3VLEA

Crystal structure of yeast proteasome interacting protein
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
456
structure length
435
Chain Sequence
NLLTQLENELNEDTLLRKCSLNLVTVMDVKPLLATIKRFLTSDYLLDVVDKLVPMADFDDVLEVYSAEDLVKALRSEIDPLKVAACRVIENSQPKGLFATSNIIDILLDILFDEKVENDKLITAIEKALERLSTDELIRRRLFDNNLPYLVSVKGRMETVSFVRLIDFLTIEFQFISGPEFKDIIFCFTKEEILKSVEDILVFIELVNYYTKFLLEIRNQDKYWALRHVKKILPVFAQLFEDTENYPDVRAFSTNCLLQLFAEVSRIEEDEYSLFKTMDKDSLKIGSEAKLITEWLELINPQYLVKYHKDVVENYFHVSGYSIGMLRNLSADEECFNAIRNKFSAEIVLRLPYLEQMQVVETLTRYEYTSKFLLNEMPKVMGSLIGDGSAGAIIDLETVHYRNSALRNLLDKGEEKLSVWYEPLLREYSKAVNGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for specific recognition of Rpt1, an ATPase subunit of the 26S proteasome, by a proteasome-dedicated chaperone Hsm3
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords DNA mismatch repair protein HSM3
total genus 167
structure length 435
sequence length 456
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18794 HSM3_C DNA mismatch repair protein HSM3, C terminal domain
A PF18795 HSM3_N DNA mismatch repair protein HSM3, N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.50 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 3vleA01
1.25.40.580 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3vleA02
4A3TA 3VLDA 3VLEA 4A3VA 3VLFA 4FP7A
chains in the Genus database with same CATH superfamily
4G8LA 3ZIPA 3CV0A 4GMRA 4HXTA 3UQ3A 2BNXA 4N2QA 4ZFHA 4PDXA 2YJYA 3QG9A 1X81A 3K4EA 2UWJG 1RW2A 3DXMG 3TGOA 4DJSA 4G3AA 2IJGX 1HF8A 1K1BA 1UJKA 1TH1A 2DCPA 3SY2A 3UL1B 2IO2C 4I2WA 4DJAA 2FO7A 3E37A 3CLJA 3IFQA 4W9RA 2ZGGA 1I7WA 3C3OA 3U3WA 1M1EA 1BI8B 3UI2A 4JZYA 3JCKC 3UINC 2WXNA 1MX4A 4HRNA 3UPVA 2WXMA 4YDOA 2L0IA 4GTSA 5KBAA 1NI1A 1DNPA 3SNXA 5C2YA 1LTXA 2GRPB 3ZRHA 4DK5A 1OT8A 2IO3C 3CHRA 3CKCA 5A23A 3NBNB 3V6YA 4U58A 4TXQA 2PM7A 5AJDA 4YVOA 3BG0B 1TEZA 2XOAA 3QOUA 2RU4B 2WXJA 5ENTD 4I9CA 5EDSA 3ESKA 3TXNA 3IBEA 2KCLA 3KEZA 4GTQA 4G23A 2WQ7A 5EILA 5J90A 3Q9UC 4UWKA 3EIJA 3TXMA 4EZLA 3K5YA 5FQ7A 5CBOA 2H6IA 4L4IA 2P8QA 1OCRE 4DX7D 5EX3A 1IQ1C 2IONA 2Y4TA 1INZA 2WXPA 2DB0A 4WNEA 4FP7A 3ZPJA 1LRVA 4EV8A 4GU5A 5B1AE 4U3JC 5G05C 1GCJA 4BTAA 3RU0A 3ESLA 3GAEA 2WTKA 3BQOA 3TG4A 4CB9A 3ZYMA 4B8PA 3Q78A 3VTXA 3Q0PA 3FWVA 1KLXA 3PREA 3V71A 2VSOE 4JW3C 4F3VA 1JPLA 5DBKA 3NOCD 4JHRA 3ZYLA 3G2TA 2VGEA 3O4XA 3T5XA 1MHQA 3TWUA 3JXZA 3O2QA 1W9CA 4I3NA 3HXEA 1HH8A 3V2XA 3ZIOA 5FZQA 4KZGA 3S7DA 4B0ZA 3SHFA 3L3FX 1K1AA 3APFA 1W63A 2PL2A 2WXKA 3FUFA 1EJYI 4UI9C 1N4QA 2XEEA 3R9MA 4UQZA 2VTBB 4NZWA 3L6XA 5LOZA 1O5MA 2Z6HA 1I7XA 5KUBA 4V3RA 4GPMA 4RLYA 1H2VC 4DB8A 1S63A 2XCBA 3GNIA 3PZDA 3B13A 3RO2A 4FA6A 1UG3A 3C3RA 1M8WA 3SFXA 5LX8A 4A3VA 2NYLA 1YMPA 3C98A 3UT8A 3JXYA 4K5CA 1U2VG 1JPWA 5E6QB 3O4ZA 3LJNA 5KJMA 5H2WA 4RVBA 1TN7A 5G05J 3ZEFA 4I17A 4R0ZA 3VLEA 3JQ1A 1OCZE 2GGFA 1N4RA 3ZGQA 4J8YA 3ASFA 4BT9A 4JHKA 4CT7B 1OWOA 2X3MA 4JB8P 4B8JA 3K49A 1N94A 2Q5DA 1O1RA 1NL4A 2R05A 1IHGA 4DVGB 2Y3AA 5KLRB 3HXCA 5JMND 1N95A 1QGRA 1TNZA 1H2TC 3LY9A 4ZHBA 3MKQB 4ACKA 2IOSA 1HU3A 3DSTA 3O2TA 3UKRG 2F8XK 3B7UX 4K5BA 3W9FA 2VGLA 3L54A 5KNHD 5LSWA 4IN3B 5BYMA 3A6PA 3FY4A 5CMYA 4RG6A 3T8MA 3MZLB 3QNKA 2FF4A 1EYHA 4I7IA 3WXXA 1SZ9A 4CZ2D 4RXHB 3L6YA 3ZHEB 4PH4B 3C72A 4GYWA 3T8SA 3SL9A 4Y6CA 5KCMA 5SW9A 2NPPA 2RFAA 2BCTA 3AS8A 4OIHA 3ZYKA 4EHMA 3BG1B 2P9UG 2Z5KA 1SA5A 4IYPA 3QWWA 4EZJA 2WXGA 1E96B 2A5UA 4MFVA 5CLCA 5CERB 2P9PG 4EECA 3KSQA 3NZSA 5BZVA 4UWLA 5EKFA 3G2VA 1N4KA 1M8XA 4N39A 4N5QA 4Z68A 2WMNA 4C48B 3CIAA 5LFAA 3I3NA 5CLBA 3BWTA 1NA0A 3Q0NA 5D0OD 1DC2A 4CRUB 2P9IG 5EWPA 4G1TA 3SD5A 5KLAA 5HHGE 3SQVA 3MA5A 4BETA 2QMRA 3FU5A 1BLXB 4OAVB 2KATA 2NXPA 3E34A 1H19A 3FUEA 5A7DB 3V30A 4LG6A 3ZU7B 5FT9A 4GZDA 1S70B 3ZXPA 5CLAA 3VWAA 2FEZA 4CBAA 4YJLA 2ZGDA 3EHQA 4CDMA 1TYQG 3ZKVA 3K5ZA 3QJZA 1UN9A 3W3UA 5BXUA 1SQMA 4B8CB 1ZU2A 3GW4A 1JUQA 3ML9A 1PC2A 3L13A 5AQAA 3PZ2A 1F59A 2OCCE 1IQRA 3LCAA 5JJAA 4JL0A 4I1AA 2HR2A 3PEVB 3TJPA 5KWDA 3LWWA 4BFRA 3TX7A 2YQ8A 1LD8A 5BV1A 3BTRC 3ASDA 4R7LA 4Q94A 3EJNA 1KZOA 3S7JA 1HO8A 4NRHB 3GZ2A 2J07A 5EKQD 1GW6A 1AP7A 3PNLB 5CECB 3AS5A 3HXBA 3FUJA 3ASOE 3DW8A 1WA5C 2JLBA 3HIZA 2XRZA 4JEHA 4NIKA 4UAFB 5E75A 1YYHA 5JHBA 2E2EA 1D8EA 2A4ZA 3RIBA 3OXFA 2DYRE 3WYFC 3AAAC 2XA7A 3IEGA 1WAO1 4U8HA 4PUCA 3AU4A 2WXOA 2H4MA 2X6JA 1Z6TA 3TL5A 3CHPA 3CEQA 3JUEA 1FT2A 1Y6IA 4PLSA 2H6FA 4AOFA 4WNDA 2VJ8A 4U5VA 2F0YA 1BU9A 2LAIA 2I9CA 4FFBC 4UQYA 3Q0LA 4JPSA 3E30A 2JEKA 3BCTA 3K62A 2RG8A 4MLPA 2YHCA 3OUWA 3TPOA 3OBVA 3PEUB 4P29A 4L1BA 3U9WA 3GYZA 2L0TB 3FUHA 2EIJE 3G2SA 3EDTB 3TJ3A 3RKVA 4BX9A 4EV9A 1W63B 5D66A 5T4YA 3Q5MA 4RZPA 4ANVA 3D9MA 2XQ0A 2WM9A 3ZIQA 5D2MC 4BSXA 1TJCA 4NEEA 3J5QB 2F31A 4G2VA 4UWGA 4IRUA 3Q4AB 1IBRB 3Q47B 2AXUA 4U5SA 1E90A 3UKXB 4GTRA 4I1OB 4L7MA 3ISMC 5HUYC 3UUXA 3UIOC 2P9KG 3ZN3A 4HOUA 3T9KA 3TWWA 1TNBA 4GZ3A 4U07A 5JA4D 5AQ7A 3CVLA 4YI0C 5CMWA 3WOZA 2KC7A 5ITZF 4OO6A 1SW6A 3PSTA 3L9TA 1TE4A 1B89A 3VLDA 5CL4A 2BTDA 5JHAA 4BPLA 4AIFA 3D9JA 2B0OE 3BUAA 1OWMA 5FZRA 4DLOA 5CEDB 1IALA 5HKPA 3EU5A 4MZ5E 2P9SG 2AJAA 3FTWA 4UADA 4FULA 5M72A 4O60A 2Z5JA 3U64A 3LKUA 3V2OA 3HXDA 5AEIA 4EVPA 2GL7A 3ABME 2EIME 1BK6A 2X38A 3DSVA 5BPPA 5HI7A 3MGBA 1WM5A 3OXLA 4PS7A 4B8AA 1PJMB 4JA9A 2LXMA 1Z2CB 2X1GF 3RAUA 1UKLA 3UTMA 3RRNB 4CT6B 4EQFA 4BTBA 3DPYA 2ETBA 2RFMA 4K92A 3Q0SA 4CDNA 3Q9NC 3K7VA 5B3SE 2X6HA 2IAEB 2JKRB 3TG5A 1WG0A 1QGKA 3BVSA 3D9IA 3TAXA 3OTNA 2KCKA 2EINE 3D9KA 3FH7A 2AWIA 4N3BA 2XPYA 2DVWA 3G2WA 3D3MA 4ME2A 3I4RB 4ANUA 3FTXA 4U5NA 1H6KA 3MCXA 3UIPC 4P6ZB 2IAEA 4GCNA 2BF0X 3NMZA 4LCTA 3E32A 3FEXC 3NMWA 4HFGA 4JD2G 1HS6A 3EHMA 3G2UA 4U96D 3L16A 2VSXE 4IULA 1QBKB 4N3AA 3ZHEA 3CHOA 3Q0OA 2XCCA 1E7VA 1HE8A 4LNUD 3C2GA 5ENQD 3CVYA 3GS3A 3O2SA 3FGAB 5B56A 4YDEA 3ABLE 4I0YA 4U0UA 4C0MA 4XI9A 3UKUG 4GTOA 4GMNA 3TPMA 4FJYA 4NACA 3EUVA 2H6GA 3LXUX 4X8QA 1UPKA 4H7XA 4OVUA 1EE5A 5ENSD 3MKQA 2XRYA 3PRZA 4MZ6E 4A63B 5EX0A 3QKYA 4LNBA 4HOTA 1O1SA 3OXGA 4GA2A 4EBAA 3ONKA 2MYOA 1A17A 5EYPF 2ETCA 2IOLA 2PNNA 1JCQA 5T8IA 5CL6A 2VGLB 5BZ5A 2VTBA 4FJZA 2LSUA 1XQSA 4L9PA 1FT1A 1IYGA 1LF8A 5KJNA 3NZUA 3LPZA 2GRQB 4UQIB 2IY0C 4GMLA 3FEYC 3MX3A 1TJFA 3K9IA 1JCRA 5DN7A 5FIOA 4J6IA 1RZ4A 1UJJA 5G55A 3KD7A 4YJEA 3QHEA 3BX2A 2VSYA 5BUZA 4XEIG 4UWFA 3ND2A 2AXZA 2FV2A 3ZINA 4CT4A 1QQEA 4WAFA 3AS4A 3CK9A 1FVFA 1U3CA 3L3QA 4RG9A 4DLQA 4GCOA 2WXHA 1OCCE 4FADA 5EKGA 5H2XA 4GA1A 2CHWA 2IFUA 5E76A 5KL8A 3ZHPA 