3VLEA

Crystal structure of yeast proteasome interacting protein
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
456
structure length
435
Chain Sequence
NLLTQLENELNEDTLLRKCSLNLVTVMDVKPLLATIKRFLTSDYLLDVVDKLVPMADFDDVLEVYSAEDLVKALRSEIDPLKVAACRVIENSQPKGLFATSNIIDILLDILFDEKVENDKLITAIEKALERLSTDELIRRRLFDNNLPYLVSVKGRMETVSFVRLIDFLTIEFQFISGPEFKDIIFCFTKEEILKSVEDILVFIELVNYYTKFLLEIRNQDKYWALRHVKKILPVFAQLFEDTENYPDVRAFSTNCLLQLFAEVSRIEEDEYSLFKTMDKDSLKIGSEAKLITEWLELINPQYLVKYHKDVVENYFHVSGYSIGMLRNLSADEECFNAIRNKFSAEIVLRLPYLEQMQVVETLTRYEYTSKFLLNEMPKVMGSLIGDGSAGAIIDLETVHYRNSALRNLLDKGEEKLSVWYEPLLREYSKAVNGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for specific recognition of Rpt1, an ATPase subunit of the 26S proteasome, by a proteasome-dedicated chaperone Hsm3
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords DNA mismatch repair protein HSM3
total genus 167
structure length 435
sequence length 456
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18794 HSM3_C DNA mismatch repair protein HSM3, C terminal domain
A PF18795 HSM3_N DNA mismatch repair protein HSM3, N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.50 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 3vleA01
1.25.40.580 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3vleA02
3VLEA 4A3TA 4FP7A 4A3VA 3VLDA 3VLFA
chains in the Genus database with same CATH superfamily
4DX5D 1BU9A 5K9SA 4EV8A 4TRQA 3SHFA 3K5QA 4EQFA 3IBEA 5T3RA 3LS8A 3DW8A 1IALA 1Z2CB 2CHWA 5BV0A 4GAAA 2AXVA 4HOSA 4QMHA 3NZSA 3V31A 3HG0D 2P2CP 1N9AA 3QNKA 3OQSA 1BI7B 4H3HA 3O2QA 3LYAA 5E75A 4HNMA 3UQ3A 4EECA 4CDRA 1JCRA 3UM2A 2GROB 3PZ2A 5G55A 5CERB 3SLAA 3R7QA 2LUHA 4XI0A 3T8KA 4AIFA 3HHMA 3UJ0A 4AY5A 2AWIA 4I2ZA 2IY0C 3MV3B 2VJ8A 3HRAA 1X81A 3GS3A 3OUXA 2MOWA 3ASHA 2J09A 3VLDA 2YHCA 4KYOB 3QMLC 5CL4A 4Q69A 4I6IA 3T5VA 2XCBA 4GZ3A 1FT1A 2X3MA 3R9MA 4CT4A 1E8YA 3PNLB 2GW1A 3JQ0A 3O48A 4V3QA 