3VLEA

Crystal structure of yeast proteasome interacting protein
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
456
structure length
435
Chain Sequence
b'NLLTQLENELNEDTLLRKCSLNLVTVMDVKPLLATIKRFLTSDYLLDVVDKLVPMADFDDVLEVYSAEDLVKALRSEIDPLKVAACRVIENSQPKGLFATSNIIDILLDILFDEKVENDKLITAIEKALERLSTDELIRRRLFDNNLPYLVSVKGRMETVSFVRLIDFLTIEFQFISGPEFKDIIFCFTKEEILKSVEDILVFIELVNYYTKFLLEIRNQDKYWALRHVKKILPVFAQLFEDTENYPDVRAFSTNCLLQLFAEVSRIEEDEYSLFKTMDKDSLKIGSEAKLITEWLELINPQYLVKYHKDVVENYFHVSGYSIGMLRNLSADEECFNAIRNKFSAEIVLRLPYLEQMQVVETLTRYEYTSKFLLNEMPKVMGSLIGDGSAGAIIDLETVHYRNSALRNLLDKGEEKLSVWYEPLLREYSKAVNGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA mismatch repair protein HSM3
publication title Structural basis for specific recognition of Rpt1, an ATPase subunit of the 26S proteasome, by a proteasome-dedicated chaperone Hsm3
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 167
structure length 435
sequence length 456
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18794 HSM3_C DNA mismatch repair protein HSM3, C terminal domain
A PF18795 HSM3_N DNA mismatch repair protein HSM3, N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.50 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 3vleA01
1.25.40.580 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3vleA02
3VLDA 3VLFA 4FP7A 4A3TA 4A3VA 3VLEA
chains in the Genus database with same CATH superfamily
1OUVA 1QBKB 3BSXA 3EDTB 3QGBA 4AJWA 1Q1SC 1OXJA 2FBNA 3FP3A 3HYMB 1UPLA 1WA5B 1NA3A 4FDDA 3SI5A 3SF4A 2AVPA 3SHFA 4IMIA 2ILRA 2R03A 3L13A 2XS1A 3LY7A 3D9NA 3MZLB 1IHBA 3KSLA 4I2ZA 3J5QB 4YK6A 5CTTA 4U7EB 3Q4AB 5J90A 1WDYA 3CIAA 4CCAA 3DXMG 5CERB 5CL3A 1H6OA 3I4GA 3CVLA 5T3RA 3LKUA 3V2OA 1H6PA 3FTXA 4GCOA 4I9CA 1B3UA 4MFUA 4NZWA 4J6IA 1EPUA 3TWVA 4HNAD 4QFVA 3LJNA 3DBSA 1E8WA 4G8KA 4IYPA 3TX7A 4KXKB 4FADA 3ZIPA 2RKKA 1TNUA 4HI9A 4K92A 4N5QA 3ZIKA 5KJKA 4IRUA 1TJFA 3SFYA 4CB8A 4DUIA 3U64A 1IQRA 3URZA 5BNWA 4J8DA 3HDXA 4B94A 1HO8A 3TT9A 2Q7FA 1GW6A 2WXGA 4I1MA 1IQ1C 4GYWA 3ZYLA 2JDQA 5EIDA 4BEPA 1E8YA 4KMOA 3LS8A 3GW4A 5CRUA 3AG1E 4JB8P 2MOWA 3KEZA 4TXPA 4AY5A 4LNBA 3LDZA 2WQ6A 4RZPA 2IE4A 3DPYA 2XGOA 3RJVA 2QNAA 1SA4A 1JDHA 2L9BA 3NMWA 3ZHPA 4B0ZA 1AP7A 2OVFA 2VGLA 2IX3A 2DBAA 4AXHA 4GMOA 3QHEA 4I5NA 3R9AB 4BTBA 3QWVA 2VSNA 2J08A 3QNKA 3RO2A 3HIZA 3SFXA 3UJ0A 4H3KA 1TNBA 3BG0B 1UOHA 3FUFA 2IONA 2XRZA 4GA2A 4Y6CA 2XA7B 3Q49B 3WG7E 1O1RA 3ASHA 3TJZB 3SNXA 1S63A 3B7RL 4FLHA 5AJDA 4CT0A 4DX2A 4HBDA 3ZKVA 4H7YA 3FU5A 3L3FX 1PC2A 4DB8A 3TPMA 2LSVA 3PZ2A 4B18A 3ONKA 4CB9A 3ZW3A 2P9NG 5A23A 4P6ZG 1YA0A 3MGBA 4MZ6E 2WXFA 3FU3A 3ENEA 2UWJG 4WUYA 1N95A 3KNDA 2JLBA 3E37A 3T7UA 3KS2A 4PH4B 2I2OA 3C3QA 3B13A 3R9MA 2DCPA 2XENA 3HVEA 5G55A 4BPLA 5A7DB 1JUQA 3CKCA 1HF8A 4IMJA 3Q0OA 4EHMA 2DZOA 2RG8A 3FTSA 4HOUA 2WXIA 1EYHA 3RRMB 1N4KA 5AJLA 4UQIB 2XPIA 1WM5A 2RFMA 3FGAB 1PY1A 3FH8A 4XIFA 4LEUA 3V2XA 2I9CA 3DRAA 1H2UA 5LP0A 2DB0A 2LAIA 2Y4UA 4GTVA 1HU3A 2YNRA 4JHRA 4GAAA 4N39A 3LPZA 3W3UA 5CLCA 3UM2A 3MJWA 4KVMA 2XEHA 2DWZA 3CVNA 2BKKB 3AU4A 1Y8MA 4BESA 1N4SA 1S64A 3JXIA 3TXNA 3DSXA 3RU0A 2HYZA 3ZIRA 2CG3A 3B7SA 1DNPA 5DIZA 3GNIA 4I8MA 4DB9A 3FUIA 1JPLA 3MKQB 1HXIA 4CRWA 3MCXA 4B93B 1BU9A 3APCA 1Y6IA 4AY6A 3FUNA 1NA0A 3EU9A 5AAOA 3ULYA 5EDSA 1JWGA 3JY1A 3TG5A 3CVUA 3K64A 2IAEA 5CL4A 1V18A 4HM9A 3G2TA 4R0ZA 2WM9A 3Q7FA 1YCSB 1XNFA 4WWPA 3I4RB 3ODSA 4LG6A 4XKCA 5B56A 2LSUA 4JD2G 3PZ4A 5KJMA 2RFAA 3IHYA 3MV3B 2M63A 2HM8A 3ZYKA 1MX6A 3LTMA 2J07A 5CLAA 3DADA 3FH5A 3DSSA 4U5LA 4APOA 4DVGB 4TXQA 5LCWC 4FHJA 4U8YD 1O1SA 3TJ3A 1H2VC 5CLEA 1TN8A 3GQ2A 3Q0RA 3HXEA 4N2QA 4YVOA 3VE6A 3QWPA 3UMVA 3BQOA 3OXFA 3EIQC 4I6JA 4BERA 5KNHD 3CKBA 2ETCA 3SD5A 1INZA 4HLEA 2PL2A 3CVYA 5CL5A 2YHCA 1BPOA 3RIBA 5G05J 3BCTA 5AEIA 3APDA 3TWUA 4I17A 2QK2A 4U0SA 3D3MA 4TNMA 2QYJA 4G23A 2IW3A 2X6KA 4D49A 5G2NA 4D4EA 5CL6A 2P9SG 1UJJA 1BI7B 3A6PA 2VGXA 2KZTB 3IEGA 3S7JA 1I7WA 2F37A 4XKBA 4U95D 4PLSA 4AIFA 2AJAA 5EYPF 2NSZA 3UKWB 3TPOA 3Q0NA 2OV8A 3IFQA 4R10A 2IEJA 1KT1A 4UADA 5CEDB 4KZGA 4UQZA 2LNIA 1A17A 3C3RA 1MJ0A 1N0QA 3B7TA 3APFA 4CT4A 4HORA 5FIOA 3T8SA 1IXVA 5HUWC 5AQBA 2Y69E 5E6QB 5CECB 2AXUA 4DPRA 1TNZA 4LCTA 3EBBA 5LFAA 1OWMA 2JKTA 4U5UA 1LTXA 2NYMA 3FUKA 2W3CA 3CEQA 4UQYA 3E4BA 4J8EA 5AYWD 4P29A 1Z3XA 4DJSA 3QC1A 2H6HA 1D8EA 3DW8A 3O2QA 1UN8A 3Q75A 3ZHEA 4HOSA 5T8IA 3W9FA 2Y3AA 1TEZA 2NPPB 3ZGQA 4NEEA 1YMPA 2XPZA 2XPYA 3JCKC 4HLLA 3UM0A 2PM7A 3CVVA 3NZSA 3ABME 1OCRE 4I5LA 2IF4A 2DYSE 4IN3B 3OUXA 4GMLA 1LSHA 1E8ZA 5EYLA 2WMNA 1W63B 2KATA 3NF1A 3ASOE 3H3DX 3E34A 2ZISA 3VTYA 3S7BA 1OCCE 4DJAA 4L4IA 4A1GA 4OYSA 3BSBA 5C2YA 1FCHA 2P9PG 3TWXA 3HG0D 5JJAA 3CHOA 2CG2A 2OEWA 3D9HA 2PNNA 5EKQD 4GMRA 5CBNA 4DX7D 4B89A 1G3JA 3PRZA 3QWWA 2IE3A 2XGSA 4CBAA 3I5PA 3JYSA 2X19B 4CZ2D 2LXMA 1UJKA 4V3IA 3BX3A 1OWNA 4JL0A 1OCZE 1Q1TC 3PS6A 1BI8B 3N71A 1XM9A 4U0ZA 2MHKA 4L7MA 4U04A 3HRAA 3UKUG 4ATGA 3TXMA 5CL8A 2GW1A 2EQXA 3NMXA 4JW2A 4RLYA 4Y6WA 4HXIA 4I96A 4RG9A 4GCNA 2VTBB 3LEWA 5B3SE 4I37A 3L22A 1GCJA 4MLPA 1LD8A 2P9IG 4EQFA 4CDNA 3K4EA 3GVTA 3IKOB 4AV7A 1O5MA 2EIKE 3GZSA 1V54E 3UQ3A 4ANUA 2AXVA 4JXTA 2JKRA 3TWSA 2BUGA 1UW4B 3LY8A 3DWLG 4F1PA 2X3MA 3RRUA 4DX1A 3ZRHA 2HO1A 5IY5E 3NZUA 4GTMA 4TUUA 4E85A 3FH7A 3C2HA 2VSXE 4FZAA 3RO3A 5JMND 2XS8A 2BNXA 5KNGA 2CFZA 3NOCD 5CBOA 4CT6B 4K0RA 4HOTA 4ANXA 4O60A 4I1AA 2C1MA 4HS2A 4ABNA 3G2UA 5FTPA 4LACA 3HXCA 4OO6A 2IO2C 4K5AB 4GA1A 1M5NS 1E8XA 2ZIRA 3UXGA 2BKGA 4EVTA 2JEKA 4QMIA 1SQMA 3ONLA 1BK6A 4BT9A 2BAPA 3TWWA 2KM4A 1KT0A 1YYHA 2QK1A 3S7FA 1DCQA 2CFUA 1OWOA 3Q73A 4EZLA 1E96B 4I6EA 2IOSA 2X1GF 3AG3E 4QQIA 3Q0QA 4QMJA 3SO8A 3Q9UC 3DSTA 4UWGA 1X81A 5KLAA 4TRQA 1TNOA 2WXQA 1PAQA 3IHVA 5FT9A 2H6FA 3Q9NC 2ZU6B 5DBKA 3RK6A 3QMLC 3FTZA 3ZYQA 1HH8A 1SA5A 5SVZA 3CQCB 3FUEA 1BD8A 1K1BA 4YDYA 3C72A 3IXEA 3BVSA 4F3VA 2GRRB 3LVQE 5BZVA 2C0MA 2ZXWE 3K9IA 3BUAA 2H6GA 4L9PA 4N3CA 3WXXA 1DCEA 3LVRE 3RZXA 3CK8A 1VDYA 3O48A 4OIHA 2CHZA 5D2MC 4CRUB 4E6HA 3FUJA 3G2SA 4FQ3A 5FC8E 3VTXA 1IB2A 3MYVA 2YNSA 4FLBA 3AU3A 4D10C 2ONDA 4DLQA 3UKXB 3G2WA 2X6JA 1UG3A 2X6IA 3V30A 3S2AA 1N4QA 2YNQA 2GRPB 5HRYA 3O4XA 2WXJA 2GL7A 3EA5B 5ENSD 3UIOC 4PS8A 1JWFA 2PF4A 5HI7A 2XHEA 3Q5MA 3EJNA 5H2XA 1IYGA 2KBXA 4WNEA 5BW8C 5KLRB 4M7CA 1QZ2A 4JPSA 1D8DA 3IBVA 4RXHB 3UT4A 4FFBC 2P9UG 1Z6TA 5EIBE 3DSWA 4U0UA 4BTAA 3OQSA 3JXYA 2X38A 3CLJA 1N52A 2LAHA 2DZNA 2V5FA 2EIME 3PREA 5CMYA 1B89A 1ZBPA 5BZ5A 4YDOA 3ZUVB 3K5YA 3UKZB 