1OYZA 3UVUA 1HG5A 3U66A 1Z3YA 3AG1E 2WXIA 4FHKA 4ANWA 3CVPA 3PUKA 1OWPA 4F1PA 3GRLA 4CRVB 2NYLB 2I6HA 3NOGD 3W9GA 3B7SA 5CCLA 4L2YA 3BX3A 3R7QA 4WWPA 4XZ4A 4E6HA 3PSPA 4FZAA 5CBNA 4UQIA 3LVQE 3LDZA 1UN8A 3DSSA 4H3HA 1JWGA 3GQ2A 2IE3A 4GZ5A 4JW2B 2EQXA 1EDUA 3FTZA 3AG2E 3FTYA 1LSHA 4M3OA 3L82A 4U5UA 3C3QA 4EPZA 1N11A 2BKGA 4HS2A 4I1MA 5BZ1A 4I2SA 4R10A 2WVIA 3CQGB 4GZCA 5HUWC 4KMOA 2IW3A 4WUYA 3ZUVB 5K9SA 1E8XA 4AM9A 2QK1A 5EN5D 2E0IA 4N3CA 3BEEA 4HLEA 1SZAA 2XA7B 4U5OA 4CEMA 2J09A 4M7CA 1X5BA 3CVWA 4DI4A 2GRMA 2IU1A 5KJKA 4C0EA 2V0PA 3ZKJA 4Y5JA 3BU8A 4KVMA 4E85A 1JPPA 2OOEA 4GMOA 4TRQA 4PS8A 5CEAA 4HI8A 3ULEG 4YVQC 3UM2A 3GZSA 1D9SA 3CQCB 1MJ0A 5ENNA 2Z5MA 5DIZA 2C0LA 2PQRA 3ML8A 3ULYA 1OWLA 4R11A 3OQSA 1NFIE 4C9BB 4UQXA 4U8VD 3AG3E 4PVZA 1Y8MA 2LXLA 2QK2A 2XGSA 2JKTB 4FC8A 2C1TA 4O27A 3HVEA 4JLQA 2GRNB 2OEWA 5ANLA 1M5NS 4UAEA 4EVAA 5JJ7A 4JW1A 5G2NA 5SWFA 3V31A 2YHEA 3SF4A 2IEJA 3JY1A 2I2OA 1SA4A 2ZXWE 1N4SA 3QGCA 3CK7A 1JCSA 5EYLA 5CHEE 4PLQA 4G26A 3RRMB 2JKRA 2L9BA 2YINA 3KS2A 3WG7E 5AQ9A 2VGXA 5ARGA 3ZNGA 4CCAA 3AU3A 3GZ1A 4DX1A 2XZDG 3MYVA 1EE4A 2FI7A 4HLLA 1ZBPA 1MQSA 4F53A 4OAUC 3IHYA 5C1DA 4Q69A 2VGYA 3FH8A 1HZ4A 2DBAA 3PH0C 4CT0A 1Q2ZA 3T8KA 1M8YA 3Q0QA 4YK6A 1TN6A 3K5QA 4D49A 2M63A 3FH5A 2MHKA 4F6RD 5FZSA 2MOWA 1V54E 3FUKA 4AY5A 4QMHA 3Q7FA 1K3ZD 5BNWA 2NYMB 4G11A 3GVTA 1G3NB 1TN8A 3CK8A 3PE4A 2CFUA 3CHSA 1QYMA 4I6JA 1N4PA 4WNGA 5CL8A 1Z5SC 2JKTA 2Z6GA 3IKOB 1O6OA 2BKKB 1IXVA 2DWZA 1QZ7A 2DZNA 4UWXA 4J8DA 1YA0A 2IWHA 3T5VA 2R5SA 2JABA 1MX6A 1JWFA 4B93B 5FC8E 2C2LA 1N52A 2XHEA 3O48A 3ONLA 4DPRA 1YCSB 3DSXA 3ASNE 5AN8A 1P5QA 4DB9A 4XIFA 4LERA 1S0PA 2KCVA 4IMJA 1NZNA 5KL1A 5ENRD 1Z3XA 2XGMA 1BPOA 5LP0A 3D9NA 2R02A 2BAPA 3HRAA 1D8DA 4GMJA 2JAKA 1EPUA 3K64A 3HYMB 2R2LA 1QZ2A 1S64A 2Y0BG 1XGWA 5CLEA 5AQBA 2WXFA 3FUNA 2MRIA 3LS8A 1BD8A 4G8KA 1EJLI 1DCEA 3CHMA 2V5QC 4MKTA 4B18A 4JW2A 2F8YA 4BEPA 3DWLG 1WDYA 3PVLA 3MKRA 3DEOA 2VSNA 3B7BA 4GTVA 2OVFA 3CVVA 4HXIA 4I6IA 1WY6A 2YNSA 1TR4A 4J8SA 3FFLA 4L2LA 4YDWA 1UPLA 2QYJA 2QY7A 5CL5A 4O1OA 3Q15A 2QNAA 5IY5E 3TT9A 4XX5A 1ZB1A 1E8YA 3UM0A 1IQUA 2KZTB 3OAWA 4U54A 3URZA 3LJ3A 4KXKB 3HG0D 1FPPA 4LSZE 3MEKA 4O1PA 1TNYA 2CHXA 4PLRA 3RJVA 4BX8A 3PZ1A 5B1BE 1U6GC 2F37A 2J8SD 4I6EA 3CVXA 4U04A 3C5WA 4D4EA 1MZCA 4ATGA 4CGVA 5ANRA 1UN0A 4LACA 4JC8A 4FQ3A 3EHNA 5AENA 3FU3A 3B95A 3V79K 3SGHA 4I5LA 2KM4A 3KSLA 2QYUA 4E4VA 3T7UA 4WNFA 4NQ0A 2ZISA 3SO8A 3TWXA 1JDHA 5AIJA 3UX4A 3ZXSA 4U95D 3PZ3A 1IKND 4K5AB 4U63A 3EG5B 3B7TA 1OWNA 5FQ4A 2PKGA 3SZ7A 4GYYA 4JKQA 2ILRA 3CSTA 4I43A 3VLFA 4EBAG 2EILE 4FDDA 1UW4B 4TUMA 2QFCA 2I1KA 4J8FA 4UUCA 4FLBA 2GRLA 3SFZA 1BI7B 2XPZA 3TWVA 3UJ0A 5EIDA 3MV3B 2CG2A 4A1GA 5K6SA 3EIQC 3PDNA 4BSZB 5CL7A 2WMOA 4DI3A 2X6FA 4AP2A 2BUGA 5HS0A 2WXLA 4RSYA 4URKA 4I6GA 3L17A 2ONDA 5CRVA 4GTTA 3DPDA 5LCWC 3ASHA 3C2HA 4GAAA 2YNQA 2J49A 4U7EB 4DX6D 4B94A 2UY1A 4KBQA 1V18A 5SVZA 4MFUA 3FULA 4NURA 1Q1SC 5FQ8A 3EU9A 3QDNA 3DBSA 4ACLA 2P9LG 3F6QA 2WPVA 2HE0A 3APDA 4U2XD 2RD0A 4EZKA 1H6PA 5AARA 5FTPA 4UWHA 1KPSB 1ELWA 3ZIKA 2XPIA 4U0ZA 4HB5A 2VYIA 1MYOA 3LVRE 3SBSA 4WWNA 1K8KG 2PM6A 4HRLA 3K61A 4YNDA 5FJYA 3QWVA 4ABNA 1N0QA 3IV0A 2P58C 5CL3A 1OUVA 3VE6A 2LO6A 3UL0B 3FU6A 4CGWA 1M8ZA 3TWQA 2XEVA 1QNFA 3BSXA 1W3BA 4Y6WA 4IMIA 3D9OA 3Q49B 3DSUA 3PE3A 3RSEG 2H6HA 1A5EA 3UM1A 4K03A 1V55E 3CKBA 3Q75A 4TNMA 3DRAA 5T3RA 1H0AA 2UY1B 4FZDA 4HOSA 3FHEA 4L23A 4HOQA 4CB8A 3SFYA 5D5KC 3UKYB 2L6BA 4XI0A 4I37A 4U5LA 3SLAA 3ABKE 3QC1A 2V4LA 4CDRA 3NQPA 3CVUA 4MRUA 4A1SA 1AWCB 1G3JA 2VQ2A 3IBVA 2WXRA 3HVEB 1KT0A 4LUNU 4HBDA 4V3QA 5AJLA 2AVPA 4WWOA 3PS6A 4KVOA 1H6OA 2JDQA 3TWTA 2AW6A 2LSVA 4I9EA 3ODSA 3HXFA 4LEUA 4XE0A 4J0UA 3I5PA 1HX8A 1TNOA 4ZDUA 3PZ4A 2ZIRA 3ULQA 4U8YD 4EVTA 1HFAA 3UT7A 3HHMA 2RKKA 3AG4E 2W3CA 3IXEA 4QFVA 3CHQA 4XZRB 3WPTA 2HYZA 3TJZB 3KAEA 3QB2A 4BT8A 4RQIA 4D10C 2WQHA 3OUXA 3CGHA 2AXVA 4AEZC 3JXJA 3RZ9A 4I1EA 3LTJA 4HRMB 2ZU6B 4I5NA 4ATZD 2IX3A 4AV7A 2Z5NA 4ILIA 2A5EA 4CV5B 4XKCA 2X6KA 4DB6A 3Q79A 3Q73A 2PZIA 3VTYA 3JX7A 3R7RA 1OXJA 3JYSA 3R9AB 3CVQA 3FUDA 4F1SA 3KNDA 4A0CA 3NF1A 2QZAA 3OPBA 4JVSA 3IHVA 4A55A 5HQ8A 1VDYA 4OVVA 3SBTB 1FCHA 4GTMA 2HM8A 2NYMA 2OV8A 2Y1LE 1XNFA 1SVXA 4HM9A 5BZUA 4RV1A 3HDXA 5KNGA 3RZXA 4TXRA 3NOWA 2CHZA 4KT6B 4FLHA 4JA7A 4BWRA 2Q7FA 3UKWB 3MJWA 4CRWA 2XENA 2V4HC 2J9QA 2FO1E 4FZFA 3QAQA 2BEDA 2DZOA 1H2UA 4YDYA 4AVXA 3ASGA 3DADA 3AJIA 4BQKA 4I96A 4J8EA 1HXIA 3UXGA 3FTUA 4HQDA 3UKZB 3ZVVA 3P2BA 5CRUA 4G24A 4JXTA 4TUUA 4ADYA 3N71A 4I2ZA 3CSFA 4AXHA 4KYOB 5CLDA 4APFA 3H3DX 4FU3A 3QMLC 4QMIA 4APOA 3NB2A 4BY6A 3UMVA 4TXPA 2R03A 3K7WA 4N5CA 4P6ZG 5G04J 3ZW3A 3C5RA 4UI9J 2DYSE 1NP7A 5BV0A 2LNIA 3ENEA 3FTVA 2IE4A 3UT4A 2HO1A 4ILGA 3GVOA 3PNTB 4K0RA 3ZILA 5ENOD 3JXIA 4BERA 3KEAA 3FDHA 2KXPC 5D0QD 5KLTB 1PJNB 2CFZA 2ETAA 1QBQA 2KBXA 1E8WA 4GTPA 2FULA 3LY8A 2OVBA 2XEHA 4F7AA 5H7PA 5EIBE 3NMXA 3V74A 5J3VA 4G25A 2V5FA 3Q0MA 2GRRB 2XZTG 4HNAD 1KZPA 4U0SA 1OCOE 3TWSA 4K6JA 3JQ0A 1N54A 4HTVA 2J4DA 1ELKA 3D9HA 2R17C 2I1JA 5CCMA 3J5PA 2Y69E 5KJLA 4HORA 2OF3A 2C0MA 3LEWA 4QMJA 3EA5B 1MX2A 2R59A 3EHRA 3E4BA 4AY6A 4DBAA 1XQRA 3RO3A 1O6PA 1DVPA 4BA3A 3TWRA 3S7FA 4DX5D 3E33A 4HI9A 3FUIA 5A6CA 3MV2B 2X19B 4UI9K 3GB8A 2LAHA 2J08A 4DRXE 2X6IA 5AAOA 3ZYQA 1NA3A 1Q1TC 2OEVA 1N9AA 4MBGA 5ARFA 1Y2AC 5G04C 3ODRA 3S2AA 1ELRA 4FHJA 3JUIA 3UM3A 3EBBA 5J08A 1UOHA 5BT1A 3CR3A 2WB2A 2XGOA 3DSWA 2DIWA 1LUJA 2GROB 2KZTA 4GZ6A 3UJ4A 3FP3A 2P2CP 3NAWA 4QQIA 3SI5A 4ANXA 5FINA 2NC9A 1T08A 2P9NG 5HRYA 1TNUA 3S7BA 3LYAA 3DXKG 1HG2A 3QK0A 2LUHA 4LRZA 1EF1C 4KZ0A 4WV6A 3ZIMA 3I4GA 2QC9A 2IF4A 3RRUA 4KZCA 3Q7AA 4DX2A 4N2SA 3Q5UA 4HVBA 3D9PA 2Y4UA 3FEYA 4B8OA 3D9LA 3QARA 5FWQA 1PAQA 4L4HA 2XS8A 5CTTA 5ENPD 2B6CA 4L7TA 5JJTA 3FEXA 4BESA 4HNMA 3QGBA 5LCWJ 2RU4A 1OY3D 2L6JA 5AYWD 3CVNA 2BKUB 4V3IA 2C1MA 3X2QE 4Q96A 1XM9A 3P1UA 4O6FA 3L22A 5JJ6A 3Q0RA 3BSBA 3ZIRA 2J4BA 4JHJA 4TV3A 4H7YA 4LNGA 4ILHB 4GYOA 4YGXA 3PUJA 2PQNA 4CYMD 1B3UA 1KT1A 1E8ZA 1WA5B 4B89A 2OT8A 5BXOA 3DEPA 3U4TA 2Z5OA 2IQCA 3B7RL 2V8SE 1PY1A 3FU0A 4JEUA 1O1TA 3QWPA 1L5JA 3FUMA 4GA0A 4OYSA 4MS6A 1LD7A 1BK5A 1E7UA 5BW8C 4V3OA 4PS3A 2GW1A 2CG3A 4GPKA 1IB2A 2PF4A 1U3DA 2WXQA 4GB9A 3L6AA 2EIKE 2NPPB 4A3TA 5CL9A 1DCQA 3L08A 3AU5A 5FQ6A 3FTSA 4J7WA 3APCA 4DUIA 2WQ6A 2NYJA 4H3KA 3ZFWA 2XS1A 3LY7A 2FBNA 4AJWA 3RK6A 1FVHA 4DZSA 3FGAA 1IHBA 2NSZA 3LTMA 1N0RA 4I8MA 2VGXB 3WOYA 4XKBA 2YNRA
chains in the Genus database with same CATH topology