4BSZB 2Z5OA 5ANLA 2NXPA 2VQ2A 1OWNA 2DVWA 3QG9A 3LPZA 3SNXA 4U54A 4DZSA 4YDYA 3FHEA 2CFUA 4PLRA 3AJIA 1SW6A 2WXKA 1IKND 3TG5A 3EU5A 2IOSA 3C72A 2V5QC 3ZHEA 2W3CA 4GMLA 5DIZA 3TWSA 1OCRE 2Z5NA 4GYYA 4CB8A 2L0IA 3CSFA 3PVLA 3AU4A 3AG3E 5G2NA 3DXKG 3U64A 3CVNA 1OWMA 3Q78A 4UAEA 4L4HA 3VWAA 4JA7A 5CLAA 3SBTB 4GCOA 2KCLA 3APCA 2IO3C 4CGWA 2A5UA 3K5ZA 1LD8A 1D8DA 4ATZD 3KSQA 4GZDA 4FZDA 3GB8A 3EJNA 3L16A 2UWJG 3TJPA 4HBDA 4B93B 4GTPA 3MV2B 2HR2A 1OYZA 3K5YA 2MYOA 3QWWA 5JHBA 2P9KG 3CIAA 5CLBA 3RRNB 4F53A 3VTXA 4A55A 5E6QB 4I0YA 2Z5JA 1UG3A 3K62A 5EKQD 3OAWA 4L7MA 4I8MA 3TWUA 4UI9K 5CCLA 4GTOA 4UQZA 4U8YD 3P2BA 2BCTA 4PUCA 1N4PA 1UN8A 2PNNA 1NL4A 2Z6GA 3LY8A 4F1SA 3AS4A 5G05C 3FEXC 4NURA 1JPPA 2XGMA 1HE8A 3WPTA 5AN8A 3JY1A 3RO2A 2UY1A 2IE4A 3ASFA 1UOHA 4G26A 3B7RL 4PH4B 3URZA 5CL7A 3HDXA 2P58C 2WXNA 1UPLA 5CLCA 3QWVA 4V3RA 4XKCA 1FPPA 1HX8A 4I7IA 5EIDA 1G3JA 4BEPA 4MKTA 3A6PA 1N4SA 4PS8A 2FO1E 3FGAA 1BK6A 1WM5A 3EU9A 4EZJA 3ZIPA 2Z5MA 4R11A 3BUAA 1XQRA 2Z6HA 5AQAA 3PSTA 4L23A 2ZISA 4BWRA 1BPOA 4YJLA 3TJZB 5H2WA 2NYLA 1HG2A 4NQ0A 1U6GC 4B8PA 4C48B 3LCAA 3ZYQA 3CQGB 4ILIA 3UJ4A 2E0IA 3L82A 4FULA 1H0AA 2WXLA 4XEIG 3K61A 1U3DA 2A4ZA 5C1DA 1D9SA 3ML8A 3FEXA 1TN7A 2R03A 4B8AA 5CBNA 4BT8A 1OCZE 3ZILA 1FCHA 3VTYA 4JHKA 2LAIA 3ZKJA 3G2SA 1KT0A 3ASNE 1MJ0A 2ZGDA 2EIKE 4DPRA 3Q5UA 2NPPA 2WXQA 4EVTA 4U8VD 2OCCE 4Y6WA 2XS8A 4GU5A 1KPSB 1QGKA 2HYZA 2XHEA 1N4RA 3SBSA 4C9BB 1E96B 4LRZA 3LWWA 1M8ZA 3LDZA 1T08A 5EKGA 4BT9A 2Y3AA 4CDNA 4LACA 5BZ5A 4B8CB 4GA1A 5CEDB 2J4BA 5G04C 3PDNA 3BG1B 4YNDA 2P9PG 2WXRA 4O27A 5CL6A 1E7VA 5EN5D 3PEVB 3GW4A 2P9LG 4B18A 2R2LA 1U2VG 3SO8A 4FC8A 3FULA 4TUUA 1H2UA 2J49A 1TN8A 3FTWA 5ENPD 3DSTA 2F31A 2L0TB 2PQRA 3OUWA 5KCMA 4RG6A 3NB2A 1MX4A 3NMZA 3UINC 5FIOA 2RFAA 1WG0A 4DB6A 1NP7A 3LXUX 4R0ZA 4IMIA 1NA0A 2AXUA 2B0OE 2HM8A 4NACA 2XPYA 2WXIA 4UI9C 1SZ9A 3Q0RA 1HO8A 4BQKA 5AENA 2JEKA 2VSNA 4LG6A 2PM6A 3S7BA 3FUIA 2ZXWE 2XRYA 