3D9KA 4KZCA 4U5OA 5CCMA 3L9TA 4KYOB 1JCSA 4YI0C 3QK0A 4N5CA 2XA7A 5FINA 2IJGX 4E4VA 3UKRG 4K5BA 3RKVA 2WQHA 5AIJA 2NXPA 5LX8A 5JHAA 4K6JA 3CK9A 5FZRA 4L2YA 1FVFA 2WXHA 5CL7A 4NRHB 5J3VA 4A63B 1E7UA 5ITZF 2V4LA 3FY4A 3TWRA 2X6HA 3ASNE 4UWHA 2ETAA 1I7XA 2OCCE 2WXNA 1HG2A 4XZ4A 2FEZA 1IQUA 3Q79A 4C0MA 3GS3A 4U8HA 1P5QA 2L0IA 3TWQA 4FJYA 2Z5KA 5JA4D 4ATZD 3CR3A 4YJLA 2BTDA 4J0UA 3V79K 2R2LA 3FU0A 4N3AA 5EKFA 1TJCA 5J08A 4U5SA 5FQ6A 4ANVA 1KZPA 1TN7A 3T8MA 3CHPA 2GRQB 4U5VA 5BV1A 3GAEA 3P1UA 4UQIA 2QZAA 5K6SA 3Q47B 5EWPA 3L54A 3FGAA 1N11A 4G25A 4O1OA 2WXLA 1OWLA 4BSXA 4O1PA 4U96D 1U3CA 5BUZA 2DYRE 5ANLA 3UUXA 3IV0A 1FT2A 2VSYA 3C2GA 4GYOA 1HS6A 3ULQA 1UN0A 3BTRC 5SW9A 4L2LA 2L6BA 3OTNA 4QMHA 4J8FA 2VGEA 3GVOA 1BK5A 3SBSA 4UI9K 3ML9A 4UQXA 2FO1E 2YHEA 3L17A 3MKQA 3ZKJA 3JXJA 5ENTD 3VLDA 4ADYA 3QJZA 4LERA 2H6IA 5FWQA 1Z5SC 1O1TA 4GMNA 3AU5A 2IO3C 4GB9A 2WPVA 3T9KA 4CRVB 3ULEG 3KEAA 5KLTB 4CV5B 3B95A 5CHEE 2PQNA 1LF8A 4U8VD 1H19A 2RU4B 3P2BA 2Y4TA 5M72A 1W3BA 4CYMD 4UWKA 1FT1A 1N4PA 4ILIA 2P9LG 5KL1A 1H2TC 4FJZA 4JVSA 4OAUC 3CSTA 4G24A 5CMWA 4APFA 5CRVA 3UT8A 5K9SA 1E90A 2YINA 3EHMA 4EV9A 1LUJA 3FTYA 4HTVA 4JC8A 3G2VA 3QB2A 4GZ5A 3FEYC 1IKND 5ENOD 1U6GC 5ARFA 2AXZA 3FEXA 1WA5C 4OVUA 1DC2A 3Q0MA 3Q5UA 3CHQA 4NURA 4N3BA 1NP7A 3OXLA 4CDRA 2Z5OA 3SY2A 3PZDA 3J5PA 1QGKA 2R05A 5EILA 3LYAA 4F53A 2X6FA 5JJ7A 2P8QA 4GZDA 2UY1B 1HFAA 4Q96A 5CL9A 2IY0C 3SL9A 3JXZA 4DI3A 4XEIG 4FHKA 3BU8A 3FFLA 3QDNA 1WY6A 3K61A 3MX3A 4RV1A 4A0CA 1OCOE 1KZOA 1RZ4A 3K49A 4Q69A 2F0YA 4TV3A 4EBAG 3D9LA 3UJ4A 2P2CP 4BA3A 3B7BA 2GROB 4PDXA 5EX3A 1TE4A 2KZTA 2J09A 5BV0A 2OF3A 3UL1B 3NOGD 2J4DA 2NYLB 2MYOA 4LUNU 3PUJA 4L4HA 3LWWA 3QARA 3ABLE 4ME2A 4JLQA 3X2QE 5JJTA 4I2SA 1A5EA 2OVBA 3PEUB 2P58C 2Y1LE 2XEEA 3FTVA 1F59A 4UWLA 4AP2A 4BFRA 4UWXA 4GZ6A 4XI0A 3PDNA 3L08A 4HRMB 2GRLA 1M8YA 1D9SA 5KJNA 1IBRB 1O6PA 4TXRA 4YDEA 4AM9A 2AW6A 1V55E 3CHSA 3UVUA 2NC9A 4BQKA 3CHMA 2VQ2A 4FULA 1IHGA 2GGFA 2I6HA 3QOUA 3UIPC 3CVPA 4RSYA 1NI1A 5JHBA 2WQ7A 1HZ4A 4GTQA 2NPPA 2A5EA 3PE3A 1G3NB 2NYJA 3O2SA 4J8SA 3DEOA 2J4BA 4I1EA 3JQ0A 3AG4E 4AOFA 3OPBA 5HKPA 1W63A 1Q2ZA 3V71A 4MKTA 2ZGGA 3PNLB 3GZ1A 2V5QC 2Z5MA 1XGWA 4F7AA 3EHQA 4GYYA 2J49A 4U58A 3ZVVA 4U3JC 1TH1A 5HQ8A 4EV8A 1Z3YA 4C0EA 4YJEA 1PJNB 4ZFHA 1NZNA 1QYMA 4GTRA 3ZIMA 3PSPA 5BYMA 1SZ9A 2DVWA 2QY7A 2R59A 5AQAA 2PZIA 3SBTB 4GZ3A 3D9OA 3FWVA 4L1BA 1K3ZD 3OXGA 4BT8A 2C0LA 1ELWA 4JA7A 2PM6A 3FULA 3C5WA 4TUMA 4ILGA 4U54A 3DSUA 2YJYA 2V0PA 1T08A 2CHWA 4JW3C 3QKYA 5FQ8A 2IWHA 4HOQA 4I0YA 2H4MA 2WB2A 2B0OE 3ABKE 3NBNB 3Q78A 3DSVA 4YDWA 5G04J 4FA6A 2VTBA 3PNTB 4EECA 3R7QA 2Z5NA 3BEEA 3GB8A 4ANWA 2EINE 1KLXA 1EE5A 5E76A 5FJYA 5KUBA 3ZNGA 5HHGE 2BKUB 3OUWA 3K7WA 3VWAA 3K5ZA 4HI8A 5BZUA 5SWFA 3MA5A 3ODRA 1O6OA 5KJLA 5AARA 3Q0LA 4O27A 3GZ2A 5AN8A 3K62A 4JA9A 4K5CA 3RSEG 3UL0B 2CHXA 4DX6D 2QYUA 4BWRA 3ML8A 3QGCA 4N2SA 3ZIQA 2A4ZA 2OEVA 3O2TA 2WXKA 2XQ0A 3OAWA 4G8LA 1U2VG 2E2EA 1SZAA 4H7XA 3FEYA 2FI7A 1X5BA 3D9IA 4DX5D 1FVHA 2XZDG 2I1KA 1HG5A 3FDHA 5CLDA 4BX8A 4KT6B 2ZGDA 1Y2AC 4EZJA 3EIJA 1MX4A 1EF1C 5T4YA 1JPPA 3PZ1A 1EJLI 4GMJA 3CVQA 1SW6A 2EIJE 2VYIA 4EVPA 3LJ3A 3AS5A 1ELRA 4CEMA 4GU5A 1TN6A 3T8KA 4PVZA 5A6CA 3EUVA 5CCLA 3CVXA 3FEXC 1N0RA 4DZSA 3D9MA 4G3AA 3IBEA 5BZ1A 2XRYA 2XZTG 2VGLB 3EG5B 2PKGA 3ASDA 3ASGA 4I2WA 4WV6A 4U2XD 2BEDA 4URKA 2R02A 3D9JA 5AENA 4CGVA 4G11A 1M8WA 3LCAA 2R17C 3CGHA 2IOLA 2BF0X 4YVQC 3R7RA 2RD0A 5B1AE 3JUIA 3DXKG 1UN9A 3ZEFA 4DK5A 3UT7A 4K03A 3D9PA 2GRMA 2HE0A 4HFGA 3ZPJA 4UAEA 5D0OD 1JPWA 5G05C 3K5QA 2Z6GA 2WVIA 3PEVB 1UKLA 2J9QA 2JAKA 3RZ9A 3C5RA 3C98A 1TR4A 4UI9J 5D0QD 3AS8A 4M3OA 3HVEB 3B7UX 4GA0A 2OT8A 3Q0PA 2IU1A 5ANRA 2FV2A 4ZDUA 3EHRA 2WMOA 5FQ7A 5BXOA 5H7PA 1M8XA 3UKYB 2F8XK 3E30A 4FZFA 2JABA 4YNDA 3AG2E 3WPTA 2QC9A 4MFVA 1DVPA 3V74A 4PS7A 4R11A 4LSZE 3LY9A 4BSZB 4EBAA 3L3QA 1N9AA 3ESLA 4W9RA 4FC8A 3HXFA 1M1EA 3ESKA 4ILHB 2OOEA 4B8JA 4G26A 4I9EA 2PQRA 2WXPA 4DRXE 2EILE 3ZU7B 2KCLA 3PVLA 2R5SA 3V6YA 4AVXA 3RRNB 4JEUA 1QNFA 3NQPA 4Q94A 3AAAC 3WOYA 1QQEA 3MV2B 4CT7B 5EX0A 4J7WA 3O4ZA 3UI2A 3ZYMA 2XCCA 4EPZA 5FQ4A 4MRUA 4XE0A 4I3NA 1JCQA 3JUEA 3DEPA 2KXPC 3EU5A 4MS6A 1ELKA 2WXMA 3E33A 1W9CA 3Q7AA 2C2LA 2KCKA 3FU6A 5EN5D 4G1TA 4JHJA 1RW2A 3HHMA 4WAFA 3WYFC 1FPPA 4HRNA 2QMRA 1U3DA 5KCMA 3FHEA 4UWFA 2A5UA 4KBQA 3ZILA 5H2WA 1N4RA 2BCTA 2IAEB 4A1SA 1NFIE 3ZXSA 3DPDA 1OYZA 2HR2A 4WNGA 3ZFWA 3ZINA 1SVXA 4NACA 4KVOA 2KC7A 2B6CA 4GZCA 4WNDA 4DBAA 3JX7A 1MZCA 4ACLA 1E7VA 4I1OB 4AEZC 5HS0A 2KCVA 2QFCA 4G2VA 2VSOE 4LNUD 4XX5A 2VJ8A 2DIWA 5LOZA 4WWNA 3FTUA 2AWIA 4U63A 3F6QA 1KPSB 4V3RA 1WAO1 4NQ0A 2XOAA 1S70B 4LNGA 3PUKA 1K1AA 1BLXB 4CDMA 4PLQA 1ZB1A 3T5XA 4RG6A 1QBQA 1XQSA 1XQRA 3VLEA 3BG1B 3UPVA 3PE4A 1MQSA 4B8AA 4FU3A 5BT1A 3KAEA 5HUYC 3CHRA 3SGHA 3GRLA 1QGRA 4NIKA 3W9GA 4PLRA 3JQ1A 4C9BB 2LO6A 1HE8A 4U07A 3ND2A 4R7LA 3SZ7A 3U3WA 1NL4A 4GPKA 4HXTA 3PZ3A 2VGXB 5LSWA 3U4TA 3FTWA 1M8ZA 4A3VA 4ACKA 4I6IA 2ETBA 2FULA 1PJMB 2XCBA 3BWTA 4PS3A 4L7TA 4DB6A 5BXUA 4A55A 2L6JA 5G04C 4ZHBA 3SLAA 2Z5JA 2RU4A 4HB5A 4KZ0A 3U66A 3K7VA 3LXUX 4V3QA 3LTJA 5ARGA 5DN7A 2VGYA 1MHQA 1S0PA 4OAVB 1OY3D 3L82A 3V31A 3BX2A 3TAXA 4GTOA 1EJYI 1OWPA 1K8KG 5D5KC 2JKTB 3CSFA 2NYMB 5B1BE 4HRLA 5AQ9A 3NB2A 3FUHA 3TL5A 1JCRA 2J8SD 5FZQA 2GRNB 2C1TA 2FO7A 1EDUA 1MX2A 4XI9A 3ZHEB 3HXBA 1ZU2A 4YGXA 1OT8A 4B8OA 1Z2CB 4UAFB 3NMZA 2MRIA 4BETA 3UM1A 2FF4A 2V8SE 3Q15A 4BX9A 4A3TA 4H3HA 4U5NA 4B8PA 4OVVA 2Y0BG 2UY1A 1N94A 4DLOA 1AWCB 4GTSA 3UTMA 3WOZA 4MBGA 3ISMC 3ZN3A 3AJIA 3CK7A 3SFZA 3L6AA 4JW1A 4JZYA 3GYZA 3T5VA 3AS4A 3HXDA 2XGMA 1QZ7A 3L6YA 3UINC 4LRZA 2WXOA 3OBVA 4WNFA 4Z68A 3TWTA 4B8CB 5EKGA 4FZDA 5KWDA 2IQCA 4JHKA 3MKRA 3PH0C 1WG0A 4MZ5E 5BPPA 5E75A 5FZSA 4L23A 4O6FA 4P6ZB 5ENPD 5D66A 2NYLA 5JJ6A 3FUDA 2IFUA 3QAQA 4BY6A 4GTPA 2WTKA 3CVWA 4X8QA 3ZIOA 3SQVA 2YQ8A 2WXRA 3MEKA 4GPMA 4JW2B 2V4HC 4J8YA 3TG4A 4FP7A 3ZXPA 4UI9C 4UUCA 3CQGB 4I7IA 3L16A 5KL8A 1LRVA 1EE4A 3VLFA 3RAUA 4F6RD 1LD7A 1H6KA 2L0TB 2JKRB 3KSQA 4HVBA 2LUHA 1HX8A 4I6GA 3FUMA 1IALA 3KD7A 5AQ7A 5CEAA 4WWOA 3UM3A 5KBAA 2E0IA 3U9WA 1UPKA 2Q5DA 4RQIA 3EHNA 4IULA 3S7DA 2I1JA 4RVBA 2F31A 3NOWA 4CGWA 2F8YA 4JKQA 4HNMA 2LXLA 3Q0SA 4EZKA 4DI4A 3C3OA 4EVAA 1TYQG 5LCWJ 4I43A 1H0AA 5C1DA 1N54A 3QG9A 1MYOA 3E32A 2XEVA 1L5JA 1TNYA 4XZRB 4JEHA 3ASFA 3PSTA 5ENQD 5ENNA 4PUCA 5CLBA 4C48B 3TGOA 3I3NA 4Y5JA 3TJPA 5ENRD 3L6XA 3NAWA 4GTTA 4V3OA 4HQDA 4F1SA 2Z6HA 3UX4A 3CV0A 2P9KG
chains in the Genus database with same CATH topology