2XA7A 3FHEA 4PS8A 3IEGA 4HOQA 4L23A 4HOSA 1WAO1 3ZIPA 3CV0A 4PUCA 4CB8A 4U8HA 3AU4A 5D5KC 2WXOA 3UKYB 4HXTA 4XI0A 3UQ3A 4I37A 2BNXA 2H4MA 4U5LA 4YVQC 3GZSA 2X6JA 1Z6TA 3TL5A 4PDXA 3SLAA 3CHPA 4N2QA 2YJYA 3QG9A 3CEQA 3CQCB 3QC1A 5ENNA 2V4LA 2Z5MA 4CDRA 5DIZA 5C1DA 1Y6IA 2C0LA 3K4EA 2UWJG 3NQPA 3CVUA 4MRUA 2PQRA 4PLSA 4A1SA 4AOFA 1G3JA 3ML8A 4DJSA 1OWLA 3IBVA 4R11A 3OQSA 1KT0A 2VQ2A 2WXRA 3HVEB 4WNDA 2VJ8A 4C9BB 4LUNU 4UQXA 4G3AA 4U5VA 2IJGX 4PVZA 1Y8MA 4V3QA 5AJLA 2QK2A 1HF8A 2AVPA 2XGSA 2JKTB 4WWOA 4FC8A 2C1TA 4O27A 3PS6A 4KVOA 2JDQA 1UJKA 1TH1A 2DCPA 2LAIA 2AW6A 2I9CA 3HVEA 2LSVA 4FFBC 4JLQA 3UL1B 3Q0LA 4JPSA 4I2WA 4UQYA 5ANLA 1M5NS 4UAEA 4EVAA 2FO7A 4I9EA 4DJAA 5JJ7A 2JEKA 3BCTA 3ODSA 3K62A 2RG8A 4JW1A 5SWFA 3CLJA 4LEUA 4MLPA 4XE0A 2YHEA 3SF4A 3IFQA 4W9RA 3JY1A 4J0UA 3I5PA 2I2OA 2YHCA 1I7WA 3OUWA 3TPOA 3OBVA 3QGCA 3PEUB 3U3WA 1M1EA 3CK7A 4P29A 1HX8A 4L1BA 3U9WA 3GYZA 4ZDUA 5CHEE 5G2NA 2L0TB 3ULQA 4PLQA 4EVTA 3FUHA 4G26A 1HFAA 2JKRA 2L9BA 2YINA 3G2SA 3JCKC 3KS2A 2WXNA 4JZYA 3RRMB 3EDTB 3HHMA 3UT7A 3TJ3A 3RKVA 5LCWJ 2W3CA 4QFVA 2VGXA 4EV9A 4BX9A 1W63B 2WXMA 3CHQA 5T4YA 2L0IA 5ARGA 3Q5MA 4RZPA 4XZRB 3WPTA 2HYZA 3TJZB 1DNPA 4ANVA 3D9MA 2XQ0A 2WM9A 3KAEA 3QB2A 4BT8A 4CCAA 4D10C 3AU3A 3SNXA 5C2YA 3GZ1A 2WQHA 3ZRHA 3ZIQA 4DK5A 3OUXA 4BSXA 1TJCA 3CGHA 2AXVA 3MYVA 4NEEA 1EE4A 4AEZC 3CHRA 2F31A 3CKCA 2FI7A 4G2VA 4UWGA 5A23A 3V6YA 4U58A 4IRUA 3RZ9A 3Q4AB 4I1EA 1IBRB 3LTJA 3Q47B 1ZBPA 2ZU6B 2AXUA 4U5SA 1E90A 3UKXB 1MQSA 4L7MA 4I1OB 2PM7A 3ZEFA 5AJDA 4F53A 4I5NA 3BG0B 3IHYA 2IX3A 4YVOA 5HUYC 3UUXA 2Z5NA 4ILIA 2XOAA 2VGYA 4AV7A 4Q69A 1TEZA 4CV5B 4XKCA 3ZN3A 3FH8A 2X6KA 2RU4B 3QOUA 4HOUA 2WXJA 4DB6A 1HZ4A 2DBAA 3PH0C 4I9CA 4CT0A 5EDSA 2PZIA 3ESKA 4GZ3A 3VTYA 4U07A 3TXNA 3IBEA 3JX7A 2KCLA 3CVLA 4YI0C 1M8YA 3Q0QA 3R7RA 5CMWA 3KEZA 3JYSA 4G23A 3R9AB 3WOZA 3CVQA 3FUDA 4F1SA 2KC7A 4YK6A 3KNDA 4A0CA 3NF1A 3OPBA 3K5QA 4JVSA 2WQ7A 4OO6A 3PSTA 4D49A 3IHVA 4A55A 5HQ8A 5J90A 1VDYA 4OVVA 1TE4A 3SBTB 4UWKA 3EIJA 1B89A 3TXMA 1FCHA 3VLDA 5CL4A 3K5YA 2BTDA 2NYMA 2HM8A 2M63A 2MHKA 3FH5A 2OV8A 5FQ7A 5JHAA 4BPLA 5FZSA 2MOWA 4L4IA 2P8QA 4AIFA 3D9JA 5EX3A 3FUKA 4AY5A 4QMHA 1XNFA 1IQ1C 1OWMA 2IONA 2Y4TA 5FZRA 2WXPA 4DLOA 1INZA 1IALA 3TGOA 2DB0A 4HM9A 4RV1A 2NYMB 5BZUA 3GVTA 3HDXA 4MZ5E 3RZXA 4FP7A 4G11A 4WNEA 3ZPJA 3UPVA 3NOWA 3CK8A 2CHZA 3PE4A 4KT6B 1LRVA 2CFUA 3FTWA 4UADA 4FLHA 4EV8A 3CHSA 4FULA 4GU5A 4JA7A 4AXHA 5M72A 4BWRA 2Z5JA 4U3JC 2Q7FA 5G05C 1GCJA 3LKUA 3U64A 4BTAA 3RU0A 4I6JA 5AEIA 3ESLA 3GAEA 2WTKA 3UKWB 3MJWA 4WNGA 5CL8A 4EVPA 4CRWA 3TG4A 2GL7A 2JKTA 2Z6GA 4CB9A 1O6OA 4B8PA 2J9QA 3IKOB 3ZYMA 1BK6A 2X38A 5BPPA 3VTXA 3Q0PA 4FZFA 1KLXA 3FWVA 3MGBA 3PREA 5HI7A 3V71A 1WM5A 3QAQA 2VSOE 3OXLA 1QZ7A 4JW3C 4UWXA 1H2UA 4J8DA 4AVXA 4PS7A 4F3VA 4B8AA 1YA0A 1PJMB 1JPLA 3ASGA 3DADA 4JA9A 2IWHA 1Z2CB 4JHRA 2X1GF 5DBKA 2UY1B 3T5VA 2R5SA 3ZYLA 4EZKA 4BQKA 1UKLA 3G2TA 1JWFA 3RRNB 3O4XA 3T5XA 4CT6B 4I96A 4EQFA 3WOYA 5FC8E 1MHQA 4J8EA 1HXIA 4BTBA 2C2LA 1N52A 3JXZA 2XHEA 3O48A 3O2QA 3ONLA 4K92A 3FTUA 3UKZB 3Q0SA 3ZVVA 1W9CA 4CDNA 4I3NA 4DPRA 3K7VA 3P2BA 1HH8A 2X6HA 4G24A 3ZIOA 4JXTA 2IAEB 4TUUA 5FZQA 4ADYA 4KZGA 2JKRB 3N71A 3S7DA 4I2ZA 3TG5A 3CSFA 1P5QA 4B0ZA 1QGKA 4DB9A 3SHFA 3BVSA 3L3FX 3D9IA 4KYOB 3TAXA 5CLDA 3OTNA 4LERA 4XIFA 4APFA 1S0PA 1W63A 3H3DX 4IMJA 1NZNA 2KCKA 1EJYI 5KL1A 2KCVA 2PL2A 3QMLC 2WXKA 4QMIA 3FUFA 4UI9C 4APOA 4BY6A 1Z3XA 3D9KA 2XGMA 4UQZA 3UMVA 1BPOA 3FH7A 5LP0A 2VTBB 4NZWA 2AWIA 3D9NA 4N3BA 2XPYA 2BAPA 3K7WA 3L6XA 3G2WA 4GMJA 4N5CA 3D3MA 4ME2A 2JAKA 1EPUA 4P6ZG 3I4RB 5G04J 3ZW3A 5LOZA 3FTXA 4ANUA 2Z6HA 3K64A 1I7XA 5KUBA 3HYMB 4U5NA 4V3RA 1H6KA 4UI9J 1NP7A 3MCXA 2LNIA 3ENEA 3FTVA 2IE4A 3UT4A 5BV0A 1QZ2A 1H2VC 2HO1A 4P6ZB 4ILGA 3GVOA 1XGWA 5CLEA 4DB8A 2WXFA 2IAEA 2XCBA 3GNIA 3NMZA 2BF0X 3FUNA 3B13A 3PNTB 2MRIA 3PZDA 3ZILA 4K0RA 4LCTA 3RO2A 1UG3A 4FA6A 3FEXC 3LS8A 1M8WA 5LX8A 4A3VA 2NYLA 3C98A 3NMWA 3FDHA 3UT8A 3JXYA 4HFGA 1HS6A 5D0QD 1JPWA 5E6QB 1EJLI 1PJNB 5KLTB 2CFZA 3EHMA 3O4ZA 3G2UA 3CHMA 4MKTA 5KJMA 5H2WA 4B18A 3L16A 4RVBA 5G05J 1E8WA 4JW2A 4R0ZA 3VLEA 1QBKB 2VSXE 3JQ1A 4I17A 2GGFA 2FULA 4IULA 3PVLA 3MKRA 4N3AA 3ASFA 3ZHEA 3CHOA 3Q0OA 3LY8A 2OVBA 4JHKA 2VSNA 4BT9A 4CT7B 1OWOA 2OVFA 2X3MA 4I6IA 4HXIA 4F7AA 3CVVA 1WY6A 2YNSA 4B8JA 3K49A 2XCCA 1E7VA 1HE8A 2Q5DA 3C2GA 3NMXA 3V74A 3FFLA 4J8SA 5J3VA 4G25A 2V5FA 3Q0MA 4L2LA 4EZLA 1UPLA 2QY7A 5CL5A 1IHGA 4U0SA 4DVGB 4K6JA 2Y3AA 3CVYA 3GS3A 3JQ0A 3Q15A 1N54A 5KLRB 4HTVA 3O2SA 2J4DA 2QNAA 1QGRA 3FGAB 5B56A 1ELKA 1H2TC 3LY9A 4GCNA 3MKQB 2R17C 3TT9A 2I1JA 4ACKA 4I0YA 4U0UA 4C0MA 2IOSA 5CCMA 5KJLA 1HU3A 2OF3A 3O2TA 4XI9A 4XX5A 4HORA 4GMNA 3TPMA 2C0MA 3LEWA 4QMJA 3EA5B 4FJYA 1E8YA 4NACA 1IQUA 2R59A 3B7UX 3LXUX 2VGLA 2KZTB 3E4BA 3L54A 3OAWA 4AY6A 4U54A 3URZA 1UPKA 4DBAA 3LJ3A 4KXKB 4H7XA 1XQRA 3RO3A 1EE5A 1O6PA 1DVPA 4OVUA 5LSWA 3MEKA 2CHXA 3MKQA 2XRYA 4BA3A 3PRZA 4PLRA 4IN3B 3S7FA 4MZ6E 3ZGQA 5BYMA 3A6PA 3RJVA 4FU3A 4BX8A 3FY4A 3FUIA 5A6CA 1U6GC 5EX0A 3QKYA 3MV2B 2X19B 4UI9K 3GB8A 4HOTA 2LAHA 2J08A 5CMYA 3CVXA 2X6IA 3OXGA 4I6EA 4RG6A 3T8MA 3ZYQA 1NA3A 1Q1TC 4GA2A 4EBAA 3MZLB 3ONKA 5ARFA 1Y2AC 5G04C 3QNKA 3ODRA 2FF4A 4U04A 3C5WA 4D4EA 1EYHA 3S2AA 1ELRA 4I7IA 4FHJA 1A17A 3JUIA 2IOLA 3WXXA 1SZ9A 3EBBA 4ATGA 4CGVA 5J08A 5BT1A 3CR3A 2WB2A 5T8IA 5CL6A 4RXHB 3L6YA 2XGOA 5ANRA 3ZHEB 1UN0A 4LACA 2DIWA 1LUJA 4GYWA 4PH4B 4FQ3A 2VGLB 5BZ5A 3SL9A 2KZTA 4FJZA 4GZ6A 4JC8A 3EHNA 4Y6CA 5SW9A 5KCMA 2VTBA 3FP3A 5AENA 3FU3A 5FQ6A 2LSUA 1XQSA 3SI5A 3SGHA 2NPPA 4ANXA 2NC9A 1IYGA 2BCTA 4I5LA 1T08A 1LF8A 3AS8A 4OIHA 2KM4A 3NZUA 3LYAA 3S7BA 1HG2A 2OOEA 5KJNA 3ZYKA 3LPZA 3QK0A 4LRZA 4E4VA 3T7UA 4WNFA 3BG1B 4UQIB 4NQ0A 1JDHA 2Z5KA 3FEYC 1EF1C 3MX3A 4GMLA 4KZ0A 3UX4A 5AIJA 3ZXSA 4WV6A 3ZIMA 3I4GA 4U63A 3EG5B 4IYPA 3B7TA 1OWNA 5FQ4A 3QWWA 2PKGA 4EZJA 1TJFA 2WXGA 2IF4A 1E96B 2A5UA 4MFVA 5CLCA 3K9IA 4KZCA 5DN7A 4GYYA 3RRUA 3SZ7A 4JKQA 4J6IA 2ILRA 3CSTA 4I43A 3VLFA 4EECA 1UJJA 4N2SA 5G55A 3KD7A 4YJEA 3NZSA 3QHEA 5BZVA 3BX2A 4UWLA 4EBAG 2VSYA 4FDDA 1UW4B 5EKFA 5BUZA 3Q5UA 3G2VA 1M8XA 2QFCA 4UWFA 4HVBA 3ND2A 4N39A 2I1KA 4J8FA 3D9PA 2AXZA 2FV2A 3ZINA 2WMNA 2Y4UA 4FLBA 2GRLA 3CIAA 3FEYA 3SFZA 5LFAA 2YNRA 4CT4A 4B8OA 2XPZA 1QQEA 3D9LA 3I3NA 3QARA 5CLBA 5FWQA 4WAFA 1PAQA 3BWTA 1FVFA 1NA0A 3AS4A 3CK9A 4L4HA 3Q0NA 5CTTA 3L3QA 1U3CA 4RG9A 5D0OD 3MV3B 4DLQA 2CG2A 2WXHA 4GCOA 5K6SA 3EIQC 4CRUB 4A1GA 3PDNA 4FADA 4L7TA 5JJTA 5EKGA 