4JL0A 3D9HA 4BTBA 3ZPJA 4UQYA 5EYPF 2BAPA 2WXJA 1BK5A 2IJGX 4UUCA 3CEQA 3MKQB 1K8KG 3ABLE 3PNTB 5EKFA 1Y8MA 3C3QA 3UVUA 4H3KA 1DVPA 3CVPA 3PZ3A 1MHQA 4JW2A 2M63A 3RIBA 2KC7A 5HS0A 4QQIA 1YA0A 3SFXA 3JXJA 2XCCA 1HZ4A 3Q0QA 1K1AA 4WWNA 3NOGD 3BVSA 2GRNB 3ZXSA 1TNBA 3MA5A 3QDNA 4YVOA 3QOUA 3KNDA 3V79K 4MZ6E 4A63B 3DSVA 5HI7A 2C2LA 3CHMA 2GL7A 4P6ZG 3D9JA 3MYVA 4NIKA 4ANWA 5KLTB 4BSXA 4YI0C 3UKWB 4WNEA 3GZSA 3FTZA 1QGRA 4U5LA 5KUBA 4ME2A 2CHZA 5BZ1A 3Q0SA 1XNFA 3RSEG 4BFRA 1MQSA 2I9CA 3Q0OA 2BEDA 4F6RD 5AARA 2LSVA 3K4EA 3SI5A 3IKOB 1B89A 2ZIRA 4N2SA 3UKRG 2NYLB 3APFA 2GRQB 3UKXB 2P9IG 3G2UA 1JCSA 2VSOE 3GAEA 5ENTD 4FHKA 1WAO1 5JJ7A 1O6OA 3Q7FA 4LNBA 2DBAA 2KXPC 3CHRA 4YVQC 4U0UA 2Y4TA 3BWTA 4CT6B 5HUYC 4ACLA 5B3SE 1D8EA 2ETBA 1TE4A 4EBAG 5CEAA 4L2YA 3VE6A 1B3UA 4B8OA 4HM9A 4GZ5A 2RU4B 3LVRE 4ZFHA 3E4BA 1LSHA 2YNRA 3BG0B 1AWCB 3ZIQA 4XZ4A 2LNIA 3L6AA 4OYSA 2CHXA 4Q94A 3L22A 4I6EA 1LF8A 1S0PA 4PDXA 4RQIA 2QK1A 2LXMA 4Z68A 4A3VA 3W3UA 4U8HA 3IHYA 2QFCA 2PF4A 2XPIA 2EQXA 5KLAA 1S64A 2FO7A 4DB8A 2EIME 3V2XA 1TNUA 3Q15A 3JQ1A 4DBAA 4G24A 1PY1A 5CECB 4MRUA 2QYJA 2WTKA 3QAQA 1PJNB 4XE0A 5ENRD 2OOEA 4MZ5E 4GMNA 2VGXB 4BETA 1FVHA 2YQ8A 4APFA 3MJWA 5T8IA 4HFGA 3K64A 4C0MA 3NAWA 2QC9A 5AJLA 2QK2A 4B8JA 1QZ7A 1Q1SC 1JCQA 3Q0NA 2AVPA 3Q49B 1LUJA 4W9RA 3Q4AB 2FI7A 2VGXA 3S2AA 1M1EA 4DJAA 4AV7A 4U63A 1IQ1C 5CL5A 5JMND 2XOAA 2WXPA 3O2SA 2OF3A 2IU1A 3MZLB 2WXHA 4OO6A 2FV2A 2JKRB 4YJEA 4MS6A 3Q0MA 2RU4A 3U3WA 4GTMA 2YNSA 2OVFA 2WXMA 3B7BA 2VTBA 3CVUA 4U7EB 2XEEA 2JDQA 3ULEG 1IBRB 1EYHA 3AG1E 3ONLA 4A1SA 5DN7A 3OPBA 3TPOA 3AG2E 4DVGB 5LSWA 3L17A 3SZ7A 1N0QA 2CG3A 4PLSA 1I7WA 2EIJE 1N4KA 4YGXA 2X6FA 1UW4B 4DUIA 4J8FA 3UT7A 4YDWA 3PZDA 4MBGA 4I96A 2NYMB 1H6OA 3C3RA 4ATGA 5BNWA 2IAEB 5EYLA 4HOQA 4GTRA 1N94A 4GTQA 3CKCA 3JUEA 3ASGA 3K7WA 1IB2A 5CBOA 1OUVA 5EIBE 3APDA 2GRMA 5JA4D 5ARGA 3UKYB 3AS5A 3BQOA 4K5BA 3EBBA 5CL9A 3QGBA 5DBKA 4GPKA 3KEZA 3NQPA 2DCPA 