1OUVA 1QBKB 3BSXA 3EDTB 3QGBA 4AJWA 1Q1SC 2FBNA 3FP3A 3HYMB 1UPLA 1WA5B 1NA3A 4FDDA 3SI5A 3SF4A 2AVPA 3SHFA 4IMIA 2ILRA 3L13A 3LY7A 3D9NA 3MZLB 4I2ZA 4YK6A 5CTTA 3Q4AB 5J90A 3CIAA 4CCAA 5CL3A 3I4GA 3CVLA 5T3RA 3LKUA 3FTXA 4GCOA 4I9CA 1B3UA 4MFUA 4NZWA 4J6IA 1EPUA 4QFVA 3DBSA 1E8WA 4IYPA 3TX7A 4KXKB 4FADA 3ZIPA 4K92A 3ZIKA 5KJKA 4IRUA 1TJFA 4CB8A 3U64A 1IQRA 3URZA 5BNWA 4J8DA 3HDXA 4B94A 1HO8A 3TT9A 2Q7FA 1GW6A 2WXGA 4I1MA 1IQ1C 4GYWA 3ZYLA 2JDQA 1E8YA 4KMOA 3LS8A 3GW4A 2MOWA 3KEZA 4AY5A 3LDZA 2WQ6A 4RZPA 2IE4A 2XGOA 3RJVA 2QNAA 2L9BA 1JDHA 3NMWA 3ZHPA 4B0ZA 2OVFA 2VGLA 2IX3A 2DBAA 4AXHA 4GMOA 3QHEA 4I5NA 3R9AB 4BTBA 3QWVA 2VSNA 2J08A 3QNKA 3RO2A 3HIZA 4H3KA 3BG0B 3FUFA 2IONA 2XRZA 4GA2A 4Y6CA 2XA7B 3Q49B 3ASHA 3TJZB 3SNXA 3B7RL 4FLHA 5AJDA 4CT0A 3ZKVA 4H7YA 3FU5A 3L3FX 1PC2A 4DB8A 3TPMA 2LSVA 4B18A 3ONKA 4CB9A 3ZW3A 5A23A 4P6ZG 1YA0A 3MGBA 4MZ6E 2WXFA 3FU3A 3ENEA 2UWJG 4WUYA 3KNDA 2JLBA 3T7UA 3KS2A 4PH4B 2I2OA 3B13A 2DCPA 5G55A 3HVEA 4BPLA 5A7DB 1JUQA 3CKCA 1HF8A 4IMJA 3Q0OA 2RG8A 3FTSA 4HOUA 2WXIA 1EYHA 3RRMB 5AJLA 4UQIB 2XPIA 1WM5A 3FGAB 1PY1A 3FH8A 4XIFA 4LEUA 2I9CA 1H2UA 5LP0A 2DB0A 2LAIA 2Y4UA 1HU3A 2YNRA 4JHRA 4GAAA 4N39A 3LPZA 3W3UA 5CLCA 3MJWA 4KVMA 3CVNA 3AU4A 1Y8MA 3TXNA 3RU0A 2HYZA 3ZIRA 2CG3A 3B7SA 1DNPA 5DIZA 3GNIA 4I8MA 4DB9A 3FUIA 1JPLA 3MKQB 1HXIA 4CRWA 3MCXA 3APCA 1Y6IA 4AY6A 3FUNA 1NA0A 5EDSA 1JWGA 3JY1A 3TG5A 3CVUA 3K64A 2IAEA 5CL4A 1V18A 4HM9A 3G2TA 4R0ZA 2WM9A 1XNFA 4WWPA 3I4RB 3ODSA 4XKCA 5B56A 2LSUA 5KJMA 3IHYA 3MV3B 2M63A 2HM8A 3ZYKA 3LTMA 2J07A 5CLAA 3DADA 3FH5A 4U5LA 4APOA 4DVGB 5LCWC 4FHJA 3TJ3A 1H2VC 5CLEA 3GQ2A 3Q0RA 4N2QA 4YVOA 3VE6A 3QWPA 3UMVA 3OXFA 3EIQC 4I6JA 3CKBA 3SD5A 1INZA 4HLEA 2PL2A 3CVYA 5CL5A 2YHCA 1BPOA 3RIBA 5G05J 3BCTA 5AEIA 3APDA 4I17A 2QK2A 4U0SA 3D3MA 4TNMA 2X6KA 4G23A 2IW3A 4D49A 5G2NA 4D4EA 5CL6A 1UJJA 3A6PA 2VGXA 2KZTB 3IEGA 3S7JA 1I7WA 4XKBA 4PLSA 4AIFA 2NSZA 3UKWB 3TPOA 3Q0NA 2OV8A 3IFQA 4R10A 1KT1A 4UADA 4KZGA 4UQZA 2LNIA 1A17A 3B7TA 3APFA 4CT4A 4HORA 5HUWC 5E6QB 2AXUA 4DPRA 4LCTA 3EBBA 5LFAA 1OWMA 2JKTA 4U5UA 2NYMA 3FUKA 2W3CA 3CEQA 4UQYA 3E4BA 4J8EA 5AYWD 4P29A 1Z3XA 4DJSA 3QC1A 3DW8A 3O2QA 1UN8A 3ZHEA 4HOSA 5T8IA 2Y3AA 1TEZA 2NPPB 3ZGQA 4NEEA 2XPZA 2XPYA 3JCKC 2PM7A 3CVVA 3NZSA 4I5LA 2IF4A 4IN3B 3OUXA 4GMLA 1E8ZA 2WMNA 1W63B 2KATA 3NF1A 3H3DX 3VTYA 3S7BA 4DJAA 4L4IA 4A1GA 4OYSA 3BSBA 5C2YA 1FCHA 5JJAA 3CHOA 2CG2A 5EKQD 4B89A 1G3JA 3PRZA 3QWWA 2IE3A 2XGSA 4CBAA 3I5PA 3JYSA 2X19B 1UJKA 4V3IA 3BX3A 1OWNA 4JL0A 1Q1TC 3PS6A 3N71A 1XM9A 4U0ZA 2MHKA 4L7MA 4U04A 4ATGA 3TXMA 5CL8A 2GW1A 2EQXA 3NMXA 4JW2A 4Y6WA 4HXIA 4I96A 4RG9A 4GCNA 2VTBB 3LEWA 4I37A 3L22A 1GCJA 4MLPA 4EQFA 4CDNA 3K4EA 3GVTA 3IKOB 4AV7A 3GZSA 3UQ3A 4ANUA 2AXVA 4JXTA 2JKRA 2BUGA 1UW4B 3LY8A 2X3MA 3RRUA 3ZRHA 2HO1A 3NZUA 4TUUA 4E85A 3FH7A 3C2HA 2VSXE 4FZAA 3RO3A 2BNXA 2CFZA 4CT6B 4K0RA 4HOTA 4ANXA 4I1AA 2C1MA 4HS2A 4ABNA 3G2UA 5FTPA 4LACA 4OO6A 4GA1A 1M5NS 1E8XA 4EVTA 2JEKA 4QMIA 1SQMA 3ONLA 1BK6A 4BT9A 2BAPA 2KM4A 1KT0A 2QK1A 3S7FA 2CFUA 1OWOA 4EZLA 1E96B 4I6EA 2IOSA 2X1GF 3Q0QA 4QMJA 4UWGA 5KLAA 4TRQA 2WXQA 1PAQA 3IHVA 5FT9A 2ZU6B 5DBKA 3RK6A 3QMLC 3FTZA 3ZYQA 1HH8A 5SVZA 3CQCB 3FUEA 3BVSA 4F3VA 3LVQE 5BZVA 2C0MA 3K9IA 4N3CA 3WXXA 3LVRE 3RZXA 3CK8A 1VDYA 3O48A 4OIHA 2CHZA 4CRUB 4E6HA 3FUJA 3G2SA 4FQ3A 5FC8E 3VTXA 1IB2A 3MYVA 2YNSA 4FLBA 3AU3A 4D10C 2ONDA 4DLQA 3UKXB 3G2WA 2X6JA 1UG3A 2X6IA 3S2AA 2YNQA 3O4XA 2WXJA 2GL7A 3EA5B 4PS8A 1JWFA 2PF4A 5HI7A 2XHEA 3Q5MA 3EJNA 5H2XA 1IYGA 4WNEA 5BW8C 5KLRB 1QZ2A 4JPSA 3IBVA 4RXHB 3UT4A 4FFBC 1Z6TA 4U0UA 4BTAA 3OQSA 3JXYA 2X38A 3CLJA 1N52A 2LAHA 2V5FA 3PREA 5CMYA 1B89A 1ZBPA 5BZ5A 3K5YA 3UKZB 3D9KA 4KZCA 4U5OA 5CCMA 4KYOB 4YI0C 3QK0A 4N5CA 2XA7A 2IJGX 4E4VA 3RKVA 2WQHA 5AIJA 2NXPA 5LX8A 5JHAA 4K6JA 3CK9A 5FZRA 4L2YA 1FVFA 2WXHA 5CL7A 4NRHB 5J3VA 1E7UA 2V4LA 3FY4A 2X6HA 4UWHA 1I7XA 2WXNA 4XZ4A 1HG2A 2FEZA 1IQUA 4C0MA 3GS3A 4U8HA 1P5QA 2L0IA 2Z5KA 4FJYA 3CR3A 4YJLA 2BTDA 4J0UA 3FU0A 4N3AA 5EKFA 1TJCA 5J08A 4U5SA 5FQ6A 4ANVA 3T8MA 3CHPA 4U5VA 5BV1A 3GAEA 3P1UA 4UQIA 5K6SA 3Q47B 5EWPA 3L54A 3FGAA 4G25A 2WXLA 1OWLA 4BSXA 1U3CA 5BUZA 5ANLA 3UUXA 3IV0A 2VSYA 3C2GA 4GYOA 1HS6A 3ULQA 1UN0A 3BTRC 5SW9A 4L2LA 3OTNA 4QMHA 4J8FA 3GVOA 1BK5A 3SBSA 4UI9K 3ML9A 4UQXA 2YHEA 3L17A 3MKQA 3VLDA 4ADYA 3QJZA 4LERA 5FWQA 4GMNA 3AU5A 4GB9A 2WPVA 4CRVB 5KLTB 4CV5B 5CHEE 2PQNA 1LF8A 1H19A 2RU4B 3P2BA 2Y4TA 5M72A 1W3BA 4UWKA 4ILIA 5KL1A 1H2TC 4FJZA 4JVSA 3CSTA 4G24A 5CMWA 4APFA 3UT8A 5K9SA 1E90A 2YINA 3EHMA 4EV9A 1LUJA 3FTYA 4HTVA 4JC8A 3G2VA 3QB2A 4GZ5A 3FEYC 1U6GC 5ARFA 2AXZA 3FEXA 1WA5C 4OVUA 3Q0MA 3Q5UA 3CHQA 4NURA 4N3BA 1NP7A 3OXLA 4CDRA 2Z5OA 3PZDA 1QGKA 3LYAA 4F53A 2X6FA 5JJ7A 2P8QA 4GZDA 2UY1B 1HFAA 4Q96A 5CL9A 3SL9A 3JXZA 4DI3A 4FHKA 3FFLA 3QDNA 1WY6A 3K61A 3MX3A 4RV1A 4A0CA 3K49A 4Q69A 4TV3A 4EBAG 3D9LA 4BA3A 4PDXA 5EX3A 1TE4A 2KZTA 2J09A 5BV0A 2OF3A 3UL1B 2J4DA 2NYLB 4LUNU 3PUJA 4L4HA 3LWWA 3QARA 4ME2A 4JLQA 5JJTA 4I2SA 2OVBA 3PEUB 2P58C 3FTVA 1F59A 4UWLA 4AP2A 4BFRA 4UWXA 4GZ6A 4XI0A 3PDNA 3L08A 2GRLA 1M8YA 5KJNA 1IBRB 1O6PA 4AM9A 2AW6A 3CHSA 3UVUA 2NC9A 4BQKA 3CHMA 2VQ2A 4FULA 1IHGA 2GGFA 2I6HA 3QOUA 3CVPA 4RSYA 5JHBA 2WQ7A 1HZ4A 2NPPA 3PE3A 3O2SA 4J8SA 2J4BA 4I1EA 3JQ0A 4AOFA 3OPBA 1W63A 3V71A 4MKTA 3PNLB 3GZ1A 2Z5MA 1XGWA 4F7AA 4GYYA 2J49A 4U58A 3ZVVA 4U3JC 1TH1A 5HQ8A 4EV8A 1Z3YA 4C0EA 4YJEA 1PJNB 1NZNA 3ZIMA 3PSPA 5BYMA 1SZ9A 2QY7A 2R59A 2PZIA 3SBTB 4GZ3A 3D9OA 3FWVA 4L1BA 3OXGA 4BT8A 2C0LA 1ELWA 4JA7A 2PM6A 3FULA 3C5WA 4ILGA 4U54A 2YJYA 2V0PA 1T08A 2CHWA 4JW3C 3QKYA 5FQ8A 2IWHA 4HOQA 4I0YA 2H4MA 2WB2A 5G04J 4FA6A 2VTBA 3PNTB 4EECA 3R7QA 2Z5NA 3BEEA 3GB8A 4ANWA 1KLXA 1EE5A 5E76A 5FJYA 5KUBA 5HHGE 2BKUB 3OUWA 3K7WA 3VWAA 3K5ZA 5BZUA 5SWFA 3MA5A 3ODRA 1O6OA 5KJLA 3Q0LA 4O27A 3GZ2A 3K62A 4JA9A 3UL0B 2CHXA 4BWRA 3ML8A 3QGCA 4N2SA 3ZIQA 2A4ZA 3O2TA 2WXKA 2XQ0A 3OAWA 2E2EA 1SZAA 4H7XA 3FEYA 2FI7A 1X5BA 3D9IA 1FVHA 2I1KA 1HG5A 3FDHA 5CLDA 4BX8A 4KT6B 1Y2AC 4EZJA 3EIJA 1EF1C 5T4YA 1JPPA 1EJLI 4GMJA 3CVQA 2VYIA 4EVPA 3LJ3A 3AS5A 1ELRA 4CEMA 4GU5A 5A6CA 4PVZA 5CCLA 3CVXA 3FEXC 4DZSA 3D9MA 4G3AA 3IBEA 5BZ1A 2XRYA 2VGLB 3EG5B 2PKGA 3ASDA 3ASGA 4I2WA 4WV6A 4U2XD 4URKA 3D9JA 5AENA 4CGVA 4G11A 1M8WA 3LCAA 2R17C 3CGHA 2IOLA 2BF0X 4YVQC 3R7RA 2RD0A 3JUIA 1UN9A 3ZEFA 4DK5A 3UT7A 4K03A 3D9PA 2GRMA 4HFGA 3ZPJA 4UAEA 5D0OD 1JPWA 5G05C 3K5QA 2Z6GA 2WVIA 3PEVB 1UKLA 2J9QA 