5EWPA 5H2XA 5CL7A 4GA1A 3FEXA 4G1TA 4HNMA 2WMOA 3SD5A 3QGBA 5KLAA 2CHWA 5HHGE 2RU4A 2IFUA 5KL8A 3MA5A 5E76A 4DI3A 2X6FA 3ZHPA 1OYZA 2QMRA 3UVUA 2L6JA 3CVNA 2BUGA 1HG5A 3FU5A 2KATA 5AYWD 4E6HA 2NXPA 2BKUB 3U66A 1Z3YA 4V3IA 2WXIA 4FHKA 4ANWA 2WXLA 1H19A 3CVPA 2C1MA 3FUEA 4Q96A 4RSYA 5A7DB 1XM9A 3P1UA 4O6FA 3PUKA 1OWPA 4URKA 3L22A 4I6GA 5JJ6A 3Q0RA 3L17A 2ONDA 3GRLA 3BSBA 3ZIRA 2J4BA 4JHJA 4TV3A 4H7YA 4CRVB 3DPDA 5LCWC 4ILHB 2NYLB 4GYOA 3ASHA 3C2HA 2I6HA 4GAAA 2YNQA 3B7SA 4YGXA 2J49A 3PUJA 4GZDA 5FT9A 2PQNA 4B94A 5CCLA 5CLAA 2UY1A 4L2YA 5BNWA 1B3UA 4KBQA 3BX3A 1E8ZA 1KT1A 3VWAA 1WA5B 3R7QA 4WWPA 4XZ4A 4B89A 1V18A 2FEZA 4CBAA 4YJLA 3PSPA 4MFUA 5SVZA 4FZAA 1Q1SC 2OT8A 4UQIA 3FULA 4NURA 5FQ8A 3LVQE 3LDZA 3QDNA 3DBSA 1UN8A 3U4TA 2Z5OA 4H3HA 4ACLA 2IQCA 3B7RL 1JWGA 3GQ2A 4CDMA 3ZKVA 3K5ZA 2IE3A 3QJZA 2WPVA 3APDA 4JW2B 4GZ5A 2V8SE 1PY1A 3FU0A 1UN9A 4JEUA 4U2XD 3W3UA 2EQXA 3QWPA 1L5JA 1SQMA 2RD0A 1EDUA 3FUMA 4B8CB 4GA0A 1ZU2A 4MS6A 3GW4A 4OYSA 5FTPA 4AP2A 1JUQA 3FTZA 3ML9A 1BK5A 1PC2A 1E7UA 5BW8C 3FTYA 4UWHA 4V3OA 4M3OA 3L13A 4U5UA 1ELWA 3ZIKA 2XPIA 4U0ZA 4PS3A 4EPZA 2GW1A 1F59A 2CG3A 2VYIA 1IQRA 3LCAA 5JJAA 3LVRE 4HS2A 4I1AA 3L08A 4JL0A 4GPKA 4I1MA 2HR2A 1IB2A 5BZ1A 2PF4A 1U3DA 2WXQA 3PEVB 4GB9A 4WWNA 3SBSA 3L6AA 3TJPA 3LWWA 4I2SA 4R10A 2PM6A 4BFRA 2WVIA 3CQGB 4GZCA 3TX7A 5HUWC 3K61A 2IW3A 2YQ8A 4KMOA 4YNDA 5FJYA 5BV1A 2NPPB 3BTRC 4A3TA 3ASDA 3QWVA 4Q94A 4R7LA 4WUYA 4ABNA 5CL9A 3EJNA 3S7JA 3AU5A 5K9SA 1E8XA 5CL3A 1OUVA 2P58C 1HO8A 3IV0A 3GZ2A 3FTSA 2J07A 3VE6A 2LO6A 2QK1A 4NRHB 3UL0B 1GW6A 5EKQD 2E0IA 3APCA 3PNLB 4N3CA 3FU6A 2WQ6A 4CGWA 1M8ZA 2XEVA 3AS5A 4H3KA 1QNFA 3ZFWA 3BSXA 1W3BA 3BEEA 3LY7A 4HLEA 1SZAA 2XA7B 4U5OA 4Y6WA 2FBNA 2J09A 3RK6A 4IMIA 4AJWA 1FVHA 4CEMA 3D9OA 1X5BA 3Q49B 3FUJA 3DW8A 4DZSA 3FGAA 1WA5C 2JLBA 3HIZA 3PE3A 2XRZA 4JEHA 4UAFB 4AM9A 3CVWA 2NSZA 5E75A 4K03A 4DI4A 5JHBA 2GRMA 2IU1A 5KJKA 3LTMA 3CKBA 2E2EA 4C0EA 2A4ZA 4TNMA 3RIBA 2V0PA 3OXFA 4Y5JA 3APFA 4I8MA 1H0AA 4KVMA 2VGXB 5T3RA 1JPPA 4XKBA 3WYFC 4GMOA 4E85A 4TRQA 4FZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3T A;  3VLD A;  3VLE A;  4A3V A;  3VLF A;  4FP7 A; 
#chains in the Genus database with same CATH topology
 4G8L A;  3ZIP A;  3CV0 A;  4GMR A;  4HXT A;  3UQ3 A;  2BNX A;  4N2Q A;  4ZFH A;  4PDX A;  2YJY A;  3QG9 A;  1X81 A;  3K4E A;  2UWJ G;  1RW2 A;  3DXM G;  3TGO A;  4DJS A;  4G3A A;  2IJG X;  1HF8 A;  1K1B A;  1UJK A;  1TH1 A;  2DCP A;  3SY2 A;  3UL1 B;  2IO2 C;  4I2W A;  4DJA A;  2FO7 A;  3E37 A;  3CLJ A;  3IFQ A;  4W9R A;  2ZGG A;  1I7W A;  3C3O A;  3U3W A;  1M1E A;  1BI8 B;  3UI2 A;  4JZY A;  3JCK C;  3UIN C;  2WXN A;  1MX4 A;  4HRN A;  3UPV A;  2WXM A;  4YDO A;  2L0I A;  4GTS A;  5KBA A;  1NI1 A;  1DNP A;  3SNX A;  5C2Y A;  1LTX A;  2GRP B;  3ZRH A;  4DK5 A;  1OT8 A;  2IO3 C;  3CHR A;  3CKC A;  5A23 A;  3NBN B;  3V6Y A;  4U58 A;  4TXQ A;  2PM7 A;  5AJD A;  4YVO A;  3BG0 B;  1TEZ A;  2XOA A;  3QOU A;  2RU4 B;  2WXJ A;  5ENT D;  4I9C A;  5EDS A;  3ESK A;  3TXN A;  3IBE A;  2KCL A;  3KEZ A;  4GTQ A;  4G23 A;  2WQ7 A;  5EIL A;  5J90 A;  3Q9U C;  4UWK A;  3EIJ A;  3TXM A;  4EZL A;  3K5Y A;  5FQ7 A;  5CBO A;  2H6I A;  4L4I A;  2P8Q A;  1OCR E;  4DX7 D;  5EX3 A;  1IQ1 C;  2ION A;  2Y4T A;  1INZ A;  2WXP A;  2DB0 A;  4WNE A;  4FP7 A;  3ZPJ A;  1LRV A;  4EV8 A;  4GU5 A;  5B1A E;  4U3J C;  5G05 C;  1GCJ A;  4BTA A;  3RU0 A;  3ESL A;  3GAE A;  2WTK A;  3BQO A;  3TG4 A;  4CB9 A;  3ZYM A;  4B8P A;  3Q78 A;  3VTX A;  3Q0P A;  3FWV A;  1KLX A;  3PRE A;  3V71 A;  2VSO E;  4JW3 C;  4F3V A;  1JPL A;  5DBK A;  3NOC D;  4JHR A;  3ZYL A;  3G2T A;  2VGE A;  3O4X A;  3T5X A;  1MHQ A;  3TWU A;  3JXZ A;  3O2Q A;  1W9C A;  4I3N A;  3HXE A;  1HH8 A;  3V2X A;  3ZIO A;  5FZQ A;  4KZG A;  3S7D A;  4B0Z A;  3SHF A;  3L3F X;  1K1A A;  3APF A;  1W63 A;  2PL2 A;  2WXK A;  3FUF A;  1EJY I;  4UI9 C;  1N4Q A;  2XEE A;  3R9M A;  4UQZ A;  2VTB B;  4NZW A;  3L6X A;  5LOZ A;  1O5M A;  2Z6H A;  1I7X A;  5KUB A;  4V3R A;  4GPM A;  4RLY A;  1H2V C;  4DB8 A;  1S63 A;  2XCB A;  3GNI A;  3PZD A;  3B13 A;  3RO2 A;  4FA6 A;  1UG3 A;  3C3R A;  1M8W A;  3SFX A;  5LX8 A;  4A3V A;  2NYL A;  1YMP A;  3C98 A;  3UT8 A;  3JXY A;  4K5C A;  1U2V G;  1JPW A;  5E6Q B;  3O4Z A;  3LJN A;  5KJM A;  5H2W A;  4RVB A;  1TN7 A;  5G05 J;  3ZEF A;  4I17 A;  4R0Z A;  3VLE A;  3JQ1 A;  1OCZ E;  2GGF A;  1N4R A;  3ZGQ A;  4J8Y A;  3ASF A;  4BT9 A;  4JHK A;  4CT7 B;  1OWO A;  2X3M A;  4JB8 P;  4B8J A;  3K49 A;  1N94 A;  2Q5D A;  1O1R A;  1NL4 A;  2R05 A;  1IHG A;  4DVG B;  2Y3A A;  5KLR B;  3HXC A;  5JMN D;  1N95 A;  1QGR A;  1TNZ A;  1H2T C;  3LY9 A;  4ZHB A;  3MKQ B;  4ACK A;  2IOS A;  1HU3 A;  3DST A;  3O2T A;  3UKR G;  2F8X K;  3B7U X;  4K5B A;  3W9F A;  2VGL A;  3L54 A;  5KNH D;  5LSW A;  4IN3 B;  5BYM A;  3A6P A;  3FY4 A;  5CMY A;  4RG6 A;  3T8M A;  3MZL B;  3QNK A;  2FF4 A;  1EYH A;  4I7I A;  3WXX A;  1SZ9 A;  4CZ2 D;  4RXH B;  3L6Y A;  3ZHE B;  4PH4 B;  3C72 A;  4GYW A;  3T8S A;  3SL9 A;  4Y6C A;  5KCM A;  5SW9 A;  2NPP A;  2RFA A;  2BCT A;  3AS8 A;  4OIH A;  3ZYK A;  4EHM A;  3BG1 B;  2P9U G;  2Z5K A;  1SA5 A;  4IYP A;  3QWW A;  4EZJ A;  2WXG A;  1E96 B;  2A5U A;  4MFV A;  5CLC A;  5CER B;  2P9P G;  4EEC A;  3KSQ A;  3NZS A;  5BZV A;  4UWL A;  5EKF A;  3G2V A;  1N4K A;  1M8X A;  4N39 A;  4N5Q A;  4Z68 A;  2WMN A;  4C48 B;  3CIA A;  5LFA A;  3I3N A;  5CLB A;  3BWT A;  1NA0 A;  3Q0N A;  5D0O D;  1DC2 A;  4CRU B;  2P9I G;  5EWP A;  4G1T A;  3SD5 A;  5KLA A;  5HHG E;  3SQV A;  3MA5 A;  4BET A;  2QMR A;  3FU5 A;  1BLX B;  4OAV B;  2KAT A;  2NXP A;  3E34 A;  1H19 A;  3FUE A;  5A7D B;  3V30 A;  4LG6 A;  3ZU7 B;  5FT9 A;  4GZD A;  1S70 B;  3ZXP A;  5CLA A;  3VWA A;  2FEZ A;  4CBA A;  4YJL A;  2ZGD A;  3EHQ A;  4CDM A;  1TYQ G;  3ZKV A;  3K5Z A;  3QJZ A;  1UN9 A;  3W3U A;  5BXU A;  1SQM A;  4B8C B;  1ZU2 A;  3GW4 A;  1JUQ A;  3ML9 A;  1PC2 A;  3L13 A;  5AQA A;  3PZ2 A;  1F59 A;  2OCC E;  1IQR A;  3LCA A;  5JJA A;  4JL0 A;  4I1A A;  2HR2 A;  3PEV B;  3TJP A;  5KWD A;  3LWW A;  4BFR A;  3TX7 A;  2YQ8 A;  1LD8 A;  5BV1 A;  3BTR C;  3ASD A;  4R7L A;  4Q94 A;  3EJN A;  1KZO A;  3S7J A;  1HO8 A;  4NRH B;  3GZ2 A;  2J07 A;  5EKQ D;  1GW6 A;  1AP7 A;  3PNL B;  5CEC B;  3AS5 A;  3HXB A;  3FUJ A;  3ASO E;  3DW8 A;  1WA5 C;  2JLB A;  3HIZ A;  2XRZ A;  4JEH A;  4NIK A;  4UAF B;  5E75 A;  1YYH A;  5JHB A;  2E2E