5AQ9A 1ELRA 3G2TA 1Z5SC 1IXVA 3DBSA 3DEOA 1N52A 2KM4A 2WMNA 1SA4A 2KBXA 3QHEA 3TG4A 4BTAA 3CVXA 3AU3A 4HORA 2C0MA 5C2YA 1WA5B 1H2TC 2KCVA 4J8EA 4DLOA 3ZIMA 4EVAA 3V71A 4I9CA 3UM1A 4O6FA 3DSSA 2WPVA 2CG2A 4CT0A 3I3NA 5BXOA 4I37A 3C3OA 3ZRHA 2B6CA 1W3BA 3LY7A 3LJ3A 2BKKB 2JKTA 4CZ2D 3TWTA 4HOTA 4TV3A 1S70B 4J7WA 5BUZA 3IV0A 5CLEA 3UUXA 4I9EA 4DB9A 3K9IA 4MFVA 2IW3A 3RZXA 2ETAA 2DWZA 1O6PA 3SFZA 3ESLA 2X6JA 5BXUA 4N3BA 1TNOA 4HTVA 4U5OA 3RAUA 3UTMA 3C2HA 3CHSA 3HVEB 4DI3A 4V3OA 3ULQA 1SQMA 3V6YA 4HXTA 3BU8A 2I6HA 3W9FA 3H3DX 4RSYA 1HF8A 4I17A 4AY6A 1FVFA 2QY7A 3B95A 2MRIA 5CRUA 3PREA 3RZ9A 4UQIA 3I4RB 1SA5A 5FZSA 2GRPB 5AYWD 4HLEA 4WNGA 2WXOA 5G05J 3PRZA 4LNGA 4N5CA 1DCQA 3FTXA 3FU3A 4KT6B 3DSXA 2DYSE 1ZU2A 3PZ4A 3TAXA 2IOLA 5LFAA 4YDOA 3DRAA 1MYOA 4BX8A 4G2VA 3FUEA 4U0ZA 5KL1A 2X19B 4TXRA 2ETCA 1JWGA 3LEWA 5BZVA 3CHQA 4L9PA 2C1MA 3B13A 5EX0A 3QB2A 2IEJA 1A17A 4ZDUA 3TXMA 2R02A 4XI9A 5A7DB 1MZCA 4OVVA 4UWXA 3SGHA 3HXCA 4FU3A 2XEHA 1H6KA 3L6XA 4FDDA 3FH8A 4H7XA 4ACKA 4JKQA 3GRLA 1PC2A 5KL8A 4D49A 4JW1A 1F59A 2R5SA 4JC8A 5FT9A 3K49A 1MX6A 4KVOA 1OY3D 4G1TA 4QMJA 5BZUA 5KJMA 4I5LA 3Q7AA 4F1PA 4Y6CA 2VSYA 4I6GA 3TWXA 4FJZA 4ZHBA 3GVOA 1HFAA 2FBNA 2NPPB 1GCJA 3QGCA 3ESKA 5AQ7A 4FA6A 3RO3A 2DB0A 2P9NG 2F8YA 2Y69E 3OXLA 4HVBA 2F37A 3CK7A 4WUYA 2RD0A 3QC1A 2BUGA 4IN3B 3L54A 5B1AE 4L1BA 3BX3A 2H6GA 1KLXA 4I1EA 3BSXA 2XGSA 2V4HC 3OTNA 2H6HA 4UWFA 5ENOD 1EE4A 5AAOA 2PL2A 3JXYA 1Z6TA 4F3VA 1EE5A 1XQSA 3L6YA 4KZGA 4WWPA 2WXGA 4UAFB 3UIPC 2R05A 5KWDA 1VDYA 2RFMA 4F7AA 3PSPA 1WA5C 3FGAB 4I2SA 3SL9A 3CHOA 2IX3A 3SFYA 3EUVA 4O60A 4XKBA 2XQ0A 4CRUB 4NRHB 5J3VA 1OWOA 3BSBA 3ZNGA 1OWLA 1TYQG 4N3CA 2IWHA 3ZEFA 3FTUA 5ARFA 3EHQA 2YINA 4E4VA 5BT1A 4OAVB 3FP3A 4M3OA 5FWQA 2E2EA 3FFLA 3ASDA 4BY6A 3PUKA 3NZUA 4BA3A 3DSWA 5FQ8A 4X8QA 5JHAA 2J08A 3FU6A 4G25A 2XS1A 4DLQA 4HRLA 2UY1B 4I1MA 4K03A 4EBAA 3ML9A 5HUWC 4PLQA 2FULA 3JCKC 3DPYA 1TN6A 2V0PA 3RK6A 1EF1C 