2JAKA 3RZ9A 3C98A 4UI9J 5D0QD 3AS8A 4M3OA 3HVEB 3B7UX 4GA0A 2OT8A 3Q0PA 2IU1A 5ANRA 2FV2A 4ZDUA 2WMOA 5FQ7A 1M8XA 3UKYB 4FZFA 4YNDA 3WPTA 4MFVA 1DVPA 3V74A 4PS7A 4R11A 3LY9A 4EBAA 3L3QA 3ESLA 4W9RA 4FC8A 1M1EA 3ESKA 4ILHB 2OOEA 4B8JA 4G26A 4I9EA 2PQRA 2WXPA 2KCLA 3PVLA 2R5SA 3V6YA 4AVXA 3RRNB 4JEUA 1QNFA 3NQPA 4Q94A 3WOYA 1QQEA 3MV2B 4CT7B 5EX0A 3O4ZA 3ZYMA 2XCCA 4EPZA 5FQ4A 4MRUA 4XE0A 4I3NA 4MS6A 1ELKA 2WXMA 1W9CA 2C2LA 2KCKA 3FU6A 4G1TA 4JHJA 3HHMA 4WAFA 3WYFC 2QMRA 1U3DA 5KCMA 3FHEA 4UWFA 2A5UA 4KBQA 3ZILA 5H2WA 2BCTA 2IAEB 4A1SA 3ZXSA 3DPDA 1OYZA 2HR2A 4WNGA 3ZFWA 3ZINA 4NACA 4KVOA 2KC7A 4GZCA 4WNDA 4DBAA 3JX7A 4ACLA 1E7VA 4I1OB 4AEZC 2KCVA 2QFCA 4G2VA 2VSOE 4XX5A 2VJ8A 2DIWA 5LOZA 4WWNA 3FTUA 2AWIA 4U63A 4V3RA 1WAO1 4NQ0A 2XOAA 3PUKA 4CDMA 4PLQA 3T5XA 4RG6A 1XQSA 1XQRA 3VLEA 3BG1B 3UPVA 3PE4A 1MQSA 4B8AA 4FU3A 5BT1A 3KAEA 5HUYC 3CHRA 3SGHA 3GRLA 1QGRA 4PLRA 3JQ1A 4C9BB 2LO6A 1HE8A 4U07A 3ND2A 4R7LA 3SZ7A 3U3WA 4GPKA 4HXTA 2VGXB 5LSWA 3U4TA 3FTWA 1M8ZA 4A3VA 4ACKA 4I6IA 2FULA 1PJMB 2XCBA 3BWTA 4PS3A 4L7TA 4DB6A 4A55A 2L6JA 5G04C 3SLAA 2Z5JA 2RU4A 4KZ0A 3U66A 3K7VA 3LXUX 4V3QA 3LTJA 5ARGA 5DN7A 2VGYA 1MHQA 1S0PA 3BX2A 3TAXA 1EJYI 1OWPA 5D5KC 2JKTB 3CSFA 2NYMB 3FUHA 3TL5A 5FZQA 2C1TA 2FO7A 1EDUA 4XI9A 3ZHEB 1ZU2A 4YGXA 4B8OA 1Z2CB 4UAFB 3NMZA 2MRIA 2FF4A 2V8SE 3Q15A 4BX9A 4A3TA 4H3HA 4U5NA 4B8PA 4OVVA 2UY1A 4DLOA 3WOZA 3ZN3A 3CK7A 3SFZA 3L6AA 4JW1A 4JZYA 3GYZA 3T5VA 3AS4A 2XGMA 1QZ7A 3L6YA 4LRZA 2WXOA 3OBVA 4WNFA 4B8CB 5EKGA 4FZDA 2IQCA 4JHKA 3MKRA 3PH0C 4MZ5E 5BPPA 5E75A 5FZSA 4L23A 4O6FA 4P6ZB 5JJ6A 2NYLA 3FUDA 2IFUA 3QAQA 4BY6A 2WTKA 3CVWA 3ZIOA 2YQ8A 2WXRA 3MEKA 4JW2B 3TG4A 4FP7A 4UI9C 3CQGB 4I7IA 3L16A 5KL8A 1LRVA 1EE4A 3VLFA 1H6KA 2L0TB 2JKRB 4HVBA 1HX8A 4I6GA 3FUMA 1IALA 3KD7A 4WWOA 2E0IA 3U9WA 1UPKA 2Q5DA 3EHNA 4IULA 3S7DA 2I1JA 4RVBA 2F31A 3NOWA 4CGWA 4JKQA 4HNMA 3Q0SA 4EZKA 4DI4A 4EVAA 5LCWJ 4I43A 1H0AA 5C1DA 1N54A 3QG9A 2XEVA 1L5JA 4XZRB 4JEHA 3ASFA 3PSTA 5ENNA 4PUCA 5CLBA 3TGOA 3I3NA 4Y5JA 3TJPA 3L6XA 4V3OA 4F1SA 2Z6HA 3UX4A 3CV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VLD A;  3VLF A;  4FP7 A;  4A3T A;  4A3V A;  3VLE A; 
#chains in the Genus database with same CATH topology
 1OUV A;  1QBK B;  3BSX A;  3EDT B;  3QGB A;  4AJW A;  1Q1S C;  1OXJ A;  2FBN A;  3FP3 A;  3HYM B;  1UPL A;  1WA5 B;  1NA3 A;  4FDD A;  3SI5 A;  3SF4 A;  2AVP A;  3SHF A;  4IMI A;  2ILR A;  2R03 A;  3L13 A;  2XS1 A;  3LY7 A;  3D9N A;  3MZL B;  1IHB A;  3KSL A;  4I2Z A;  3J5Q B;  4YK6 A;  5CTT A;  4U7E B;  3Q4A B;  5J90 A;  1WDY A;  3CIA A;  4CCA A;  3DXM G;  5CER B;  5CL3 A;  1H6O A;  3I4G A;  3CVL A;  5T3R A;  3LKU A;  3V2O A;  1H6P A;  3FTX A;  4GCO A;  4I9C A;  1B3U A;  4MFU A;  4NZW A;  4J6I A;  1EPU A;  3TWV A;  4HNA D;  4QFV A;  3LJN A;  3DBS A;  1E8W A;  4G8K A;  4IYP A;  3TX7 A;  4KXK B;  4FAD A;  3ZIP A;  2RKK A;  1TNU A;  4HI9 A;  4K92 A;  4N5Q A;  3ZIK A;  5KJK A;  4IRU A;  1TJF A;  3SFY A;  4CB8 A;  4DUI A;  3U64 A;  1IQR A;  3URZ A;  5BNW A;  4J8D A;  3HDX A;  4B94 A;  1HO8 A;  3TT9 A;  2Q7F A;  1GW6 A;  2WXG A;  4I1M A;  1IQ1 C;  4GYW A;  3ZYL A;  2JDQ A;  5EID A;  4BEP A;  1E8Y A;  4KMO A;  3LS8 A;  3GW4 A;  5CRU A;  3AG1 E;  4JB8 P;  2MOW A;  3KEZ A;  4TXP A;  4AY5 A;  4LNB A;  3LDZ A;  2WQ6 A;  4RZP A;  2IE4 A;  3DPY A;  2XGO A;  3RJV A;  2QNA A;  1SA4 A;  1JDH A;  2L9B A;  3NMW A;  3ZHP A;  4B0Z A;  1AP7 A;  2OVF A;  2VGL A;  2IX3 A;  2DBA A;  4AXH A;  4GMO A;  3QHE A;  4I5N A;  3R9A B;  4BTB A;  3QWV A;  2VSN A;  2J08 A;  3QNK A;  3RO2 A;  3HIZ A;  3SFX A;  3UJ0 A;  4H3K A;  1TNB A;  3BG0 B;  1UOH A;  3FUF A;  2ION A;  2XRZ A;  4GA2 A;  4Y6C A;  2XA7 B;  3Q49 B;  3WG7 E;  1O1R A;  3ASH A;  3TJZ B;  3SNX A;  1S63 A;  3B7R L;  4FLH A;  5AJD A;  4CT0 A;  4DX2 A;  4HBD A;  3ZKV A;  4H7Y A;  3FU5 A;  3L3F X;  1PC2 A;  4DB8 A;  3TPM A;  2LSV A;  3PZ2 A;  4B18 A;  3ONK A;  4CB9 A;  3ZW3 A;  2P9N G;  5A23 A;  4P6Z G;  1YA0 A;  3MGB A;  4MZ6 E;  2WXF A;  3FU3 A;  3ENE A;  2UWJ G;  4WUY A;  1N95 A;  3KND A;  2JLB A;  3E37 A;  3T7U A;  3KS2 A;  4PH4 B;  2I2O A;  3C3Q A;  3B13 A;  3R9M A;  2DCP A;  2XEN A;  3HVE A;  5G55 A;  4BPL A;  5A7D B;  1JUQ A;  3CKC A;  1HF8 A;  4IMJ A;  3Q0O A;  4EHM A;  2DZO A;  2RG8 A;  3FTS A;  4HOU A;  2WXI A;  1EYH A;  3RRM B;  1N4K A;  5AJL A;  4UQI B;  2XPI A;  1WM5 A;  2RFM A;  3FGA B;  1PY1 A;  3FH8 A;  4XIF A;  4LEU A;  3V2X A;  2I9C A;  3DRA A;  1H2U A;  5LP0 A;  2DB0 A;  2LAI A;  2Y4U A;  4GTV A;  1HU3 A;  2YNR A;  4JHR A;  4GAA A;  4N39 A;  3LPZ A;  3W3U A;  5CLC A;  3UM2 A;  3MJW A;  4KVM A;  2XEH A;  2DWZ A;  3CVN A;  2BKK B;  3AU4 A;  1Y8M A;  4BES A;  1N4S A;  1S64 A;  3JXI A;  3TXN A;  3DSX A;  3RU0 A;  2HYZ A;  3ZIR A;  2CG3 A;  3B7S A;  1DNP A;  5DIZ A;  3GNI A;  4I8M A;  4DB9 A;  3FUI A;  1JPL A;  3MKQ B;  1HXI A;  4CRW A;  3MCX A;  4B93 B;  1BU9 A;  3APC A;  1Y6I A;  4AY6 A;  3FUN A;  1NA0 A;  3EU9 A;  5AAO A;  3ULY A;  5EDS A;  1JWG A;  3JY1 A;  3TG5 A;  3CVU A;  3K64 A;  2IAE A;  5CL4 A;  1V18 A;  4HM9 A;  3G2T A;  4R0Z A;  2WM9 A;  3Q7F A;  1YCS B;  1XNF A;  4WWP A;  3I4R B;  3ODS A;  4LG6 A;  4XKC A;  5B56 A;  2LSU A;  4JD2 G;  3PZ4 A;  5KJM A;  2RFA A;  3IHY A;  3MV3 B;  2M63 A;  2HM8 A;  3ZYK A;  1MX6 A;  3LTM A;  2J07 A;  5CLA A;  3DAD A;  3FH5 A;  3DSS A;  4U5L A;  4APO A;  4DVG B;  4TXQ A;  5LCW C;  4FHJ A;  4U8Y D;  1O1S A;  3TJ3 A;  1H2V C;  5CLE A;  1TN8 A;  3GQ2 A;  3Q0R A;  3HXE A;  4N2Q A;  4YVO A;  3VE6 A;  3QWP A;  3UMV A;  3BQO A;  3OXF A;  3EIQ C;  4I6J A;  4BER A;  5KNH D;  3CKB A;  2ETC A;  3SD5 A;  1INZ A;  4HLE A;  2PL2 A;  3CVY A;  5CL5 A;  2YHC A;  1BPO A;  3RIB A;  5G05 J;  3BCT A;  5AEI A;  3APD A;  3TWU A;  4I17 A;  2QK2 A;  4U0S A;  3D3M A;  4TNM A;  2QYJ A;  4G23 A;  2IW3 A;  2X6K A;  4D49 A;  5G2N A;  4D4E A;  5CL6 A;  2P9S G;  1UJJ A;  1BI7 B;  3A6P A;  2VGX A;  2KZT B;  3IEG A;  3S7J A;  1I7W A;  2F37 A;  4XKB A;  4U95 D;  4PLS A;  4AIF A;  2AJA A;  5EYP F;  2NSZ A;  3UKW B;  3TPO A;  3Q0N A;  2OV8 A;  3IFQ A;  4R10 A;  2IEJ A;  1KT1 A;  4UAD A;  5CED B;  4KZG A;  4UQZ A;  2LNI A;  1A17 A;  3C3R A;  1MJ0 A;  1N0Q A;  3B7T A;  3APF A;  4CT4 A;  4HOR A;  5FIO A;  3T8S A;  1IXV A;  5HUW C;  5AQB A;  2Y69 E;  5E6Q B;  5CEC B;  2AXU A;  4DPR A;  1TNZ A;  4LCT A;  3EBB A;  5LFA A;  1OWM A;  2JKT A;  4U5U A;  1LTX A;  2NYM A;  3FUK A;  