A;  1D8E A;  2A4Z A;  3RIB A;  3OXF A;  2DYR E;  3WYF C;  3AAA C;  2XA7 A;  3IEG A;  1WAO 1;  4U8H A;  4PUC A;  3AU4 A;  2WXO A;  2H4M A;  2X6J A;  1Z6T A;  3TL5 A;  3CHP A;  3CEQ A;  3JUE A;  1FT2 A;  1Y6I A;  4PLS A;  2H6F A;  4AOF A;  4WND A;  2VJ8 A;  4U5V A;  2F0Y A;  1BU9 A;  2LAI A;  2I9C A;  4FFB C;  4UQY A;  3Q0L A;  4JPS A;  3E30 A;  2JEK A;  3BCT A;  3K62 A;  2RG8 A;  4MLP A;  2YHC A;  3OUW A;  3TPO A;  3OBV A;  3PEU B;  4P29 A;  4L1B A;  3U9W A;  3GYZ A;  2L0T B;  3FUH A;  2EIJ E;  3G2S A;  3EDT B;  3TJ3 A;  3RKV A;  4BX9 A;  4EV9 A;  1W63 B;  5D66 A;  5T4Y A;  3Q5M A;  4RZP A;  4ANV A;  3D9M A;  2XQ0 A;  2WM9 A;  3ZIQ A;  5D2M C;  4BSX A;  1TJC A;  4NEE A;  3J5Q B;  2F31 A;  4G2V A;  4UWG A;  4IRU A;  3Q4A B;  1IBR B;  3Q47 B;  2AXU A;  4U5S A;  1E90 A;  3UKX B;  4GTR A;  4I1O B;  4L7M A;  3ISM C;  5HUY C;  3UUX A;  3UIO C;  2P9K G;  3ZN3 A;  4HOU A;  3T9K A;  3TWW A;  1TNB A;  4GZ3 A;  4U07 A;  5JA4 D;  5AQ7 A;  3CVL A;  4YI0 C;  5CMW A;  3WOZ A;  2KC7 A;  5ITZ F;  4OO6 A;  1SW6 A;  3PST A;  3L9T A;  1TE4 A;  1B89 A;  3VLD A;  5CL4 A;  2BTD A;  5JHA A;  4BPL A;  4AIF A;  3D9J A;  2B0O E;  3BUA A;  1OWM A;  5FZR A;  4DLO A;  5CED B;  1IAL A;  5HKP A;  3EU5 A;  4MZ5 E;  2P9S G;  2AJA A;  3FTW A;  4UAD A;  4FUL A;  5M72 A;  4O60 A;  2Z5J A;  3U64 A;  3LKU A;  3V2O A;  3HXD A;  5AEI A;  4EVP A;  2GL7 A;  3ABM E;  2EIM E;  1BK6 A;  2X38 A;  3DSV A;  5BPP A;  5HI7 A;  3MGB A;  1WM5 A;  3OXL A;  4PS7 A;  4B8A A;  1PJM B;  4JA9 A;  2LXM A;  1Z2C B;  2X1G F;  3RAU A;  1UKL A;  3UTM A;  3RRN B;  4CT6 B;  4EQF A;  4BTB A;  3DPY A;  2ETB A;  2RFM A;  4K92 A;  3Q0S A;  4CDN A;  3Q9N C;  3K7V A;  5B3S E;  2X6H A;  2IAE B;  2JKR B;  3TG5 A;  1WG0 A;  1QGK A;  3BVS A;  3D9I A;  3TAX A;  3OTN A;  2KCK A;  2EIN E;  3D9K A;  3FH7 A;  2AWI A;  4N3B A;  2XPY A;  2DVW A;  3G2W A;  3D3M A;  4ME2 A;  3I4R B;  4ANU A;  3FTX A;  4U5N A;  1H6K A;  3MCX A;  3UIP C;  4P6Z B;  2IAE A;  4GCN A;  2BF0 X;  3NMZ A;  4LCT A;  3E32 A;  3FEX C;  3NMW A;  4HFG A;  4JD2 G;  1HS6 A;  3EHM A;  3G2U A;  4U96 D;  3L16 A;  2VSX E;  4IUL A;  1QBK B;  4N3A A;  3ZHE A;  3CHO A;  3Q0O A;  2XCC A;  1E7V A;  1HE8 A;  4LNU D;  3C2G A;  5ENQ D;  3CVY A;  3GS3 A;  3O2S A;  3FGA B;  5B56 A;  4YDE A;  3ABL E;  4I0Y A;  4U0U A;  4C0M A;  4XI9 A;  3UKU G;  4GTO A;  4GMN A;  3TPM A;  4FJY A;  4NAC A;  3EUV A;  2H6G A;  3LXU X;  4X8Q A;  1UPK A;  4H7X A;  4OVU A;  1EE5 A;  5ENS D;  3MKQ A;  2XRY A;  3PRZ A;  4MZ6 E;  4A63 B;  5EX0 A;  3QKY A;  4LNB A;  4HOT A;  1O1S A;  3OXG A;  4GA2 A;  4EBA A;  3ONK A;  2MYO A;  1A17 A;  5EYP F;  2ETC A;  2IOL A;  2PNN A;  1JCQ A;  5T8I A;  5CL6 A;  2VGL B;  5BZ5 A;  2VTB A;  4FJZ A;  2LSU A;  1XQS A;  4L9P A;  1FT1 A;  1IYG A;  1LF8 A;  5KJN A;  3NZU A;  3LPZ A;  2GRQ B;  4UQI B;  2IY0 C;  4GML A;  3FEY C;  3MX3 A;  1TJF A;  3K9I A;  1JCR A;  5DN7 A;  5FIO A;  4J6I A;  1RZ4 A;  1UJJ A;  5G55 A;  3KD7 A;  4YJE A;  3QHE A;  3BX2 A;  2VSY A;  5BUZ A;  4XEI G;  4UWF A;  3ND2 A;  2AXZ A;  2FV2 A;  3ZIN A;  4CT4 A;  1QQE A;  4WAF A;  3AS4 A;  3CK9 A;  1FVF A;  1U3C A;  3L3Q A;  4RG9 A;  4DLQ A;  4GCO A;  2WXH A;  1OCC E;  4FAD A;  5EKG A;  5H2X A;  4GA1 A;  2CHW A;  2IFU A;  5E76 A;  5KL8 A;  3ZHP A;  1OYZ A;  3UVU A;  1HG5 A;  3U66 A;  1Z3Y A;  3AG1 E;  2WXI A;  4FHK A;  4ANW A;  3CVP A;  3PUK A;  1OWP A;  4F1P A;  3GRL A;  4CRV B;  2NYL B;  2I6H A;  3NOG D;  3W9G A;  3B7S A;  5CCL A;  4L2Y A;  3BX3 A;  3R7Q A;  4WWP A;  4XZ4 A;  4E6H A;  3PSP A;  4FZA A;  5CBN A;  4UQI A;  3LVQ E;  3LDZ A;  1UN8 A;  3DSS A;  4H3H A;  1JWG A;  3GQ2 A;  2IE3 A;  4GZ5 A;  4JW2 B;  2EQX A;  1EDU A;  3FTZ A;  3AG2 E;  3FTY A;  1LSH A;  4M3O A;  3L82 A;  4U5U A;  3C3Q A;  4EPZ A;  1N11 A;  2BKG A;  4HS2 A;  4I1M A;  5BZ1 A;  4I2S A;  4R10 A;  2WVI A;  3CQG B;  4GZC A;  5HUW C;  4KMO A;  2IW3 A;  4WUY A;  3ZUV B;  5K9S A;  1E8X A;  4AM9 A;  2QK1 A;  5EN5 D;  2E0I A;  4N3C A;  3BEE A;  4HLE A;  1SZA A;  2XA7 B;  4U5O A;  4CEM A;  2J09 A;  4M7C A;  1X5B A;  3CVW A;  4DI4 A;  2GRM A;  2IU1 A;  5KJK A;  4C0E A;  2V0P A;  3ZKJ A;  4Y5J A;  3BU8 A;  4KVM A;  4E85 A;  1JPP A;  2OOE A;  4GMO A;  4TRQ A;  4PS8 A;  5CEA A;  4HI8 A;  3ULE G;  4YVQ C;  3UM2 A;  3GZS A;  1D9S A;  3CQC B;  1MJ0 A;  5ENN A;  2Z5M A;  5DIZ A;  2C0L A;  2PQR A;  3ML8 A;  3ULY A;  1OWL A;  4R11 A;  3OQS A;  1NFI E;  4C9B B;  4UQX A;  4U8V D;  3AG3 E;  4PVZ A;  1Y8M A;  2LXL A;  2QK2 A;  2XGS A;  2JKT B;  4FC8 A;  2C1T A;  4O27 A;  3HVE A;  4JLQ A;  2GRN B;  2OEW A;  5ANL A;  1M5N S;  4UAE A;  4EVA A;  5JJ7 A;  4JW1 A;  5G2N A;  5SWF A;  3V31 A;  2YHE A;  3SF4 A;  2IEJ A;  3JY1 A;  2I2O A;  1SA4 A;  2ZXW E;  1N4S A;  3QGC A;  3CK7 A;  1JCS A;  5EYL A;  5CHE E;  4PLQ A;  4G26 A;  3RRM B;  2JKR A;  2L9B A;  2YIN A;  3KS2 A;  3WG7 E;  5AQ9 A;  2VGX A;  5ARG A;  3ZNG A;  4CCA A;  3AU3 A;  3GZ1 A;  4DX1 A;  2XZD G;  3MYV A;  1EE4 A;  2FI7 A;  4HLL A;  1ZBP A;  1MQS A;  4F53 A;  4OAU C;  3IHY A;  5C1D A;  4Q69 A;  2VGY A;  3FH8 A;  1HZ4 A;  2DBA A;  3PH0 C;  4CT0 A;  1Q2Z A;  3T8K A;  1M8Y A;  3Q0Q A;  4YK6 A;  1TN6 A;  3K5Q A;  4D49 A;  2M63 A;  3FH5 A;  2MHK A;  4F6R D;  5FZS A;  2MOW A;  1V54 E;  3FUK A;  4AY5 A;  4QMH A;  3Q7F A;  1K3Z D;  5BNW A;  2NYM B;  4G11 A;  3GVT A;  1G3N B;  1TN8 A;  3CK8 A;  3PE4 A;  2CFU A;  3CHS A;  1QYM A;  4I6J A;  1N4P A;  4WNG A;  5CL8 A;  1Z5S C;  2JKT A;  2Z6G A;  3IKO B;  1O6O A;  2BKK B;  1IXV A;  2DWZ A;  1QZ7 A;  2DZN A;  4UWX A;  4J8D A;  1YA0 A;  2IWH A;  3T5V A;  2R5S A;  2JAB A;  1MX6 A;  1JWF A;  4B93 B;  5FC8 E;  2C2L A;  1N52 A;  2XHE A;  3O48 A;  3ONL A;  4DPR A;  1YCS B;  3DSX A;  3ASN E;  5AN8 A;  1P5Q A;  4DB9 A;  4XIF A;  4LER A;  1S0P A;  2KCV A;  4IMJ A;  1NZN A;  5KL1 A;  5ENR D;  1Z3X A;  2XGM A;  1BPO A;  5LP0 A;  3D9N A;  2R02 A;  2BAP A;  3HRA A;  1D8D A;  4GMJ A;  2JAK A;  1EPU A;  3K64 A;  3HYM B;  2R2L A;  1QZ2 A;  1S64 A;  2Y0B G;  1XGW A;  5CLE A;  5AQB A;  2WXF A;  3FUN A;  2MRI A;  3LS8 A;  1BD8 A;  4G8K A;  1EJL I;  1DCE A;  3CHM A;  2V5Q C;  4MKT A;  4B18 A;  4JW2 A;  2F8Y A;  4BEP A;  3DWL G;  1WDY A;  3PVL A;  3MKR A;  3DEO A;  2VSN A;  3B7B A;  4GTV A;  2OVF A;  3CVV A;  4HXI A;  4I6I A;  1WY6 A;  2YNS A;  1TR4 A;  4J8S A;  3FFL A;  4L2L A;  4YDW A;  1UPL A;  2QYJ A;  2QY7 A;  5CL5 A;  4O1O A;  3Q15 A;  2QNA A;  