1NA3A 4XZRB 5FINA 5AQBA 2IE3A 4I3NA 5SVZA 2NSZA 3JX7A 3LJNA 1H19A 4JB8P 3D9OA 4L7TA 5FC8E 3UX4A 4EZLA 3FU5A 4MFUA 1XGWA 3TX7A 5ENQD 4CB9A 1X5BA 4HOUA 2CFZA 4KXKB 1OWPA 4RG9A 4IYPA 4UI9J 2VGEA 4UWKA 4CRVB 1BI8B 5B1BE 1WDYA 5CMYA 1WY6A 3TWRA 1HG5A 1TH1A 1W63B 2GRLA 4O1OA 4G11A 4DRXE 4HXIA 3TJ3A 3UL1B 4LNUD 3ZINA 3ABME 3MX3A 3DPDA 3L3QA 3FUDA 3FY4A 3T8MA 1S63A 2V5FA 2NYMA 3ODRA 2AJAA 2YHEA 4NEEA 3TGOA 4QFVA 4BERA 3D9KA 4TXPA 4U0SA 4PS3A 4I1OB 5ENSD 2Q5DA 1N11A 4BX9A 4RV1A 4KMOA 1BD8A 4GTTA 1UPKA 4CRWA 1LTXA 3UM0A 2P8QA 4Y5JA 3Q79A 3G2VA 5LX8A 4CT7B 1PAQA 1Y2AC 4N5QA 4EPZA 2FF4A 1E8WA 3C98A 1OCOE 3T9KA 4L4IA 3LVQE 3GZ2A 5T4YA 4CDMA 5FQ4A 3BX2A 5J08A 3FH7A 2HO1A 1M8XA 3L9TA 3KAEA 2H4MA 2RG8A 5HKPA 4AEZC 3UMVA 1DCEA 4DJSA 3B7UX 3B7SA 3DSUA 2EINE 2WXFA 3J5QB 4KBQA 3OXGA 4G8KA 3FUKA 2R59A 2J4DA 2PM7A 3QKYA 4ANVA 1EJLI 1N4QA 1Z3XA 3FDHA 2Y1LE 4U07A 2VSXE 2R17C 1IHBA 1UJJA 4ANXA 4K92A 4JHRA 4P6ZB 4A0CA 2DZNA 3UM3A 4HRMB 2BKGA 4HRNA 5BPPA 1V18A 4APOA 3OBVA 3FUNA 5CL8A 5D66A 3SQVA 3E33A 5H2XA 4FZFA 4LSZE 3RRMB 3MEKA 4A3TA 5A6CA 1O1RA 1G3NB 1K3ZD 1SZAA 3S7JA 4B0ZA 1QQEA 3D9LA 4GZCA 4GTVA 4RLYA 3ZHEB 1U3CA 3CHPA 3SY2A 2OEVA 1RZ4A 2H6IA 4WNFA 4U5VA 2OV8A 4WV6A 3CV0A 1OCCE 3HIZA 4KZ0A 3GZ1A 4CYMD 3CK9A 5D2MC 4FFBC 2C0LA 1E7UA 2XEVA 3Q75A 3IFQA 2I2OA 3NOCD 3Q47B 4FJYA 1A5EA 1JUQA 1EPUA 4JD2G 4U96D 2FEZA 1IHGA 4KZCA 4DX7D 2KZTB 3PH0C 4JZYA 2AXZA 2EILE 2DYRE 2ILRA 4JEHA 1E8XA 5FJYA 1GW6A 3K7VA 2MHKA 2XA7A 3CLJA 3RU0A 3TWVA 3FUHA 4GYWA 3GNIA 3NMXA 4PVZA 3J5PA 1E90A 3HXFA 2OT8A 4K0RA 5LP0A 1UN0A 3DWLG 4HI9A 1V55E 3R7RA 5CCMA 4OIHA 4HS2A 1ZB1A 3VLFA 3F6QA 3EIQC 4JEUA 2WM9A 3CK8A 1YCSB 1FT2A 3PE4A 3GQ2A 4JA9A 1DNPA 5IY5E 3QK0A 2XENA 1NFIE 3FUJA 2WQ7A 3JXZA 3PUJA 3UT8A 3N71A 2IONA 2XZDG 3FEYC 1TR4A 3ZGQA 3EHRA 5BYMA 4HLLA 4FADA 4I5NA 1TJFA 4U95D 4K5AB 2WB2A 2X6HA 2L6BA 3QARA 4AM9A 4JXTA 4UWGA 5SW9A 3AG4E 3HXBA 4BESA 2KZTA 4UQIB 3NOWA 5KBAA 3VLEA 1JPWA 4JW2B 