2W3C A;  3CEQ A;  4UQY A;  3E4B A;  4J8E A;  5AYW D;  4P29 A;  1Z3X A;  4DJS A;  3QC1 A;  2H6H A;  1D8E A;  3DW8 A;  3O2Q A;  1UN8 A;  3Q75 A;  3ZHE A;  4HOS A;  5T8I A;  3W9F A;  2Y3A A;  1TEZ A;  2NPP B;  3ZGQ A;  4NEE A;  1YMP A;  2XPZ A;  2XPY A;  3JCK C;  4HLL A;  3UM0 A;  2PM7 A;  3CVV A;  3NZS A;  3ABM E;  1OCR E;  4I5L A;  2IF4 A;  2DYS E;  4IN3 B;  3OUX A;  4GML A;  1LSH A;  1E8Z A;  5EYL A;  2WMN A;  1W63 B;  2KAT A;  3NF1 A;  3ASO E;  3H3D X;  3E34 A;  2ZIS A;  3VTY A;  3S7B A;  1OCC E;  4DJA A;  4L4I A;  4A1G A;  4OYS A;  3BSB A;  5C2Y A;  1FCH A;  2P9P G;  3TWX A;  3HG0 D;  5JJA A;  3CHO A;  2CG2 A;  2OEW A;  3D9H A;  2PNN A;  5EKQ D;  4GMR A;  5CBN A;  4DX7 D;  4B89 A;  1G3J A;  3PRZ A;  3QWW A;  2IE3 A;  2XGS A;  4CBA A;  3I5P A;  3JYS A;  2X19 B;  4CZ2 D;  2LXM A;  1UJK A;  4V3I A;  3BX3 A;  1OWN A;  4JL0 A;  1OCZ E;  1Q1T C;  3PS6 A;  1BI8 B;  3N71 A;  1XM9 A;  4U0Z A;  2MHK A;  4L7M A;  4U04 A;  3HRA A;  3UKU G;  4ATG A;  3TXM A;  5CL8 A;  2GW1 A;  2EQX A;  3NMX A;  4JW2 A;  4RLY A;  4Y6W A;  4HXI A;  4I96 A;  4RG9 A;  4GCN A;  2VTB B;  3LEW A;  5B3S E;  4I37 A;  3L22 A;  1GCJ A;  4MLP A;  1LD8 A;  2P9I G;  4EQF A;  4CDN A;  3K4E A;  3GVT A;  3IKO B;  4AV7 A;  1O5M A;  2EIK E;  3GZS A;  1V54 E;  3UQ3 A;  4ANU A;  2AXV A;  4JXT A;  2JKR A;  3TWS A;  2BUG A;  1UW4 B;  3LY8 A;  3DWL G;  4F1P A;  2X3M A;  3RRU A;  4DX1 A;  3ZRH A;  2HO1 A;  5IY5 E;  3NZU A;  4GTM A;  4TUU A;  4E85 A;  3FH7 A;  3C2H A;  2VSX E;  4FZA A;  3RO3 A;  5JMN D;  2XS8 A;  2BNX A;  5KNG A;  2CFZ A;  3NOC D;  5CBO A;  4CT6 B;  4K0R A;  4HOT A;  4ANX A;  4O60 A;  4I1A A;  2C1M A;  4HS2 A;  4ABN A;  3G2U A;  5FTP A;  4LAC A;  3HXC A;  4OO6 A;  2IO2 C;  4K5A B;  4GA1 A;  1M5N S;  1E8X A;  2ZIR A;  3UXG A;  2BKG A;  4EVT A;  2JEK A;  4QMI A;  1SQM A;  3ONL A;  1BK6 A;  4BT9 A;  2BAP A;  3TWW A;  2KM4 A;  1KT0 A;  1YYH A;  2QK1 A;  3S7F A;  1DCQ A;  2CFU A;  1OWO A;  3Q73 A;  4EZL A;  1E96 B;  4I6E A;  2IOS A;  2X1G F;  3AG3 E;  4QQI A;  3Q0Q A;  4QMJ A;  3SO8 A;  3Q9U C;  3DST A;  4UWG A;  1X81 A;  5KLA A;  4TRQ A;  1TNO A;  2WXQ A;  1PAQ A;  3IHV A;  5FT9 A;  2H6F A;  3Q9N C;  2ZU6 B;  5DBK A;  3RK6 A;  3QML C;  3FTZ A;  3ZYQ A;  1HH8 A;  1SA5 A;  5SVZ A;  3CQC B;  3FUE A;  1BD8 A;  1K1B A;  4YDY A;  3C72 A;  3IXE A;  3BVS A;  4F3V A;  2GRR B;  3LVQ E;  5BZV A;  2C0M A;  2ZXW E;  3K9I A;  3BUA A;  2H6G A;  4L9P A;  4N3C A;  3WXX A;  1DCE A;  3LVR E;  3RZX A;  3CK8 A;  1VDY A;  3O48 A;  4OIH A;  2CHZ A;  5D2M C;  4CRU B;  4E6H A;  3FUJ A;  3G2S A;  4FQ3 A;  5FC8 E;  3VTX A;  1IB2 A;  3MYV A;  2YNS A;  4FLB A;  3AU3 A;  4D10 C;  2OND A;  4DLQ A;  3UKX B;  3G2W A;  2X6J A;  1UG3 A;  2X6I A;  3V30 A;  3S2A A;  1N4Q A;  2YNQ A;  2GRP B;  5HRY A;  3O4X A;  2WXJ A;  2GL7 A;  3EA5 B;  5ENS D;  3UIO C;  4PS8 A;  1JWF A;  2PF4 A;  5HI7 A;  2XHE A;  3Q5M A;  3EJN A;  5H2X A;  1IYG A;  2KBX A;  4WNE A;  5BW8 C;  5KLR B;  4M7C A;  1QZ2 A;  4JPS A;  1D8D A;  3IBV A;  4RXH B;  3UT4 A;  4FFB C;  2P9U G;  1Z6T A;  5EIB E;  3DSW A;  4U0U A;  4BTA A;  3OQS A;  3JXY A;  2X38 A;  3CLJ A;  1N52 A;  2LAH A;  2DZN A;  2V5F A;  2EIM E;  3PRE A;  5CMY A;  1B89 A;  1ZBP A;  5BZ5 A;  4YDO A;  3ZUV B;  3K5Y A;  3UKZ B;  3D9K A;  4KZC A;  4U5O A;  5CCM A;  3L9T A;  4KYO B;  1JCS A;  4YI0 C;  3QK0 A;  4N5C A;  2XA7 A;  5FIN A;  2IJG X;  4E4V A;  3UKR G;  4K5B A;  3RKV A;  2WQH A;  5AIJ A;  2NXP A;  5LX8 A;  5JHA A;  4K6J A;  3CK9 A;  5FZR A;  4L2Y A;  1FVF A;  2WXH A;  5CL7 A;  4NRH B;  5J3V A;  4A63 B;  1E7U A;  5ITZ F;  2V4L A;  3FY4 A;  3TWR A;  2X6H A;  3ASN E;  4UWH A;  2ETA A;  1I7X A;  2OCC E;  2WXN A;  1HG2 A;  4XZ4 A;  2FEZ A;  1IQU A;  3Q79 A;  4C0M A;  3GS3 A;  4U8H A;  1P5Q A;  2L0I A;  3TWQ A;  4FJY A;  2Z5K A;  5JA4 D;  4ATZ D;  3CR3 A;  4YJL A;  2BTD A;  4J0U A;  3V79 K;  2R2L A;  3FU0 A;  4N3A A;  5EKF A;  1TJC A;  5J08 A;  4U5S A;  5FQ6 A;  4ANV A;  1KZP A;  1TN7 A;  3T8M A;  3CHP A;  2GRQ B;  4U5V A;  5BV1 A;  3GAE A;  3P1U A;  4UQI A;  2QZA A;  5K6S A;  3Q47 B;  5EWP A;  3L54 A;  3FGA A;  1N11 A;  4G25 A;  4O1O A;  2WXL A;  1OWL A;  4BSX A;  4O1P A;  4U96 D;  1U3C A;  5BUZ A;  2DYR E;  5ANL A;  3UUX A;  3IV0 A;  1FT2 A;  2VSY A;  3C2G A;  4GYO A;  1HS6 A;  3ULQ A;  1UN0 A;  3BTR C;  5SW9 A;  4L2L A;  2L6B A;  3OTN A;  4QMH A;  4J8F A;  2VGE A;  3GVO A;  1BK5 A;  3SBS A;  4UI9 K;  3ML9 A;  4UQX A;  2FO1 E;  2YHE A;  3L17 A;  3MKQ A;  3ZKJ A;  3JXJ A;  5ENT D;  3VLD A;  4ADY A;  3QJZ A;  4LER A;  2H6I A;  5FWQ A;  1Z5S C;  1O1T A;  4GMN A;  3AU5 A;  2IO3 C;  4GB9 A;  2WPV A;  3T9K A;  4CRV B;  3ULE G;  3KEA A;  5KLT B;  4CV5 B;  3B95 A;  5CHE E;  2PQN A;  1LF8 A;  4U8V D;  1H19 A;  2RU4 B;  3P2B A;  2Y4T A;  5M72 A;  1W3B A;  4CYM D;  4UWK A;  1FT1 A;  1N4P A;  4ILI A;  2P9L G;  5KL1 A;  1H2T C;  4FJZ A;  4JVS A;  4OAU C;  3CST A;  4G24 A;  5CMW A;  4APF A;  5CRV A;  3UT8 A;  5K9S A;  1E90 A;  2YIN A;  3EHM A;  4EV9 A;  1LUJ A;  3FTY A;  4HTV A;  4JC8 A;  3G2V A;  3QB2 A;  4GZ5 A;  3FEY C;  1IKN D;  5ENO D;  1U6G C;  5ARF A;  2AXZ A;  3FEX A;  1WA5 C;  4OVU A;  1DC2 A;  3Q0M A;  3Q5U A;  3CHQ A;  4NUR A;  4N3B A;  1NP7 A;  3OXL A;  4CDR A;  2Z5O A;  3SY2 A;  3PZD A;  3J5P A;  1QGK A;  2R05 A;  5EIL A;  3LYA A;  4F53 A;  2X6F A;  5JJ7 A;  2P8Q A;  4GZD A;  2UY1 B;  1HFA A;  4Q96 A;  5CL9 A;  2IY0 C;  3SL9 A;  3JXZ A;  4DI3 A;  4XEI G;  4FHK A;  3BU8 A;  3FFL A;  3QDN A;  1WY6 A;  3K61 A;  3MX3 A;  4RV1 A;  4A0C A;  1OCO E;  1KZO A;  1RZ4 A;  3K49 A;  4Q69 A;  2F0Y A;  4TV3 A;  4EBA G;  3D9L A;  3UJ4 A;  2P2C P;  4BA3 A;  3B7B A;  2GRO B;  4PDX A;  5EX3 A;  1TE4 A;  2KZT A;  2J09 A;  5BV0 A;  2OF3 A;  3UL1 B;  3NOG D;  2J4D A;  2NYL B;  2MYO A;  4LUN U;  3PUJ A;  4L4H A;  3LWW A;  3QAR A;  3ABL E;  4ME2 A;  4JLQ A;  3X2Q E;  5JJT A;  4I2S A;  1A5E A;  2OVB A;  3PEU B;  2P58 C;  2Y1L E;  2XEE A;  3FTV A;  1F59 A;  4UWL A;  4AP2 A;  4BFR A;  4UWX A;  4GZ6 A;  4XI0 A;  3PDN A;  3L08 A;  4HRM B;  2GRL A;  1M8Y A;  1D9S A;  5KJN A;  1IBR B;  1O6P A;  4TXR A;  4YDE A;  4AM9 A;  2AW6 A;  1V55 E;  3CHS A;  3UVU A;  2NC9 A;  4BQK A;  3CHM A;  2VQ2 A;  4FUL A;  1IHG A;  2GGF A;  2I6H A;  3QOU A;  3UIP C;  3CVP A;  4RSY A;  1NI1 A;  5JHB A;  2WQ7 A;  1HZ4 A;  4GTQ A;  2NPP A;  2A5E A;  3PE3 A;  1G3N B;  2NYJ A;  3O2S A;  4J8S A;  3DEO A;  2J4B A;  4I1E A;  3JQ0 