5IY5 E;  3TT9 A;  4XX5 A;  1ZB1 A;  1E8Y A;  3UM0 A;  1IQU A;  2KZT B;  3OAW A;  4U54 A;  3URZ A;  3LJ3 A;  4KXK B;  3HG0 D;  1FPP A;  4LSZ E;  3MEK A;  4O1P A;  1TNY A;  2CHX A;  4PLR A;  3RJV A;  4BX8 A;  3PZ1 A;  5B1B E;  1U6G C;  2F37 A;  2J8S D;  4I6E A;  3CVX A;  4U04 A;  3C5W A;  4D4E A;  1MZC A;  4ATG A;  4CGV A;  5ANR A;  1UN0 A;  4LAC A;  4JC8 A;  4FQ3 A;  3EHN A;  5AEN A;  3FU3 A;  3B95 A;  3V79 K;  3SGH A;  4I5L A;  2KM4 A;  3KSL A;  2QYU A;  4E4V A;  3T7U A;  4WNF A;  4NQ0 A;  2ZIS A;  3SO8 A;  3TWX A;  1JDH A;  5AIJ A;  3UX4 A;  3ZXS A;  4U95 D;  3PZ3 A;  1IKN D;  4K5A B;  4U63 A;  3EG5 B;  3B7T A;  1OWN A;  5FQ4 A;  2PKG A;  3SZ7 A;  4GYY A;  4JKQ A;  2ILR A;  3CST A;  4I43 A;  3VLF A;  4EBA G;  2EIL E;  4FDD A;  1UW4 B;  4TUM A;  2QFC A;  2I1K A;  4J8F A;  4UUC A;  4FLB A;  2GRL A;  3SFZ A;  1BI7 B;  2XPZ A;  3TWV A;  3UJ0 A;  5EID A;  3MV3 B;  2CG2 A;  4A1G A;  5K6S A;  3EIQ C;  3PDN A;  4BSZ B;  5CL7 A;  2WMO A;  4DI3 A;  2X6F A;  4AP2 A;  2BUG A;  5HS0 A;  2WXL A;  4RSY A;  4URK A;  4I6G A;  3L17 A;  2OND A;  5CRV A;  4GTT A;  3DPD A;  5LCW C;  3ASH A;  3C2H A;  4GAA A;  2YNQ A;  2J49 A;  4U7E B;  4DX6 D;  4B94 A;  2UY1 A;  4KBQ A;  1V18 A;  5SVZ A;  4MFU A;  3FUL A;  4NUR A;  1Q1S C;  5FQ8 A;  3EU9 A;  3QDN A;  3DBS A;  4ACL A;  2P9L G;  3F6Q A;  2WPV A;  2HE0 A;  3APD A;  4U2X D;  2RD0 A;  4EZK A;  1H6P A;  5AAR A;  5FTP A;  4UWH A;  1KPS B;  1ELW A;  3ZIK A;  2XPI A;  4U0Z A;  4HB5 A;  2VYI A;  1MYO A;  3LVR E;  3SBS A;  4WWN A;  1K8K G;  2PM6 A;  4HRL A;  3K61 A;  4YND A;  5FJY A;  3QWV A;  4ABN A;  1N0Q A;  3IV0 A;  2P58 C;  5CL3 A;  1OUV A;  3VE6 A;  2LO6 A;  3UL0 B;  3FU6 A;  4CGW A;  1M8Z A;  3TWQ A;  2XEV A;  1QNF A;  3BSX A;  1W3B A;  4Y6W A;  4IMI A;  3D9O A;  3Q49 B;  3DSU A;  3PE3 A;  3RSE G;  2H6H A;  1A5E A;  3UM1 A;  4K03 A;  1V55 E;  3CKB A;  3Q75 A;  4TNM A;  3DRA A;  5T3R A;  1H0A A;  2UY1 B;  4FZD A;  4HOS A;  3FHE A;  4L23 A;  4HOQ A;  4CB8 A;  3SFY A;  5D5K C;  3UKY B;  2L6B A;  4XI0 A;  4I37 A;  4U5L A;  3SLA A;  3ABK E;  3QC1 A;  2V4L A;  4CDR A;  3NQP A;  3CVU A;  4MRU A;  4A1S A;  1AWC B;  1G3J A;  2VQ2 A;  3IBV A;  2WXR A;  3HVE B;  1KT0 A;  4LUN U;  4HBD A;  4V3Q A;  5AJL A;  2AVP A;  4WWO A;  3PS6 A;  4KVO A;  1H6O A;  2JDQ A;  3TWT A;  2AW6 A;  2LSV A;  4I9E A;  3ODS A;  3HXF A;  4LEU A;  4XE0 A;  4J0U A;  3I5P A;  1HX8 A;  1TNO A;  4ZDU A;  3PZ4 A;  2ZIR A;  3ULQ A;  4U8Y D;  4EVT A;  1HFA A;  3UT7 A;  3HHM A;  2RKK A;  3AG4 E;  2W3C A;  3IXE A;  4QFV A;  3CHQ A;  4XZR B;  3WPT A;  2HYZ A;  3TJZ B;  3KAE A;  3QB2 A;  4BT8 A;  4RQI A;  4D10 C;  2WQH A;  3OUX A;  3CGH A;  2AXV A;  4AEZ C;  3JXJ A;  3RZ9 A;  4I1E A;  3LTJ A;  4HRM B;  2ZU6 B;  4I5N A;  4ATZ D;  2IX3 A;  4AV7 A;  2Z5N A;  4ILI A;  2A5E A;  4CV5 B;  4XKC A;  2X6K A;  4DB6 A;  3Q79 A;  3Q73 A;  2PZI A;  3VTY A;  3JX7 A;  3R7R A;  1OXJ A;  3JYS A;  3R9A B;  3CVQ A;  3FUD A;  4F1S A;  3KND A;  4A0C A;  3NF1 A;  2QZA A;  3OPB A;  4JVS A;  3IHV A;  4A55 A;  5HQ8 A;  1VDY A;  4OVV A;  3SBT B;  1FCH A;  4GTM A;  2HM8 A;  2NYM A;  2OV8 A;  2Y1L E;  1XNF A;  1SVX A;  4HM9 A;  5BZU A;  4RV1 A;  3HDX A;  5KNG A;  3RZX A;  4TXR A;  3NOW A;  2CHZ A;  4KT6 B;  4FLH A;  4JA7 A;  4BWR A;  2Q7F A;  3UKW B;  3MJW A;  4CRW A;  2XEN A;  2V4H C;  2J9Q A;  2FO1 E;  4FZF A;  3QAQ A;  2BED A;  2DZO A;  1H2U A;  4YDY A;  4AVX A;  3ASG A;  3DAD A;  3AJI A;  4BQK A;  4I96 A;  4J8E A;  1HXI A;  3UXG A;  3FTU A;  4HQD A;  3UKZ B;  3ZVV A;  3P2B A;  5CRU A;  4G24 A;  4JXT A;  4TUU A;  4ADY A;  3N71 A;  4I2Z A;  3CSF A;  4AXH A;  4KYO B;  5CLD A;  4APF A;  3H3D X;  4FU3 A;  3QML C;  4QMI A;  4APO A;  3NB2 A;  4BY6 A;  3UMV A;  4TXP A;  2R03 A;  3K7W A;  4N5C A;  4P6Z G;  5G04 J;  3ZW3 A;  3C5R A;  4UI9 J;  2DYS E;  1NP7 A;  5BV0 A;  2LNI A;  3ENE A;  3FTV A;  2IE4 A;  3UT4 A;  2HO1 A;  4ILG A;  3GVO A;  3PNT B;  4K0R A;  3ZIL A;  5ENO D;  3JXI A;  4BER A;  3KEA A;  3FDH A;  2KXP C;  5D0Q D;  5KLT B;  1PJN B;  2CFZ A;  2ETA A;  1QBQ A;  2KBX A;  1E8W A;  4GTP A;  2FUL A;  3LY8 A;  2OVB A;  2XEH A;  4F7A A;  5H7P A;  5EIB E;  3NMX A;  3V74 A;  5J3V A;  4G25 A;  2V5F A;  3Q0M A;  2GRR B;  2XZT G;  4HNA D;  1KZP A;  4U0S A;  1OCO E;  3TWS A;  4K6J A;  3JQ0 A;  1N54 A;  4HTV A;  2J4D A;  1ELK A;  3D9H A;  2R17 C;  2I1J A;  5CCM A;  3J5P A;  2Y69 E;  5KJL A;  4HOR A;  2OF3 A;  2C0M A;  3LEW A;  4QMJ A;  3EA5 B;  1MX2 A;  2R59 A;  3EHR A;  3E4B A;  4AY6 A;  4DBA A;  1XQR A;  3RO3 A;  1O6P A;  1DVP A;  4BA3 A;  3TWR A;  3S7F A;  4DX5 D;  3E33 A;  4HI9 A;  3FUI A;  5A6C A;  3MV2 B;  2X19 B;  4UI9 K;  3GB8 A;  2LAH A;  2J08 A;  4DRX E;  2X6I A;  5AAO A;  3ZYQ A;  1NA3 A;  1Q1T C;  2OEV A;  1N9A A;  4MBG A;  5ARF A;  1Y2A C;  5G04 C;  3ODR A;  3S2A A;  1ELR A;  4FHJ A;  3JUI A;  3UM3 A;  3EBB A;  5J08 A;  1UOH A;  5BT1 A;  3CR3 A;  2WB2 A;  2XGO A;  3DSW A;  2DIW A;  1LUJ A;  2GRO B;  2KZT A;  4GZ6 A;  3UJ4 A;  3FP3 A;  2P2C P;  3NAW A;  4QQI A;  3SI5 A;  4ANX A;  5FIN A;  2NC9 A;  1T08 A;  2P9N G;  5HRY A;  1TNU A;  3S7B A;  3LYA A;  3DXK G;  1HG2 A;  3QK0 A;  2LUH A;  4LRZ A;  1EF1 C;  4KZ0 A;  4WV6 A;  3ZIM A;  3I4G A;  2QC9 A;  2IF4 A;  3RRU A;  4KZC A;  3Q7A A;  4DX2 A;  4N2S A;  3Q5U A;  4HVB A;  3D9P A;  2Y4U A;  3FEY A;  4B8O A;  3D9L A;  3QAR A;  5FWQ A;  1PAQ A;  4L4H A;  2XS8 A;  5CTT A;  5ENP D;  2B6C A;  4L7T A;  5JJT A;  3FEX A;  4BES A;  4HNM A;  3QGB A;  5LCW J;  2RU4 A;  1OY3 D;  2L6J A;  5AYW D;  3CVN A;  2BKU B;  4V3I A;  2C1M A;  3X2Q E;  4Q96 A;  1XM9 A;  3P1U A;  4O6F A;  3L22 A;  5JJ6 A;  3Q0R A;  3BSB A;  3ZIR A;  2J4B A;  4JHJ A;  4TV3 A;  4H7Y A;  4LNG A;  4ILH B;  4GYO A;  4YGX A;  3PUJ A;  2PQN A;  4CYM D;  1B3U A;  1KT1 A;  1E8Z A;  1WA5 B;  4B89 A;  2OT8 A;  5BXO A;  3DEP A;  3U4T A;  2Z5O A;  2IQC A;  3B7R L;  2V8S E;  1PY1 A;  3FU0 A;  4JEU A;  1O1T A;  3QWP A;  1L5J A;  3FUM A;  4GA0 A;  4OYS A;  4MS6 A;  1LD7 A;  1BK5 A;  1E7U A;  5BW8 C;  4V3O A;  4PS3 A;  2GW1 A;  2CG3 A;  4GPK A;  1IB2 A;  2PF4 A;  1U3D A;  2WXQ A;  4GB9 A;  3L6A A;  2EIK E;  2NPP B;  4A3T A;  5CL9 A;  1DCQ A;  3L08 A;  3AU5 A;  5FQ6 A;  3FTS A;  4J7W A;  3APC A;  4DUI A;  2WQ6 A;  2NYJ A;  4H3K A;  3ZFW A;  2XS1 A;  3LY7 A;  2FBN A;  4AJW A;  3RK6 A;  1FVH A;  4DZS A;  3FGA A;  1IHB A;  2NSZ A;  3LTM A;  1N0R A;  4I8M A;  2VGX B;  3WOY A;  4XKB A;  2YNR A; 