5KNHD 3UIOC 2PKGA 1HXIA 3ND2A 4WWOA 3KSLA 3Q5MA 5EILA 1QYMA 1QBQA 1QBKB 2XA7B 3ISMC 1W9CA 4JHJA 3SF4A 5CHEE 3FUMA 2I1JA 4U2XD 1YYHA 4ILHB 2L9BA 3ZYLA 3JXIA 3WOYA 5FTPA 2ZGGA 1L5JA 3E37A 1Z3YA 3Q9UC 2XZTG 1M8YA 2RKKA 1PJMB 4UADA 1UKLA 4U04A 2X6IA 3IHVA 1O5MA 4N3AA 3KEAA 3RRUA 3TXNA 3CVYA 3ZUVB 2JABA 3FTVA 2P9UG 2QMRA 3ZIKA 4B89A 3QJZA 4KVMA 3V2OA 3D9NA 4LCTA 5CMWA 3EHNA 2VGYA 4A1GA 3FEYA 3U66A 4YDEA 4URKA 4J6IA 4P29A 4GTSA 2JKTB 3C5WA 1OXJA 2VYIA 4DX2A 3BTRC 5EWPA 4JLQA 3X2QE 3UKUG 4B94A 3O4XA 1K1BA 4ABNA 1W63A 3Q0LA 3QWPA 4GYOA 4G3AA 3AU5A 4G23A 2IQCA 2QYUA 3RJVA 4FP7A 4ILGA 3T5XA 3ZVVA 4YK6A 5FQ7A 3V30A 1TJCA 2JLBA 1M8WA 1TNYA 3ZYMA 3ZW3A 3CQCB 1JWFA 2NYJA 4JVSA 4QMIA 1BLXB 4G8LA 3TL5A 3ENEA 4D10C 3E32A 2NC9A 3PE3A 2VTBB 3ZIOA 3LY9A 3ZFWA 3BEEA 3E34A 3FWVA 4DI4A 3U9WA 4R10A 1JDHA 5HQ8A 2JAKA 4K5CA 3L08A 2I1KA 4I1AA 3ZN3A 4FLHA 2IO2C 3O2TA 4AOFA 2XPZA 2BKUB 3I5PA 2Y4UA 2OVBA 4NZWA 3DADA 3PEUB 2LO6A 4OAUC 3AAAC 2AW6A 2XRZA 3CKBA 5FZQA 2Z5KA 1H2VC 3CVWA 5AIJA 2JKRA 3CVVA 4DX6D 5EDSA 2L6JA 3LTMA 3ODSA 3BCTA 3MGBA 5H7PA 4ADYA 3Q0PA 3ZKVA 5LCWJ 1O1SA 4ANUA 4AXHA 2KATA 5M72A 1HS6A 4J8YA 3TWQA 3DXMG 4GB9A 3JYSA 3T7UA 4N39A 3EDTB 3Q9NC 4XX5A 1QNFA 4AJWA 4XIFA 3OXFA 1KT1A 2HE0A 3CGHA 5D0QD 4IULA 5K6SA 2LXLA 1P5QA 3ZU7B 3UL0B 3PZ1A 4TUMA 2ONDA 4HB5A 1KZPA 2J9QA 3FH5A 3NF1A 4AVXA 2P9SG 5KJNA 3C2GA 2X1GF 1UJKA 3LTJA 1IQRA 4J8SA 3UPVA 2F0YA 1NZNA 4GMOA 3WYFC 2X38A 3WXXA 4WAFA 4D4EA 5G04J 1EJYI 4U5UA 5FQ6A 1QZ2A 5LOZA 5HHGE 3O4ZA 4EVPA 4J8DA 2X6KA 5BW8C 3EG5B 3KD7A 2BF0X 1MX2A 4U58A 4GA0A 3ONKA 4GCNA 3ZYKA 3B7TA 1IYGA 3WG7E 3FU0A 3TWWA 5EX3A 2YNQA 2WMOA 5ANRA 4U5SA 4RXHB 4CV5B 1TNZA 5ENNA 1V54E 3UXGA 3W9GA 1ELWA 3ABKE 5JJ6A 4O1PA 5LCWC 3D9MA 3G2WA 4FHJA 3C5RA 3FTSA 3P1UA 4U5NA 3FUFA 2IF4A 2OEWA 1ELKA 4MLPA 4OVUA 4DX1A 2KCKA 4FZAA 3EIJA 3NMWA 5CRVA 2YJYA 3EA5B 2PQNA 3DEPA 2QZAA 4I2WA 5BV1A 3ZHPA 5KJLA 4N2QA 1IQUA 4EHMA 4RVBA 5J90A 3UKZB 3L3FX 