A;  2PQN A;  3HIZ A;  1H6K A;  4GA1 A;  3GZS A;  2AXU A;  1B89 A;  2X19 B;  2P58 C;  1LF8 A;  4H7Y A;  3D9J A;  4GYO A;  3VWA A;  4ZDU A;  3Q4A B;  4UQI B;  4BX8 A;  4UI9 J;  2RG8 A;  5KJL A;  4UAD A;  4BX9 A;  2YNS A;  3K7W A;  3LDZ A;  4CDR A;  4U5U A;  2L0T B;  4EBA A;  4V3O A;  1BK6 A;  4CCA A;  3BTR C;  4GYY A;  3EIJ A;  3VLE A;  4WWP A;  4I2Z A;  3OXF A;  1W63 B;  2ILR A;  4I96 A;  3W3U A;  3MV3 B;  4EPZ A;  1WM5 A;  3CLJ A;  4PS7 A;  4XZ4 A;  5JJT A;  3CEQ A;  3G2S A;  3NQP A;  3RZX A;  1M8X A;  4HNM A;  4NEE A;  4R0Z A;  3S7B A;  4U3J C;  4I1E A;  3L54 A;  4OO6 A;  2WM9 A;  2X6J A;  3I5P A;  3CK9 A;  1OWN A;  4ATG A;  3T7U A;  2HYZ A;  2WB2 A;  3ZYL A;  4IMI A;  4JKQ A;  3QDN A;  3QWP A;  3FTS A;  2YQ8 A;  3CGH A;  4CRV B;  2EQX A;  3PUJ A;  3QK0 A;  4B8P A;  2Z5N A;  3RJV A;  2LNI A;  5H2X A;  1I7X A;  5BZU A;  1U6G C;  3L6A A;  5ENN A;  5J90 A;  1UN0 A;  4I8M A;  3AS8 A;  1M8Y A;  4PVZ A;  1XGW A;  3FTU A;  2J49 A;  5EDS A;  3VLD A;  3PRE A;  2Z5K A;  3GS3 A;  3BG1 B;  3ZRH A;  4U0Z A;  3ZKV A;  3NMX A;  3UL0 B;  1Y8M A;  1UKL A;  4F7A A;  2OV8 A;  2WXF A;  3LY9 A;  4KYO B;  3ML8 A;  3Q49 B;  3S7F A;  4Q94 A;  3FUM A;  3PNL B;  4XKC A;  4D49 A;  3BEE A;  5D0O D;  4AM9 A;  2WPV A;  3L17 A;  3K7V A;  3PS6 A;  2DB0 A;  3D9K A;  5KCM A;  4L4H A;  4TUU A;  3MKQ A;  3FTV A;  3Q0S A;  4U5V A;  2UY1 A;  3IBE A;  3ODR A;  3GW4 A;  2VSO E;  4PLQ A;  4XI9 A;  5T3R A;  2XRZ A;  4JHJ A;  4YI0 C;  3BG0 B;  3K64 A;  1UN9 A;  3GYZ A;  2CHX A;  5FJY A;  4I0Y A;  3FEY A;  1WA5 C;  4XZR B;  5CCM A;  2GW1 A;  2WMO A;  5BT1 A;  3QNK A;  5CLE A;  2RU4 A;  5DBK A;  3CVW A;  5CCL A;  2PKG A;  5CMY A;  5FTP A;  1IQ1 C;  3MKR A;  5ARF A;  2Z5O A;  3FUL A;  4MRU A;  3UT4 A;  4N2S A;  3K5Z A;  4EV8 A;  3FFL A;  5FWQ A;  3O4X A;  1BPO A;  4I2S A;  3RO3 A;  4PLR A;  3BSX A;  3Q0Q A;  2C0M A;  4IMJ A;  3D9O A;  3V71 A;  4A3V A;  4BTB A;  4PDX A;  3G2T A;  4DB8 A;  4EVT A;  2WXN A;  5A23 A;  4GZ6 A;  4BQK A;  4J8S A;  4IRU A;  4DLO A;  2OF3 A;  4HFG A;  3TJ3 A;  4DJA A;  1Y2A C;  2NYL B;  3B7R L;  4UI9 K;  3ESL A;  2C2L A;  1M1E A;  3D3M A;  4O27 A;  4RG6 A;  4HOR A;  1E96 B;  3OTN A;  2J9Q A;  3SL9 A;  3NMW A;  2WXJ A;  2OOE A;  4BT8 A;  5KL1 A;  4GZC A;  3ONL A;  5H2W A;  4JW2 B;  3R7Q A;  3IV0 A;  4MFU A;  4U2X D;  4G2V A;  2JAK A;  4F3V A;  2I6H A;  4WNF A;  4XX5 A;  1PC2 A;  3QC1 A;  4TRQ A;  5BW8 C;  5CL9 A;  3FU5 A;  3U9W A;  2BTD A;  5FC8 E;  5EX3 A;  2BF0 X;  4J0U A;  2CFZ A;  1HZ4 A;  2GRM A;  1EE4 A;  3PVL A;  3PNT B;  3QGB A;  4A3T A;  4BA3 A;  1JPL A;  1HO8 A;  4HOQ A;  4A1G A;  3K9I A;  2PZI A;  5KLA A;  2XHE A;  2IF4 A;  3BX3 A;  4J8D A;  4AXH A;  1U3C A;  3EG5 B;  2IJG X;  5FT9 A;  1DNP A;  3UUX A;  4ME2 A;  3APF A;  2BCT A;  2FF4 A;  3LTM A;  4NQ0 A;  2X6H A;  2UY1 B;  2WXM A;  3RKV A;  2I9C A;  2IAE A;  3U64 A;  5LSW A;  4CB8 A;  2WXK A;  1Q1S C;  4I17 A;  2XA7 A;  2FBN A;  3JX7 A;  3EDT B;  4WND A;  5FQ4 A;  3TAX A;  3MCX A;  5G05 C;  1H2T C;  4RV1 A;  3HHM A;  3AU3 A;  5B56 A;  3CR3 A;  3TXM A;  1EJY I;  1TJC A;  2WTK A;  3LYA A;  4I6G A;  2Q7F A;  4FC8 A;  4JXT A;  3B7S A;  5ANR A;  1JPW A;  2XOA A;  5HHG E;  3TPM A;  3TPO A;  4O6F A;  2UWJ G;  2JKT A;  4L4I A;  3ZIM A;  4EBA G;  5CLA A;  2I1J A;  4U54 A;  3LTJ A;  3C2H A;  2VTB A;  4U07 A;  1EYH A;  4N39 A;  4L23 A;  5C2Y A;  4LCT A;  2WQ7 A;  4ABN A;  4L1B A;  4LUN U;  4G1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...