A;  3AG4 E;  4AOF A;  3OPB A;  5HKP A;  1W63 A;  1Q2Z A;  3V71 A;  4MKT A;  2ZGG A;  3PNL B;  3GZ1 A;  2V5Q C;  2Z5M A;  1XGW A;  4F7A A;  3EHQ A;  4GYY A;  2J49 A;  4U58 A;  3ZVV A;  4U3J C;  1TH1 A;  5HQ8 A;  4EV8 A;  1Z3Y A;  4C0E A;  4YJE A;  1PJN B;  4ZFH A;  1NZN A;  1QYM A;  4GTR A;  3ZIM A;  3PSP A;  5BYM A;  1SZ9 A;  2DVW A;  2QY7 A;  2R59 A;  5AQA A;  2PZI A;  3SBT B;  4GZ3 A;  3D9O A;  3FWV A;  4L1B A;  1K3Z D;  3OXG A;  4BT8 A;  2C0L A;  1ELW A;  4JA7 A;  2PM6 A;  3FUL A;  3C5W A;  4TUM A;  4ILG A;  4U54 A;  3DSU A;  2YJY A;  2V0P A;  1T08 A;  2CHW A;  4JW3 C;  3QKY A;  5FQ8 A;  2IWH A;  4HOQ A;  4I0Y A;  2H4M A;  2WB2 A;  2B0O E;  3ABK E;  3NBN B;  3Q78 A;  3DSV A;  4YDW A;  5G04 J;  4FA6 A;  2VTB A;  3PNT B;  4EEC A;  3R7Q A;  2Z5N A;  3BEE A;  3GB8 A;  4ANW A;  2EIN E;  1KLX A;  1EE5 A;  5E76 A;  5FJY A;  5KUB A;  3ZNG A;  5HHG E;  2BKU B;  3OUW A;  3K7W A;  3VWA A;  3K5Z A;  4HI8 A;  5BZU A;  5SWF A;  3MA5 A;  3ODR A;  1O6O A;  5KJL A;  5AAR A;  3Q0L A;  4O27 A;  3GZ2 A;  5AN8 A;  3K62 A;  4JA9 A;  4K5C A;  3RSE G;  3UL0 B;  2CHX A;  4DX6 D;  2QYU A;  4BWR A;  3ML8 A;  3QGC A;  4N2S A;  3ZIQ A;  2A4Z A;  2OEV A;  3O2T A;  2WXK A;  2XQ0 A;  3OAW A;  4G8L A;  1U2V G;  2E2E A;  1SZA A;  4H7X A;  3FEY A;  2FI7 A;  1X5B A;  3D9I A;  4DX5 D;  1FVH A;  2XZD G;  2I1K A;  1HG5 A;  3FDH A;  5CLD A;  4BX8 A;  4KT6 B;  2ZGD A;  1Y2A C;  4EZJ A;  3EIJ A;  1MX4 A;  1EF1 C;  5T4Y A;  1JPP A;  3PZ1 A;  1EJL I;  4GMJ A;  3CVQ A;  1SW6 A;  2EIJ E;  2VYI A;  4EVP A;  3LJ3 A;  3AS5 A;  1ELR A;  4CEM A;  4GU5 A;  1TN6 A;  3T8K A;  4PVZ A;  5A6C A;  3EUV A;  5CCL A;  3CVX A;  3FEX C;  1N0R A;  4DZS A;  3D9M A;  4G3A A;  3IBE A;  5BZ1 A;  2XRY A;  2XZT G;  2VGL B;  3EG5 B;  2PKG A;  3ASD A;  3ASG A;  4I2W A;  4WV6 A;  4U2X D;  2BED A;  4URK A;  2R02 A;  3D9J A;  5AEN A;  4CGV A;  4G11 A;  1M8W A;  3LCA A;  2R17 C;  3CGH A;  2IOL A;  2BF0 X;  4YVQ C;  3R7R A;  2RD0 A;  5B1A E;  3JUI A;  3DXK G;  1UN9 A;  3ZEF A;  4DK5 A;  3UT7 A;  4K03 A;  3D9P A;  2GRM A;  2HE0 A;  4HFG A;  3ZPJ A;  4UAE A;  5D0O D;  1JPW A;  5G05 C;  3K5Q A;  2Z6G A;  2WVI A;  3PEV B;  1UKL A;  2J9Q A;  2JAK A;  3RZ9 A;  3C5R A;  3C98 A;  1TR4 A;  4UI9 J;  5D0Q D;  3AS8 A;  4M3O A;  3HVE B;  3B7U X;  4GA0 A;  2OT8 A;  3Q0P A;  2IU1 A;  5ANR A;  2FV2 A;  4ZDU A;  3EHR A;  2WMO A;  5FQ7 A;  5BXO A;  5H7P A;  1M8X A;  3UKY B;  2F8X K;  3E30 A;  4FZF A;  2JAB A;  4YND A;  3AG2 E;  3WPT A;  2QC9 A;  4MFV A;  1DVP A;  3V74 A;  4PS7 A;  4R11 A;  4LSZ E;  3LY9 A;  4BSZ B;  4EBA A;  3L3Q A;  1N9A A;  3ESL A;  4W9R A;  4FC8 A;  3HXF A;  1M1E A;  3ESK A;  4ILH B;  2OOE A;  4B8J A;  4G26 A;  4I9E A;  2PQR A;  2WXP A;  4DRX E;  2EIL E;  3ZU7 B;  2KCL A;  3PVL A;  2R5S A;  3V6Y A;  4AVX A;  3RRN B;  4JEU A;  1QNF A;  3NQP A;  4Q94 A;  3AAA C;  3WOY A;  1QQE A;  3MV2 B;  4CT7 B;  5EX0 A;  4J7W A;  3O4Z A;  3UI2 A;  3ZYM A;  2XCC A;  4EPZ A;  5FQ4 A;  4MRU A;  4XE0 A;  4I3N A;  1JCQ A;  3JUE A;  3DEP A;  2KXP C;  3EU5 A;  4MS6 A;  1ELK A;  2WXM A;  3E33 A;  1W9C A;  3Q7A A;  2C2L A;  2KCK A;  3FU6 A;  5EN5 D;  4G1T A;  4JHJ A;  1RW2 A;  3HHM A;  4WAF A;  3WYF C;  1FPP A;  4HRN A;  2QMR A;  1U3D A;  5KCM A;  3FHE A;  4UWF A;  2A5U A;  4KBQ A;  3ZIL A;  5H2W A;  1N4R A;  2BCT A;  2IAE B;  4A1S A;  1NFI E;  3ZXS A;  3DPD A;  1OYZ A;  2HR2 A;  4WNG A;  3ZFW A;  3ZIN A;  1SVX A;  4NAC A;  4KVO A;  2KC7 A;  2B6C A;  4GZC A;  4WND A;  4DBA A;  3JX7 A;  1MZC A;  4ACL A;  1E7V A;  4I1O B;  4AEZ C;  5HS0 A;  2KCV A;  2QFC A;  4G2V A;  2VSO E;  4LNU D;  4XX5 A;  2VJ8 A;  2DIW A;  5LOZ A;  4WWN A;  3FTU A;  2AWI A;  4U63 A;  3F6Q A;  1KPS B;  4V3R A;  1WAO 1;  4NQ0 A;  2XOA A;  1S70 B;  4LNG A;  3PUK A;  1K1A A;  1BLX B;  4CDM A;  4PLQ A;  1ZB1 A;  3T5X A;  4RG6 A;  1QBQ A;  1XQS A;  1XQR A;  3VLE A;  3BG1 B;  3UPV A;  3PE4 A;  1MQS A;  4B8A A;  4FU3 A;  5BT1 A;  3KAE A;  5HUY C;  3CHR A;  3SGH A;  3GRL A;  1QGR A;  4NIK A;  3W9G A;  4PLR A;  3JQ1 A;  4C9B B;  2LO6 A;  1HE8 A;  4U07 A;  3ND2 A;  4R7L A;  3SZ7 A;  3U3W A;  1NL4 A;  4GPK A;  4HXT A;  3PZ3 A;  2VGX B;  5LSW A;  3U4T A;  3FTW A;  1M8Z A;  4A3V A;  4ACK A;  4I6I A;  2ETB A;  2FUL A;  1PJM B;  2XCB A;  3BWT A;  4PS3 A;  4L7T A;  4DB6 A;  5BXU A;  4A55 A;  2L6J A;  5G04 C;  4ZHB A;  3SLA A;  2Z5J A;  2RU4 A;  4HB5 A;  4KZ0 A;  3U66 A;  3K7V A;  3LXU X;  4V3Q A;  3LTJ A;  5ARG A;  5DN7 A;  2VGY A;  1MHQ A;  1S0P A;  4OAV B;  1OY3 D;  3L82 A;  3V31 A;  3BX2 A;  3TAX A;  4GTO A;  1EJY I;  1OWP A;  1K8K G;  5D5K C;  2JKT B;  3CSF A;  2NYM B;  5B1B E;  4HRL A;  5AQ9 A;  3NB2 A;  3FUH A;  3TL5 A;  1JCR A;  2J8S D;  5FZQ A;  2GRN B;  2C1T A;  2FO7 A;  1EDU A;  1MX2 A;  4XI9 A;  3ZHE B;  3HXB A;  1ZU2 A;  4YGX A;  1OT8 A;  4B8O A;  1Z2C B;  4UAF B;  3NMZ A;  2MRI A;  4BET A;  3UM1 A;  2FF4 A;  2V8S E;  3Q15 A;  4BX9 A;  4A3T A;  4H3H A;  4U5N A;  4B8P A;  4OVV A;  2Y0B G;  2UY1 A;  1N94 A;  4DLO A;  1AWC B;  4GTS A;  3UTM A;  3WOZ A;  4MBG A;  3ISM C;  3ZN3 A;  3AJI A;  3CK7 A;  3SFZ A;  3L6A A;  4JW1 A;  4JZY A;  3GYZ A;  3T5V A;  3AS4 A;  3HXD A;  2XGM A;  1QZ7 A;  3L6Y A;  3UIN C;  4LRZ A;  2WXO A;  3OBV A;  4WNF A;  4Z68 A;  3TWT A;  4B8C B;  5EKG A;  4FZD A;  5KWD A;  2IQC A;  4JHK A;  3MKR A;  3PH0 C;  1WG0 A;  4MZ5 E;  5BPP A;  5E75 A;  5FZS A;  4L23 A;  4O6F A;  4P6Z B;  5ENP D;  5D66 A;  2NYL A;  5JJ6 A;  3FUD A;  2IFU A;  3QAQ A;  4BY6 A;  4GTP A;  2WTK A;  3CVW A;  4X8Q A;  3ZIO A;  3SQV A;  2YQ8 A;  2WXR A;  3MEK A;  4GPM A;  4JW2 B;  2V4H C;  4J8Y A;  3TG4 A;  4FP7 A;  3ZXP A;  4UI9 C;  4UUC A;  3CQG B;  4I7I A;  3L16 A;  5KL8 A;  1LRV A;  1EE4 A;  3VLF A;  3RAU A;  4F6R D;  1LD7 A;  1H6K A;  2L0T B;  2JKR B;  3KSQ A;  4HVB A;  2LUH A;  1HX8 A;  4I6G A;  3FUM A;  1IAL A;  3KD7 A;  5AQ7 A;  5CEA A;  4WWO A;  3UM3 A;  5KBA A;  2E0I A;  3U9W A;  1UPK A;  2Q5D A;  4RQI A;  3EHN A;  4IUL A;  3S7D A;  2I1J A;  4RVB A;  2F31 A;  3NOW A;  4CGW A;  2F8Y A;  4JKQ A;  4HNM A;  2LXL A;  3Q0S A;  4EZK A;  4DI4 A;  3C3O A;  4EVA A;  1TYQ G;  5LCW J;  4I43 A;  1H0A A;  5C1D A;  1N54 A;  3QG9 A;  1MYO A;  3E32 A;  2XEV A;  1L5J A;  1TNY A;  4XZR B;  4JEH A;  3ASF A;  3PST A;  5ENQ D;  5ENN A;  4PUC A;  5CLB A;  4C48 B;  3TGO A;  3I3N A;  4Y5J A;  3TJP A;  5ENR D;  3L6X A;  3NAW A;  4GTT A;  4V3O A;  4HQD A;  4F1S A;  2Z6H A;  3UX4 A;  3CV0 A;  2P9K G; 