4WNDA 4BPLA 4UWLA 1Q2ZA 1YMPA 4GMJA 1AP7A 4FQ3A 2J8SD 4JW3C 1LD7A 4CBAA 5CL3A 4UQXA 4J0UA 1XM9A 4FLBA 4HI8A 5CLDA 4HNAD 4CCAA 4K6JA 3CVQA 4UWHA 3JUIA 2C1TA 1RW2A 4EV9A 3TT9A 1HU3A 2GGFA 3UT4A 2GRRB 4CEMA 4GMRA 3MCXA 4E85A 2WQHA 4E6HA 1SVXA 2PZIA 4I43A 2BTDA 5KJKA 4DK5A 1N0RA 5D5KC 2V8SE 5JJAA 5KLRB 4V3IA 2F8XK 1H6PA 3UI2A 5SWFA 4I6JA 2LSUA 2H6FA 1KZOA 1E8ZA 3MKQA 2J07A 5AEIA 3GVTA 3CSTA 1TEZA 5D0OD 3E30A 4L2LA 3AS8A 1NI1A 4HQDA 3ULYA 3HXDA 3U4TA 3IXEA 1Q1TC 2QNAA 3L13A 3R9AB 3FTYA 5ITZF 3S7FA 4RZPA 1DC2A 4AP2A 3Q73A 2DZOA 2VGLB 3D9IA 3CR3A 3LKUA 1LRVA 5FZRA 1OT8A 3SD5A 4IMJA 1O1TA 4EZKA 5JJTA 3RKVA 3HXEA 3ZXPA 4Q96A 3CVLA 5A23A 1INZA 1N54A 4LEUA 1I7XA 4TNMA 3TPMA 2ZU6B 5AJDA 2A5EA 2DIWA 3MKRA 3ASOE 5KNGA 3S7DA 5E76A 2VGLA 1M5NS 2IFUA 3D3MA 3EHMA 3WOZA 2LAHA 3HYMB 3I4GA 3GYZA 4U3JC 3T8SA 4H7YA 3D9PA 4GA2A 3KS2A 4C0EA 1EDUA 3ZIRA 4M7CA 3IBVA 1HH8A 4IRUA 2BNXA 1ZBPA 3V74A 1UN9A 1N95A 4GPMA 4GZ6A 5HRYA 2IAEA 1Y6IA 4LUNU 4PS7A 5CTTA 2XGOA 3NBNB 3IEGA 4TXQA 2Q7FA 2WVIA 4R7LA 2WQ6A 3HVEA 2V4LA 4LERA 2Y0BG 5B56A 4CGVA 1JPLA 3PS6A 4JPSA
chains in the Genus database with same CATH topology
2BUGA 5K9SA 4EV8A 4IN3B 3L54A 3BVSA 4TRQA 3ZXSA 3FTVA 4L1BA 3SHFA 3BX3A 3K5QA 3MA5A 4EQFA 2QMRA 3IBEA 3ZIKA 4B89A 4HXIA 5T3RA 3QJZA 1KLXA 4KVMA 4I1EA 3LS8A 3QDNA 3BSXA 3D9NA 3QOUA 4LCTA 3KNDA 2XGSA 4YVOA 3U66A 4MZ6E 5CMWA 3OTNA 3DW8A 4UWFA 5HI7A 1EE4A 1IALA 3EHNA 2C2LA 1Z2CB 2GL7A 4P6ZG 2PL2A 2VGYA 3CHMA 3D9JA 3FEYA 3JXYA 2CHWA 3MYVA 4ANWA 5KLTB 4GAAA 4BSXA 2AXVA 5BV0A 4J6IA 4URKA 1Z6TA 4YI0C 3UKWB 4P29A 4WNEA 4F3VA 2JKTB 1EE5A 3C5WA 3FTZA 3GZSA 4HOSA 1QGRA 4QMHA 4U5LA 1XQSA 3NZSA 5KUBA 3L6YA 4KZGA 4WWPA 4ME2A 2CHZA 2WXGA 5BZ1A 3Q0SA 1XNFA 2VYIA 3QNKA 4BFRA 1MQSA 2I9CA 3BTRC 3OQSA 5EWPA 3Q0OA 4UAFB 4H3HA 3O2QA 3LYAA 5E75A 2LSVA 4JLQA 4HNMA 3K4EA 1VDYA 3UQ3A 4B94A 3SI5A 3O4XA 3IKOB 4EECA 1B89A 3PSPA 4F7AA 1WA5C 3FGAB 4I2SA 4CDRA 3SL9A 1W63A 4ABNA 5G55A 