#chains in the Genus database with same CATH homology
 2XA7 A;  3FHE A;  4PS8 A;  3IEG A;  4HOQ A;  4L23 A;  4HOS A;  1WAO 1;  3ZIP A;  3CV0 A;  4PUC A;  4CB8 A;  4U8H A;  3AU4 A;  5D5K C;  2WXO A;  3UKY B;  4HXT A;  4XI0 A;  3UQ3 A;  4I37 A;  2BNX A;  2H4M A;  4U5L A;  4YVQ C;  3GZS A;  2X6J A;  1Z6T A;  3TL5 A;  4PDX A;  3SLA A;  3CHP A;  4N2Q A;  2YJY A;  3QG9 A;  3CEQ A;  3CQC B;  3QC1 A;  5ENN A;  2V4L A;  2Z5M A;  4CDR A;  5DIZ A;  5C1D A;  1Y6I A;  2C0L A;  3K4E A;  2UWJ G;  3NQP A;  3CVU A;  4MRU A;  2PQR A;  4PLS A;  4A1S A;  4AOF A;  1G3J A;  3ML8 A;  4DJS A;  1OWL A;  3IBV A;  4R11 A;  3OQS A;  1KT0 A;  2VQ2 A;  2WXR A;  3HVE B;  4WND A;  2VJ8 A;  4C9B B;  4LUN U;  4UQX A;  4G3A A;  4U5V A;  2IJG X;  4PVZ A;  1Y8M A;  4V3Q A;  5AJL A;  2QK2 A;  1HF8 A;  2AVP A;  2XGS A;  2JKT B;  4WWO A;  4FC8 A;  2C1T A;  4O27 A;  3PS6 A;  4KVO A;  2JDQ A;  1UJK A;  1TH1 A;  2DCP A;  2LAI A;  2AW6 A;  2I9C A;  3HVE A;  2LSV A;  4FFB C;  4JLQ A;  3UL1 B;  3Q0L A;  4JPS A;  4I2W A;  4UQY A;  5ANL A;  1M5N S;  4UAE A;  4EVA A;  2FO7 A;  4I9E A;  4DJA A;  5JJ7 A;  2JEK A;  3BCT A;  3ODS A;  3K62 A;  2RG8 A;  4JW1 A;  5SWF A;  3CLJ A;  4LEU A;  4MLP A;  4XE0 A;  2YHE A;  3SF4 A;  3IFQ A;  4W9R A;  3JY1 A;  4J0U A;  3I5P A;  2I2O A;  2YHC A;  1I7W A;  3OUW A;  3TPO A;  3OBV A;  3QGC A;  3PEU B;  3U3W A;  1M1E A;  3CK7 A;  4P29 A;  1HX8 A;  4L1B A;  3U9W A;  3GYZ A;  4ZDU A;  5CHE E;  5G2N A;  2L0T B;  3ULQ A;  4PLQ A;  4EVT A;  3FUH A;  4G26 A;  1HFA A;  2JKR A;  2L9B A;  2YIN A;  3G2S A;  3JCK C;  3KS2 A;  2WXN A;  4JZY A;  3RRM B;  3EDT B;  3HHM A;  3UT7 A;  3TJ3 A;  3RKV A;  5LCW J;  2W3C A;  4QFV A;  2VGX A;  4EV9 A;  4BX9 A;  1W63 B;  2WXM A;  3CHQ A;  5T4Y A;  2L0I A;  5ARG A;  3Q5M A;  4RZP A;  4XZR B;  3WPT A;  2HYZ A;  3TJZ B;  1DNP A;  4ANV A;  3D9M A;  2XQ0 A;  2WM9 A;  3KAE A;  3QB2 A;  4BT8 A;  4CCA A;  4D10 C;  3AU3 A;  3SNX A;  5C2Y A;  3GZ1 A;  2WQH A;  3ZRH A;  3ZIQ A;  4DK5 A;  3OUX A;  4BSX A;  1TJC A;  3CGH A;  2AXV A;  3MYV A;  4NEE A;  1EE4 A;  4AEZ C;  3CHR A;  2F31 A;  3CKC A;  2FI7 A;  4G2V A;  4UWG A;  5A23 A;  3V6Y A;  4U58 A;  4IRU A;  3RZ9 A;  3Q4A B;  4I1E A;  1IBR B;  3LTJ A;  3Q47 B;  1ZBP A;  2ZU6 B;  2AXU A;  4U5S A;  1E90 A;  3UKX B;  1MQS A;  4L7M A;  4I1O B;  2PM7 A;  3ZEF A;  5AJD A;  4F53 A;  4I5N A;  3BG0 B;  3IHY A;  2IX3 A;  4YVO A;  5HUY C;  3UUX A;  2Z5N A;  4ILI A;  2XOA A;  2VGY A;  4AV7 A;  4Q69 A;  1TEZ A;  4CV5 B;  4XKC A;  3ZN3 A;  3FH8 A;  2X6K A;  2RU4 B;  3QOU A;  4HOU A;  2WXJ A;  4DB6 A;  1HZ4 A;  2DBA A;  3PH0 C;  4I9C A;  4CT0 A;  5EDS A;  2PZI A;  3ESK A;  4GZ3 A;  3VTY A;  4U07 A;  3TXN A;  3IBE A;  3JX7 A;  2KCL A;  3CVL A;  4YI0 C;  1M8Y A;  3Q0Q A;  3R7R A;  5CMW A;  3KEZ A;  3JYS A;  4G23 A;  3R9A B;  3WOZ A;  3CVQ A;  3FUD A;  4F1S A;  2KC7 A;  4YK6 A;  3KND A;  4A0C A;  3NF1 A;  3OPB A;  3K5Q A;  4JVS A;  2WQ7 A;  4OO6 A;  3PST A;  4D49 A;  3IHV A;  4A55 A;  5HQ8 A;  5J90 A;  1VDY A;  4OVV A;  1TE4 A;  3SBT B;  4UWK A;  3EIJ A;  1B89 A;  3TXM A;  1FCH A;  3VLD A;  5CL4 A;  3K5Y A;  2BTD A;  2NYM A;  2HM8 A;  2M63 A;  2MHK A;  3FH5 A;  2OV8 A;  5FQ7 A;  5JHA A;  4BPL A;  5FZS A;  2MOW A;  4L4I A;  2P8Q A;  4AIF A;  3D9J A;  5EX3 A;  3FUK A;  4AY5 A;  4QMH A;  1XNF A;  1IQ1 C;  1OWM A;  2ION A;  2Y4T A;  5FZR A;  2WXP A;  4DLO A;  1INZ A;  1IAL A;  3TGO A;  2DB0 A;  4HM9 A;  4RV1 A;  2NYM B;  5BZU A;  3GVT A;  3HDX A;  4MZ5 E;  3RZX A;  4FP7 A;  4G11 A;  4WNE A;  3ZPJ A;  3UPV A;  3NOW A;  3CK8 A;  2CHZ A;  3PE4 A;  4KT6 B;  1LRV A;  2CFU A;  3FTW A;  4UAD A;  4FLH A;  4EV8 A;  3CHS A;  4FUL A;  4GU5 A;  4JA7 A;  4AXH A;  5M72 A;  4BWR A;  2Z5J A;  4U3J C;  2Q7F A;  5G05 C;  1GCJ A;  3LKU A;  3U64 A;  4BTA A;  3RU0 A;  4I6J A;  5AEI A;  3ESL A;  3GAE A;  2WTK A;  3UKW B;  3MJW A;  4WNG A;  5CL8 A;  4EVP A;  4CRW A;  3TG4 A;  2GL7 A;  2JKT A;  2Z6G A;  4CB9 A;  1O6O A;  4B8P A;  2J9Q A;  3IKO B;  3ZYM A;  1BK6 A;  2X38 A;  5BPP A;  3VTX A;  3Q0P A;  4FZF A;  1KLX A;  3FWV A;  3MGB A;  3PRE A;  5HI7 A;  3V71 A;  1WM5 A;  3QAQ A;  2VSO E;  3OXL A;  1QZ7 A;  4JW3 C;  4UWX A;  1H2U A;  4J8D A;  4AVX A;  4PS7 A;  4F3V A;  4B8A A;  1YA0 A;  1PJM B;  1JPL A;  3ASG A;  3DAD A;  4JA9 A;  2IWH A;  1Z2C B;  4JHR A;  2X1G F;  5DBK A;  2UY1 B;  3T5V A;  2R5S A;  3ZYL A;  4EZK A;  4BQK A;  1UKL A;  3G2T A;  1JWF A;  3RRN B;  3O4X A;  3T5X A;  4CT6 B;  4I96 A;  4EQF A;  3WOY A;  5FC8 E;  1MHQ A;  4J8E A;  1HXI A;  4BTB A;  2C2L A;  1N52 A;  3JXZ A;  2XHE A;  3O48 A;  3O2Q A;  3ONL A;  4K92 A;  3FTU A;  3UKZ B;  3Q0S A;  3ZVV A;  1W9C A;  4CDN A;  4I3N A;  4DPR A;  3K7V A;  3P2B A;  1HH8 A;  2X6H A;  4G24 A;  3ZIO A;  4JXT A;  2IAE B;  4TUU A;  5FZQ A;  4ADY A;  4KZG A;  2JKR B;  3N71 A;  3S7D A;  4I2Z A;  3TG5 A;  3CSF A;  1P5Q A;  4B0Z A;  1QGK A;  4DB9 A;  3SHF A;  3BVS A;  3L3F X;  3D9I A;  4KYO B;  3TAX A;  5CLD A;  3OTN A;  4LER A;  4XIF A;  4APF A;  1S0P A;  1W63 A;  3H3D X;  4IMJ A;  1NZN A;  2KCK A;  1EJY I;  5KL1 A;  2KCV A;  2PL2 A;  3QML C;  2WXK A;  4QMI A;  3FUF A;  4UI9 C;  4APO A;  4BY6 A;  1Z3X A;  3D9K A;  2XGM A;  4UQZ A;  3UMV A;  1BPO A;  3FH7 A;  5LP0 A;  2VTB B;  4NZW A;  2AWI A;  3D9N A;  4N3B A;  2XPY A;  2BAP A;  3K7W A;  3L6X A;  3G2W A;  4GMJ A;  4N5C A;  3D3M A;  4ME2 A;  2JAK A;  1EPU A;  4P6Z G;  3I4R B;  5G04 J;  3ZW3 A;  5LOZ A;  3FTX A;  4ANU A;  2Z6H A;  3K64 A;  1I7X A;  5KUB A;  3HYM B;  4U5N A;  4V3R A;  1H6K A;  4UI9 J;  1NP7 A;  3MCX A;  2LNI A;  3ENE A;  3FTV A;  2IE4 A;  3UT4 A;  5BV0 A;  1QZ2 A;  1H2V C;  2HO1 A;  4P6Z B;  4ILG A;  3GVO A;  1XGW A;  5CLE A;  4DB8 A;  2WXF A;  2IAE A;  2XCB A;  3GNI A;  3NMZ A;  2BF0 X;  3FUN A;  3B13 A;  3PNT B;  2MRI A;  3PZD A;  3ZIL A;  4K0R A;  4LCT A;  3RO2 A;  1UG3 A;  4FA6 A;  3FEX C;  3LS8 A;  1M8W A;  5LX8 A;  4A3V A;  2NYL A;  3C98 A;  3NMW A;  3FDH A;  3UT8 A;  3JXY A;  4HFG A;  1HS6 A;  5D0Q D;  1JPW A;  5E6Q B;  1EJL I;  1PJN B;  5KLT B;  2CFZ A;  3EHM A;  3O4Z A;  3G2U A;  3CHM A;  4MKT A;  5KJM A;  5H2W A;  4B18 A;  3L16 A;  4RVB A;  5G05 J;  1E8W A;  4JW2 A;  4R0Z A;  3VLE A;  1QBK B;  2VSX E;  3JQ1 A;  4I17 A;  2GGF A;  2FUL A;  4IUL A;  3PVL A;  3MKR A;  4N3A A;  3ASF A;  3ZHE A;  3CHO A;  3Q0O A;  3LY8 A;  2OVB A;  4JHK A;  2VSN A;  4BT9 A;  4CT7 B;  1OWO A;  2OVF