#chains in the Genus database with same CATH homology
 1OUV A;  1QBK B;  3BSX A;  3EDT B;  3QGB A;  4AJW A;  1Q1S C;  2FBN A;  3FP3 A;  3HYM B;  1UPL A;  1WA5 B;  1NA3 A;  4FDD A;  3SI5 A;  3SF4 A;  2AVP A;  3SHF A;  4IMI A;  2ILR A;  3L13 A;  3LY7 A;  3D9N A;  3MZL B;  4I2Z A;  4YK6 A;  5CTT A;  3Q4A B;  5J90 A;  3CIA A;  4CCA A;  5CL3 A;  3I4G A;  3CVL A;  5T3R A;  3LKU A;  3FTX A;  4GCO A;  4I9C A;  1B3U A;  4MFU A;  4NZW A;  4J6I A;  1EPU A;  4QFV A;  3DBS A;  1E8W A;  4IYP A;  3TX7 A;  4KXK B;  4FAD A;  3ZIP A;  4K92 A;  3ZIK A;  5KJK A;  4IRU A;  1TJF A;  4CB8 A;  3U64 A;  1IQR A;  3URZ A;  5BNW A;  4J8D A;  3HDX A;  4B94 A;  1HO8 A;  3TT9 A;  2Q7F A;  1GW6 A;  2WXG A;  4I1M A;  1IQ1 C;  4GYW A;  3ZYL A;  2JDQ A;  1E8Y A;  4KMO A;  3LS8 A;  3GW4 A;  2MOW A;  3KEZ A;  4AY5 A;  3LDZ A;  2WQ6 A;  4RZP A;  2IE4 A;  2XGO A;  3RJV A;  2QNA A;  2L9B A;  1JDH A;  3NMW A;  3ZHP A;  4B0Z A;  2OVF A;  2VGL A;  2IX3 A;  2DBA A;  4AXH A;  4GMO A;  3QHE A;  4I5N A;  3R9A B;  4BTB A;  3QWV A;  2VSN A;  2J08 A;  3QNK A;  3RO2 A;  3HIZ A;  4H3K A;  3BG0 B;  3FUF A;  2ION A;  2XRZ A;  4GA2 A;  4Y6C A;  2XA7 B;  3Q49 B;  3ASH A;  3TJZ B;  3SNX A;  3B7R L;  4FLH A;  5AJD A;  4CT0 A;  3ZKV A;  4H7Y A;  3FU5 A;  3L3F X;  1PC2 A;  4DB8 A;  3TPM A;  2LSV A;  4B18 A;  3ONK A;  4CB9 A;  3ZW3 A;  5A23 A;  4P6Z G;  1YA0 A;  3MGB A;  4MZ6 E;  2WXF A;  3FU3 A;  3ENE A;  2UWJ G;  4WUY A;  3KND A;  2JLB A;  3T7U A;  3KS2 A;  4PH4 B;  2I2O A;  3B13 A;  2DCP A;  5G55 A;  3HVE A;  4BPL A;  5A7D B;  1JUQ A;  3CKC A;  1HF8 A;  4IMJ A;  3Q0O A;  2RG8 A;  3FTS A;  4HOU A;  2WXI A;  1EYH A;  3RRM B;  5AJL A;  4UQI B;  2XPI A;  1WM5 A;  3FGA B;  1PY1 A;  3FH8 A;  4XIF A;  4LEU A;  2I9C A;  1H2U A;  5LP0 A;  2DB0 A;  2LAI A;  2Y4U A;  1HU3 A;  2YNR A;  4JHR A;  4GAA A;  4N39 A;  3LPZ A;  3W3U A;  5CLC A;  3MJW A;  4KVM A;  3CVN A;  3AU4 A;  1Y8M A;  3TXN A;  3RU0 A;  2HYZ A;  3ZIR A;  2CG3 A;  3B7S A;  1DNP A;  5DIZ A;  3GNI A;  4I8M A;  4DB9 A;  3FUI A;  1JPL A;  3MKQ B;  1HXI A;  4CRW A;  3MCX A;  3APC A;  1Y6I A;  4AY6 A;  3FUN A;  1NA0 A;  5EDS A;  1JWG A;  3JY1 A;  3TG5 A;  3CVU A;  3K64 A;  2IAE A;  5CL4 A;  1V18 A;  4HM9 A;  3G2T A;  4R0Z A;  2WM9 A;  1XNF A;  4WWP A;  3I4R B;  3ODS A;  4XKC A;  5B56 A;  2LSU A;  5KJM A;  3IHY A;  3MV3 B;  2M63 A;  2HM8 A;  3ZYK A;  3LTM A;  2J07 A;  5CLA A;  3DAD A;  3FH5 A;  4U5L A;  4APO A;  4DVG B;  5LCW C;  4FHJ A;  3TJ3 A;  1H2V C;  5CLE A;  3GQ2 A;  3Q0R A;  4N2Q A;  4YVO A;  3VE6 A;  3QWP A;  3UMV A;  3OXF A;  3EIQ C;  4I6J A;  3CKB A;  3SD5 A;  1INZ A;  4HLE A;  2PL2 A;  3CVY A;  5CL5 A;  2YHC A;  1BPO A;  3RIB A;  5G05 J;  3BCT A;  5AEI A;  3APD A;  4I17 A;  2QK2 A;  4U0S A;  3D3M A;  4TNM A;  2X6K A;  4G23 A;  2IW3 A;  4D49 A;  5G2N A;  4D4E A;  5CL6 A;  1UJJ A;  3A6P A;  2VGX A;  2KZT B;  3IEG A;  3S7J A;  1I7W A;  4XKB A;  4PLS A;  4AIF A;  2NSZ A;  3UKW B;  3TPO A;  3Q0N A;  2OV8 A;  3IFQ A;  4R10 A;  1KT1 A;  4UAD A;  4KZG A;  4UQZ A;  2LNI A;  1A17 A;  3B7T A;  3APF A;  4CT4 A;  4HOR A;  5HUW C;  5E6Q B;  2AXU A;  4DPR A;  4LCT A;  3EBB A;  5LFA A;  1OWM A;  2JKT A;  4U5U A;  2NYM A;  3FUK A;  2W3C A;  3CEQ A;  4UQY A;  3E4B A;  4J8E A;  5AYW D;  4P29 A;  1Z3X A;  4DJS A;  3QC1 A;  3DW8 A;  3O2Q A;  1UN8 A;  3ZHE A;  4HOS A;  5T8I A;  2Y3A A;  1TEZ A;  2NPP B;  3ZGQ A;  4NEE A;  2XPZ A;  2XPY A;  3JCK C;  2PM7 A;  3CVV A;  3NZS A;  4I5L A;  2IF4 A;  4IN3 B;  3OUX A;  4GML A;  1E8Z A;  2WMN A;  1W63 B;  2KAT A;  3NF1 A;  3H3D X;  3VTY A;  3S7B A;  4DJA A;  4L4I A;  4A1G A;  4OYS A;  3BSB A;  5C2Y A;  1FCH A;  5JJA A;  3CHO A;  2CG2 A;  5EKQ D;  4B89 A;  1G3J A;  3PRZ A;  3QWW A;  2IE3 A;  2XGS A;  4CBA A;  3I5P A;  3JYS A;  2X19 B;  1UJK A;  4V3I A;  3BX3 A;  1OWN A;  4JL0 A;  1Q1T C;  3PS6 A;  3N71 A;  1XM9 A;  4U0Z A;  2MHK A;  4L7M A;  4U04 A;  4ATG A;  3TXM A;  5CL8 A;  2GW1 A;  2EQX A;  3NMX A;  4JW2 A;  4Y6W A;  4HXI A;  4I96 A;  4RG9 A;  4GCN A;  2VTB B;  3LEW A;  4I37 A;  3L22 A;  1GCJ A;  4MLP A;  4EQF A;  4CDN A;  3K4E A;  3GVT A;  3IKO B;  4AV7 A;  3GZS A;  3UQ3 A;  4ANU A;  2AXV A;  4JXT A;  2JKR A;  2BUG A;  1UW4 B;  3LY8 A;  2X3M A;  3RRU A;  3ZRH A;  2HO1 A;  3NZU A;  4TUU A;  4E85 A;  3FH7 A;  3C2H A;  2VSX E;  4FZA A;  3RO3 A;  2BNX A;  2CFZ A;  4CT6 B;  4K0R A;  4HOT A;  4ANX A;  4I1A A;  2C1M A;  4HS2 A;  4ABN A;  3G2U A;  5FTP A;  4LAC A;  4OO6 A;  4GA1 A;  1M5N S;  1E8X A;  4EVT A;  2JEK A;  4QMI A;  1SQM A;  3ONL A;  1BK6 A;  4BT9 A;  2BAP A;  2KM4 A;  1KT0 A;  2QK1 A;  3S7F A;  2CFU A;  1OWO A;  4EZL A;  1E96 B;  4I6E A;  2IOS A;  2X1G F;  3Q0Q A;  4QMJ A;  4UWG A;  5KLA A;  4TRQ A;  2WXQ A;  1PAQ A;  3IHV A;  5FT9 A;  2ZU6 B;  5DBK A;  3RK6 A;  3QML C;  3FTZ A;  3ZYQ A;  1HH8 A;  5SVZ A;  3CQC B;  3FUE A;  3BVS A;  4F3V A;  3LVQ E;  5BZV A;  2C0M A;  3K9I A;  4N3C A;  3WXX A;  3LVR E;  3RZX A;  3CK8 A;  1VDY A;  3O48 A;  4OIH A;  2CHZ A;  4CRU B;  4E6H A;  3FUJ A;  3G2S A;  4FQ3 A;  5FC8 E;  3VTX A;  1IB2 A;  3MYV A;  2YNS A;  4FLB A;  3AU3 A;  4D10 C;  2OND A;  4DLQ A;  3UKX B;  3G2W A;  2X6J A;  1UG3 A;  2X6I A;  3S2A A;  2YNQ A;  3O4X A;  2WXJ A;  2GL7 A;  3EA5 B;  4PS8 A;  1JWF A;  2PF4 A;  5HI7 A;  2XHE A;  3Q5M A;  3EJN A;  5H2X A;  1IYG A;  4WNE A;  5BW8 C;  5KLR B;  1QZ2 A;  4JPS A;  3IBV A;  4RXH B;  3UT4 A;  4FFB C;  1Z6T A;  4U0U A;  4BTA A;  3OQS A;  3JXY A;  2X38 A;  3CLJ A;  1N52 A;  2LAH A;  2V5F A;  3PRE A;  5CMY A;  1B89 A;  1ZBP A;  5BZ5 A;  3K5Y A;  3UKZ B;  3D9K A;  4KZC A;  4U5O A;  5CCM A;  4KYO B;  4YI0 C;  3QK0 A;  4N5C A;  2XA7 A;  2IJG X;  4E4V A;  3RKV A;  2WQH A;  5AIJ A;  2NXP A;  5LX8 A;  5JHA A;  4K6J A;  3CK9 A;  5FZR A;  4L2Y A;  1FVF A;  2WXH A;  5CL7 A;  4NRH B;  5J3V A;  1E7U A;  2V4L A;  3FY4 A;  2X6H A;  4UWH A;  1I7X A;  2WXN A;  4XZ4 A;  1HG2 A;  2FEZ A;  1IQU A;  4C0M A;  3GS3 A;  4U8H A;  1P5Q A;  2L0I A;  2Z5K A;  4FJY A;  3CR3 A;  4YJL A;  2BTD A;  4J0U A;  3FU0 A;  4N3A A;  5EKF A;  1TJC A;  5J08 A;  4U5S A;  5FQ6 A;  4ANV A;  3T8M A;  3CHP A;  4U5V A;  5BV1 A;  3GAE A;  3P1U A;  4UQI A;  5K6S A;  3Q47 B;  5EWP A;  3L54 A;  3FGA A;  4G25 A;  2WXL A;  1OWL A;  4BSX A;  1U3C A;  5BUZ A;  5ANL A;  3UUX A;  3IV0 A;  2VSY A;  3C2G A;  4GYO A;  1HS6 A;  3ULQ A;  1UN0 A;  3BTR C;  5SW9 A;  4L2L A;  3OTN A;  4QMH