A;  2X3M A;  4I6I A;  4HXI A;  4F7A A;  3CVV A;  1WY6 A;  2YNS A;  4B8J A;  3K49 A;  2XCC A;  1E7V A;  1HE8 A;  2Q5D A;  3C2G A;  3NMX A;  3V74 A;  3FFL A;  4J8S A;  5J3V A;  4G25 A;  2V5F A;  3Q0M A;  4L2L A;  4EZL A;  1UPL A;  2QY7 A;  5CL5 A;  1IHG A;  4U0S A;  4DVG B;  4K6J A;  2Y3A A;  3CVY A;  3GS3 A;  3JQ0 A;  3Q15 A;  1N54 A;  5KLR B;  4HTV A;  3O2S A;  2J4D A;  2QNA A;  1QGR A;  3FGA B;  5B56 A;  1ELK A;  1H2T C;  3LY9 A;  4GCN A;  3MKQ B;  2R17 C;  3TT9 A;  2I1J A;  4ACK A;  4I0Y A;  4U0U A;  4C0M A;  2IOS A;  5CCM A;  5KJL A;  1HU3 A;  2OF3 A;  3O2T A;  4XI9 A;  4XX5 A;  4HOR A;  4GMN A;  3TPM A;  2C0M A;  3LEW A;  4QMJ A;  3EA5 B;  4FJY A;  1E8Y A;  4NAC A;  1IQU A;  2R59 A;  3B7U X;  3LXU X;  2VGL A;  2KZT B;  3E4B A;  3L54 A;  3OAW A;  4AY6 A;  4U54 A;  3URZ A;  1UPK A;  4DBA A;  3LJ3 A;  4KXK B;  4H7X A;  1XQR A;  3RO3 A;  1EE5 A;  1O6P A;  1DVP A;  4OVU A;  5LSW A;  3MEK A;  2CHX A;  3MKQ A;  2XRY A;  4BA3 A;  3PRZ A;  4PLR A;  4IN3 B;  3S7F A;  4MZ6 E;  3ZGQ A;  5BYM A;  3A6P A;  3RJV A;  4FU3 A;  4BX8 A;  3FY4 A;  3FUI A;  5A6C A;  1U6G C;  5EX0 A;  3QKY A;  3MV2 B;  2X19 B;  4UI9 K;  3GB8 A;  4HOT A;  2LAH A;  2J08 A;  5CMY A;  3CVX A;  2X6I A;  3OXG A;  4I6E A;  4RG6 A;  3T8M A;  3ZYQ A;  1NA3 A;  1Q1T C;  4GA2 A;  4EBA A;  3MZL B;  3ONK A;  5ARF A;  1Y2A C;  5G04 C;  3QNK A;  3ODR A;  2FF4 A;  4U04 A;  3C5W A;  4D4E A;  1EYH A;  3S2A A;  1ELR A;  4I7I A;  4FHJ A;  1A17 A;  3JUI A;  2IOL A;  3WXX A;  1SZ9 A;  3EBB A;  4ATG A;  4CGV A;  5J08 A;  5BT1 A;  3CR3 A;  2WB2 A;  5T8I A;  5CL6 A;  4RXH B;  3L6Y A;  2XGO A;  5ANR A;  3ZHE B;  1UN0 A;  4LAC A;  2DIW A;  1LUJ A;  4GYW A;  4PH4 B;  4FQ3 A;  2VGL B;  5BZ5 A;  3SL9 A;  2KZT A;  4FJZ A;  4GZ6 A;  4JC8 A;  3EHN A;  4Y6C A;  5SW9 A;  5KCM A;  2VTB A;  3FP3 A;  5AEN A;  3FU3 A;  5FQ6 A;  2LSU A;  1XQS A;  3SI5 A;  3SGH A;  2NPP A;  4ANX A;  2NC9 A;  1IYG A;  2BCT A;  4I5L A;  1T08 A;  1LF8 A;  3AS8 A;  4OIH A;  2KM4 A;  3NZU A;  3LYA A;  3S7B A;  1HG2 A;  2OOE A;  5KJN A;  3ZYK A;  3LPZ A;  3QK0 A;  4LRZ A;  4E4V A;  3T7U A;  4WNF A;  3BG1 B;  4UQI B;  4NQ0 A;  1JDH A;  2Z5K A;  3FEY C;  1EF1 C;  3MX3 A;  4GML A;  4KZ0 A;  3UX4 A;  5AIJ A;  3ZXS A;  4WV6 A;  3ZIM A;  3I4G A;  4U63 A;  3EG5 B;  4IYP A;  3B7T A;  1OWN A;  5FQ4 A;  3QWW A;  2PKG A;  4EZJ A;  1TJF A;  2WXG A;  2IF4 A;  1E96 B;  2A5U A;  4MFV A;  5CLC A;  3K9I A;  4KZC A;  5DN7 A;  4GYY A;  3RRU A;  3SZ7 A;  4JKQ A;  4J6I A;  2ILR A;  3CST A;  4I43 A;  3VLF A;  4EEC A;  1UJJ A;  4N2S A;  5G55 A;  3KD7 A;  4YJE A;  3NZS A;  3QHE A;  5BZV A;  3BX2 A;  4UWL A;  4EBA G;  2VSY A;  4FDD A;  1UW4 B;  5EKF A;  5BUZ A;  3Q5U A;  3G2V A;  1M8X A;  2QFC A;  4UWF A;  4HVB A;  3ND2 A;  4N39 A;  2I1K A;  4J8F A;  3D9P A;  2AXZ A;  2FV2 A;  3ZIN A;  2WMN A;  2Y4U A;  4FLB A;  2GRL A;  3CIA A;  3FEY A;  3SFZ A;  5LFA A;  2YNR A;  4CT4 A;  4B8O A;  2XPZ A;  1QQE A;  3D9L A;  3I3N A;  3QAR A;  5CLB A;  5FWQ A;  4WAF A;  1PAQ A;  3BWT A;  1FVF A;  1NA0 A;  3AS4 A;  3CK9 A;  4L4H A;  3Q0N A;  5CTT A;  3L3Q A;  1U3C A;  4RG9 A;  5D0O D;  3MV3 B;  4DLQ A;  2CG2 A;  2WXH A;  4GCO A;  5K6S A;  3EIQ C;  4CRU B;  4A1G A;  3PDN A;  4FAD A;  4L7T A;  5JJT A;  5EKG A;  5EWP A;  5H2X A;  5CL7 A;  4GA1 A;  3FEX A;  4G1T A;  4HNM A;  2WMO A;  3SD5 A;  3QGB A;  5KLA A;  2CHW A;  5HHG E;  2RU4 A;  2IFU A;  5KL8 A;  3MA5 A;  5E76 A;  4DI3 A;  2X6F A;  3ZHP A;  1OYZ A;  2QMR A;  3UVU A;  2L6J A;  3CVN A;  2BUG A;  1HG5 A;  3FU5 A;  2KAT A;  5AYW D;  4E6H A;  2NXP A;  2BKU B;  3U66 A;  1Z3Y A;  4V3I A;  2WXI A;  4FHK A;  4ANW A;  2WXL A;  1H19 A;  3CVP A;  2C1M A;  3FUE A;  4Q96 A;  4RSY A;  5A7D B;  1XM9 A;  3P1U A;  4O6F A;  3PUK A;  1OWP A;  4URK A;  3L22 A;  4I6G A;  5JJ6 A;  3Q0R A;  3L17 A;  2OND A;  3GRL A;  3BSB A;  3ZIR A;  2J4B A;  4JHJ A;  4TV3 A;  4H7Y A;  4CRV B;  3DPD A;  5LCW C;  4ILH B;  2NYL B;  4GYO A;  3ASH A;  3C2H A;  2I6H A;  4GAA A;  2YNQ A;  3B7S A;  4YGX A;  2J49 A;  3PUJ A;  4GZD A;  5FT9 A;  2PQN A;  4B94 A;  5CCL A;  5CLA A;  2UY1 A;  4L2Y A;  5BNW A;  1B3U A;  4KBQ A;  3BX3 A;  1E8Z A;  1KT1 A;  3VWA A;  1WA5 B;  3R7Q A;  4WWP A;  4XZ4 A;  4B89 A;  1V18 A;  2FEZ A;  4CBA A;  4YJL A;  3PSP A;  4MFU A;  5SVZ A;  4FZA A;  1Q1S C;  2OT8 A;  4UQI A;  3FUL A;  4NUR A;  5FQ8 A;  3LVQ E;  3LDZ A;  3QDN A;  3DBS A;  1UN8 A;  3U4T A;  2Z5O A;  4H3H A;  4ACL A;  2IQC A;  3B7R L;  1JWG A;  3GQ2 A;  4CDM A;  3ZKV A;  3K5Z A;  2IE3 A;  3QJZ A;  2WPV A;  3APD A;  4JW2 B;  4GZ5 A;  2V8S E;  1PY1 A;  3FU0 A;  1UN9 A;  4JEU A;  4U2X D;  3W3U A;  2EQX A;  3QWP A;  1L5J A;  1SQM A;  2RD0 A;  1EDU A;  3FUM A;  4B8C B;  4GA0 A;  1ZU2 A;  4MS6 A;  3GW4 A;  4OYS A;  5FTP A;  4AP2 A;  1JUQ A;  3FTZ A;  3ML9 A;  1BK5 A;  1PC2 A;  1E7U A;  5BW8 C;  3FTY A;  4UWH A;  4V3O A;  4M3O A;  3L13 A;  4U5U A;  1ELW A;  3ZIK A;  2XPI A;  4U0Z A;  4PS3 A;  4EPZ A;  2GW1 A;  1F59 A;  2CG3 A;  2VYI A;  1IQR A;  3LCA A;  5JJA A;  3LVR E;  4HS2 A;  4I1A A;  3L08 A;  4JL0 A;  4GPK A;  4I1M A;  2HR2 A;  1IB2 A;  5BZ1 A;  2PF4 A;  1U3D A;  2WXQ A;  3PEV B;  4GB9 A;  4WWN A;  3SBS A;  3L6A A;  3TJP A;  3LWW A;  4I2S A;  4R10 A;  2PM6 A;  4BFR A;  2WVI A;  3CQG B;  4GZC A;  3TX7 A;  5HUW C;  3K61 A;  2IW3 A;  2YQ8 A;  4KMO A;  4YND A;  5FJY A;  5BV1 A;  2NPP B;  3BTR C;  4A3T A;  3ASD A;  3QWV A;  4Q94 A;  4R7L A;  4WUY A;  4ABN A;  5CL9 A;  3EJN A;  3S7J A;  3AU5 A;  5K9S A;  1E8X A;  5CL3 A;  1OUV A;  2P58 C;  1HO8 A;  3IV0 A;  3GZ2 A;  3FTS A;  2J07 A;  3VE6 A;  2LO6 A;  2QK1 A;  4NRH B;  3UL0 B;  1GW6 A;  5EKQ D;  2E0I A;  3APC A;  3PNL B;  4N3C A;  3FU6 A;  2WQ6 A;  4CGW A;  1M8Z A;  2XEV A;  3AS5 A;  4H3K A;  1QNF A;  3ZFW A;  3BSX A;  1W3B A;  3BEE A;  3LY7 A;  4HLE A;  1SZA A;  2XA7 B;  4U5O A;  4Y6W A;  2FBN A;  2J09 A;  3RK6 A;  4IMI A;  4AJW A;  1FVH A;  4CEM A;  3D9O A;  1X5B A;  3Q49 B;  3FUJ A;  3DW8 A;  4DZS A;  3FGA A;  1WA5 C;  2JLB A;  3HIZ A;  3PE3 A;  2XRZ A;  4JEH A;  4UAF B;  4AM9 A;  3CVW A;  2NSZ A;  5E75 A;  4K03 A;  4DI4 A;  5JHB A;  2GRM A;  2IU1 A;  5KJK A;  3LTM A;  3CKB A;  2E2E A;  4C0E A;  2A4Z A;  4TNM A;  3RIB A;  2V0P A;  3OXF A;  4Y5J A;  3APF A;  4I8M A;  1H0A A;  4KVM A;  2VGX B;  5T3R A;  1JPP A;  4XKB A;  3WYF C;  4GMO A;  4E85 A;  4TRQ A;  4FZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...