A;  4J8F A;  3GVO A;  1BK5 A;  3SBS A;  4UI9 K;  3ML9 A;  4UQX A;  2YHE A;  3L17 A;  3MKQ A;  3VLD A;  4ADY A;  3QJZ A;  4LER A;  5FWQ A;  4GMN A;  3AU5 A;  4GB9 A;  2WPV A;  4CRV B;  5KLT B;  4CV5 B;  5CHE E;  2PQN A;  1LF8 A;  1H19 A;  2RU4 B;  3P2B A;  2Y4T A;  5M72 A;  1W3B A;  4UWK A;  4ILI A;  5KL1 A;  1H2T C;  4FJZ A;  4JVS A;  3CST A;  4G24 A;  5CMW A;  4APF A;  3UT8 A;  5K9S A;  1E90 A;  2YIN A;  3EHM A;  4EV9 A;  1LUJ A;  3FTY A;  4HTV A;  4JC8 A;  3G2V A;  3QB2 A;  4GZ5 A;  3FEY C;  1U6G C;  5ARF A;  2AXZ A;  3FEX A;  1WA5 C;  4OVU A;  3Q0M A;  3Q5U A;  3CHQ A;  4NUR A;  4N3B A;  1NP7 A;  3OXL A;  4CDR A;  2Z5O A;  3PZD A;  1QGK A;  3LYA A;  4F53 A;  2X6F A;  5JJ7 A;  2P8Q A;  4GZD A;  2UY1 B;  1HFA A;  4Q96 A;  5CL9 A;  3SL9 A;  3JXZ A;  4DI3 A;  4FHK A;  3FFL A;  3QDN A;  1WY6 A;  3K61 A;  3MX3 A;  4RV1 A;  4A0C A;  3K49 A;  4Q69 A;  4TV3 A;  4EBA G;  3D9L A;  4BA3 A;  4PDX A;  5EX3 A;  1TE4 A;  2KZT A;  2J09 A;  5BV0 A;  2OF3 A;  3UL1 B;  2J4D A;  2NYL B;  4LUN U;  3PUJ A;  4L4H A;  3LWW A;  3QAR A;  4ME2 A;  4JLQ A;  5JJT A;  4I2S A;  2OVB A;  3PEU B;  2P58 C;  3FTV A;  1F59 A;  4UWL A;  4AP2 A;  4BFR A;  4UWX A;  4GZ6 A;  4XI0 A;  3PDN A;  3L08 A;  2GRL A;  1M8Y A;  5KJN A;  1IBR B;  1O6P A;  4AM9 A;  2AW6 A;  3CHS A;  3UVU A;  2NC9 A;  4BQK A;  3CHM A;  2VQ2 A;  4FUL A;  1IHG A;  2GGF A;  2I6H A;  3QOU A;  3CVP A;  4RSY A;  5JHB A;  2WQ7 A;  1HZ4 A;  2NPP A;  3PE3 A;  3O2S A;  4J8S A;  2J4B A;  4I1E A;  3JQ0 A;  4AOF A;  3OPB A;  1W63 A;  3V71 A;  4MKT A;  3PNL B;  3GZ1 A;  2Z5M A;  1XGW A;  4F7A A;  4GYY A;  2J49 A;  4U58 A;  3ZVV A;  4U3J C;  1TH1 A;  5HQ8 A;  4EV8 A;  1Z3Y A;  4C0E A;  4YJE A;  1PJN B;  1NZN A;  3ZIM A;  3PSP A;  5BYM A;  1SZ9 A;  2QY7 A;  2R59 A;  2PZI A;  3SBT B;  4GZ3 A;  3D9O A;  3FWV A;  4L1B A;  3OXG A;  4BT8 A;  2C0L A;  1ELW A;  4JA7 A;  2PM6 A;  3FUL A;  3C5W A;  4ILG A;  4U54 A;  2YJY A;  2V0P A;  1T08 A;  2CHW A;  4JW3 C;  3QKY A;  5FQ8 A;  2IWH A;  4HOQ A;  4I0Y A;  2H4M A;  2WB2 A;  5G04 J;  4FA6 A;  2VTB A;  3PNT B;  4EEC A;  3R7Q A;  2Z5N A;  3BEE A;  3GB8 A;  4ANW A;  1KLX A;  1EE5 A;  5E76 A;  5FJY A;  5KUB A;  5HHG E;  2BKU B;  3OUW A;  3K7W A;  3VWA A;  3K5Z A;  5BZU A;  5SWF A;  3MA5 A;  3ODR A;  1O6O A;  5KJL A;  3Q0L A;  4O27 A;  3GZ2 A;  3K62 A;  4JA9 A;  3UL0 B;  2CHX A;  4BWR A;  3ML8 A;  3QGC A;  4N2S A;  3ZIQ A;  2A4Z A;  3O2T A;  2WXK A;  2XQ0 A;  3OAW A;  2E2E A;  1SZA A;  4H7X A;  3FEY A;  2FI7 A;  1X5B A;  3D9I A;  1FVH A;  2I1K A;  1HG5 A;  3FDH A;  5CLD A;  4BX8 A;  4KT6 B;  1Y2A C;  4EZJ A;  3EIJ A;  1EF1 C;  5T4Y A;  1JPP A;  1EJL I;  4GMJ A;  3CVQ A;  2VYI A;  4EVP A;  3LJ3 A;  3AS5 A;  1ELR A;  4CEM A;  4GU5 A;  5A6C A;  4PVZ A;  5CCL A;  3CVX A;  3FEX C;  4DZS A;  3D9M A;  4G3A A;  3IBE A;  5BZ1 A;  2XRY A;  2VGL B;  3EG5 B;  2PKG A;  3ASD A;  3ASG A;  4I2W A;  4WV6 A;  4U2X D;  4URK A;  3D9J A;  5AEN A;  4CGV A;  4G11 A;  1M8W A;  3LCA A;  2R17 C;  3CGH A;  2IOL A;  2BF0 X;  4YVQ C;  3R7R A;  2RD0 A;  3JUI A;  1UN9 A;  3ZEF A;  4DK5 A;  3UT7 A;  4K03 A;  3D9P A;  2GRM A;  4HFG A;  3ZPJ A;  4UAE A;  5D0O D;  1JPW A;  5G05 C;  3K5Q A;  2Z6G A;  2WVI A;  3PEV B;  1UKL A;  2J9Q A;  2JAK A;  3RZ9 A;  3C98 A;  4UI9 J;  5D0Q D;  3AS8 A;  4M3O A;  3HVE B;  3B7U X;  4GA0 A;  2OT8 A;  3Q0P A;  2IU1 A;  5ANR A;  2FV2 A;  4ZDU A;  2WMO A;  5FQ7 A;  1M8X A;  3UKY B;  4FZF A;  4YND A;  3WPT A;  4MFV A;  1DVP A;  3V74 A;  4PS7 A;  4R11 A;  3LY9 A;  4EBA A;  3L3Q A;  3ESL A;  4W9R A;  4FC8 A;  1M1E A;  3ESK A;  4ILH B;  2OOE A;  4B8J A;  4G26 A;  4I9E A;  2PQR A;  2WXP A;  2KCL A;  3PVL A;  2R5S A;  3V6Y A;  4AVX A;  3RRN B;  4JEU A;  1QNF A;  3NQP A;  4Q94 A;  3WOY A;  1QQE A;  3MV2 B;  4CT7 B;  5EX0 A;  3O4Z A;  3ZYM A;  2XCC A;  4EPZ A;  5FQ4 A;  4MRU A;  4XE0 A;  4I3N A;  4MS6 A;  1ELK A;  2WXM A;  1W9C A;  2C2L A;  2KCK A;  3FU6 A;  4G1T A;  4JHJ A;  3HHM A;  4WAF A;  3WYF C;  2QMR A;  1U3D A;  5KCM A;  3FHE A;  4UWF A;  2A5U A;  4KBQ A;  3ZIL A;  5H2W A;  2BCT A;  2IAE B;  4A1S A;  3ZXS A;  3DPD A;  1OYZ A;  2HR2 A;  4WNG A;  3ZFW A;  3ZIN A;  4NAC A;  4KVO A;  2KC7 A;  4GZC A;  4WND A;  4DBA A;  3JX7 A;  4ACL A;  1E7V A;  4I1O B;  4AEZ C;  2KCV A;  2QFC A;  4G2V A;  2VSO E;  4XX5 A;  2VJ8 A;  2DIW A;  5LOZ A;  4WWN A;  3FTU A;  2AWI A;  4U63 A;  4V3R A;  1WAO 1;  4NQ0 A;  2XOA A;  3PUK A;  4CDM A;  4PLQ A;  3T5X A;  4RG6 A;  1XQS A;  1XQR A;  3VLE A;  3BG1 B;  3UPV A;  3PE4 A;  1MQS A;  4B8A A;  4FU3 A;  5BT1 A;  3KAE A;  5HUY C;  3CHR A;  3SGH A;  3GRL A;  1QGR A;  4PLR A;  3JQ1 A;  4C9B B;  2LO6 A;  1HE8 A;  4U07 A;  3ND2 A;  4R7L A;  3SZ7 A;  3U3W A;  4GPK A;  4HXT A;  2VGX B;  5LSW A;  3U4T A;  3FTW A;  1M8Z A;  4A3V A;  4ACK A;  4I6I A;  2FUL A;  1PJM B;  2XCB A;  3BWT A;  4PS3 A;  4L7T A;  4DB6 A;  4A55 A;  2L6J A;  5G04 C;  3SLA A;  2Z5J A;  2RU4 A;  4KZ0 A;  3U66 A;  3K7V A;  3LXU X;  4V3Q A;  3LTJ A;  5ARG A;  5DN7 A;  2VGY A;  1MHQ A;  1S0P A;  3BX2 A;  3TAX A;  1EJY I;  1OWP A;  5D5K C;  2JKT B;  3CSF A;  2NYM B;  3FUH A;  3TL5 A;  5FZQ A;  2C1T A;  2FO7 A;  1EDU A;  4XI9 A;  3ZHE B;  1ZU2 A;  4YGX A;  4B8O A;  1Z2C B;  4UAF B;  3NMZ A;  2MRI A;  2FF4 A;  2V8S E;  3Q15 A;  4BX9 A;  4A3T A;  4H3H A;  4U5N A;  4B8P A;  4OVV A;  2UY1 A;  4DLO A;  3WOZ A;  3ZN3 A;  3CK7 A;  3SFZ A;  3L6A A;  4JW1 A;  4JZY A;  3GYZ A;  3T5V A;  3AS4 A;  2XGM A;  1QZ7 A;  3L6Y A;  4LRZ A;  2WXO A;  3OBV A;  4WNF A;  4B8C B;  5EKG A;  4FZD A;  2IQC A;  4JHK A;  3MKR A;  3PH0 C;  4MZ5 E;  5BPP A;  5E75 A;  5FZS A;  4L23 A;  4O6F A;  4P6Z B;  5JJ6 A;  2NYL A;  3FUD A;  2IFU A;  3QAQ A;  4BY6 A;  2WTK A;  3CVW A;  3ZIO A;  2YQ8 A;  2WXR A;  3MEK A;  4JW2 B;  3TG4 A;  4FP7 A;  4UI9 C;  3CQG B;  4I7I A;  3L16 A;  5KL8 A;  1LRV A;  1EE4 A;  3VLF A;  1H6K A;  2L0T B;  2JKR B;  4HVB A;  1HX8 A;  4I6G A;  3FUM A;  1IAL A;  3KD7 A;  4WWO A;  2E0I A;  3U9W A;  1UPK A;  2Q5D A;  3EHN A;  4IUL A;  3S7D A;  2I1J A;  4RVB A;  2F31 A;  3NOW A;  4CGW A;  4JKQ A;  4HNM A;  3Q0S A;  4EZK A;  4DI4 A;  4EVA A;  5LCW J;  4I43 A;  1H0A A;  5C1D A;  1N54 A;  3QG9 A;  2XEV A;  1L5J A;  4XZR B;  4JEH A;  3ASF A;  3PST A;  5ENN A;  4PUC A;  5CLB A;  3TGO A;  3I3N A;  4Y5J A;  3TJP A;  3L6X A;  4V3O A;  4F1S A;  2Z6H A;  3UX4 A;  3CV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...