3CHOA 3Q0LA 2IX3A 4N2SA 3QWPA 3SLAA 4XKBA 2XQ0A 4CRUB 4GYOA 4NRHB 4XI0A 2NYLB 4G3AA 3AU5A 3APFA 3UKXB 4AIFA 3G2UA 3HHMA 2IQCA 4G23A 4AY5A 2AWIA 3GAEA 2VSOE 4I2ZA 5J3VA 3RJVA 4FHKA 1WAO1 3MV3B 2VJ8A 1OWOA 3BSBA 1O6OA 5JJ7A 3GS3A 3OUXA 4FP7A 1OWLA 2DBAA 2MOWA 4ILGA 3T5XA 3CHRA 4N3CA 3ZVVA 4YVQC 4YK6A 2IWHA 3ASHA 3ZEFA 2J09A 5FQ7A 4U0UA 2Y4TA 3BWTA 1TJCA 2JLBA 3FTUA 5ARFA 3VLDA 1M8WA 2YHCA 2YINA 4E4VA 5BT1A 4CT6B 4KYOB 3QMLC 5CL4A 5HUYC 3ZYMA 3FP3A 4M3OA 5FWQA 4DLOA 4Q69A 4ACLA 3CQCB 3ZW3A 2E2EA 3FFLA 3ASDA 4I6IA 1JWFA 4BY6A 3T5VA 3PUKA 4JVSA 4QMIA 1TE4A 2XCBA 3NZUA 4GZ3A 4EBAG 4BA3A 3TL5A 2X3MA 5FQ8A 5JHAA 4CT4A 4L2YA 3VE6A 3ENEA 4D10C 2J08A 1E8YA 1B3UA 3FU6A 4G25A 4DLQA 3PNLB 4B8OA 2NC9A 3PE3A 2VTBB 3ZIOA 2GW1A 4HM9A 2UY1B 3LY9A 4I1MA 4K03A 3ZFWA 4EBAA 4GZ5A 3BEEA 3JQ0A 3O48A 3ML9A 3FWVA 4DI4A 2RU4B 3LVRE 4V3QA 5HUWC 3U9WA 3E4BA 4PLQA 4R10A 1JDHA 2FULA 2Z5OA 3JCKC 2YNRA 3BG0B 5ANLA 2JAKA 5HQ8A 3L08A 2I1KA 2NXPA 2VQ2A 2V0PA 3RK6A 3ZIQA 4I1AA 4XZ4A 3ZN3A 1OWNA 1EF1C 3QG9A 2LNIA 3L6AA 3LPZA 1NA3A 4FLHA 4OYSA 4U54A 2CHXA 3O2TA 4Q94A 4DZSA 4AOFA 2XPZA 3FHEA 2CFUA 3L22A 4PLRA 2BKUB 1LF8A 3I5PA 4I6EA 4XZRB 1S0PA 2WXKA 4PDXA 2QK1A 2Y4UA 2IE3A 3TG5A 4I3NA 2IOSA 2OVBA 4NZWA 4JW1A 5SVZA 4A3VA 3DADA 3W3UA 3PEUB 2NSZA 3IHYA 4U8HA 3JX7A 2LO6A 2QFCA 2PF4A 1H19A 3ZHEA 2AW6A 2W3CA 2XPIA 3D9OA 2XRZA 3CKBA 2EQXA 5KLAA 4GMLA 5DIZA 4L7TA 2Z5KA 5FC8E 5FZQA 1H2VC 3UX4A 2FO7A 4EZLA 3CVWA 4DB8A 3FU5A 5AIJA 2JKRA 2Z5NA 4GYYA 4CB8A 3CVVA 4G24A 3Q15A 2L6JA 4DBAA 3JQ1A 3SNXA 5EDSA 1PY1A 2L0IA 3LTMA 3CSFA 4MRUA 3PVLA 3AU4A 2WTKA 4MFUA 1XGWA 3ODSA 3TX7A 3BCTA 3QAQA 5G2NA 1PJNB 3U64A 3CVNA 4CB9A 4XE0A 1X5BA 4HOUA 3MGBA 1OWMA 2CFZA 4UAEA 4L4HA 4ADYA 2OOEA 4MZ5E 4KXKB 4GMNA 4EPZA 3VWAA 3Q0PA 1OWPA 4RG9A 2VGXB 4JA7A 3TXNA 3ZKVA 1FVHA 4IYPA 4UI9J 2YQ8A 5CLAA 4APFA 3SBTB 5LCWJ 3MJWA 4UWKA 2KATA 4HFGA 3K64A 4GCOA 4CRVB 5T8IA 4AXHA 4ANUA 2KCLA 5AJLA 4C0MA 2QK2A 1HS6A 4B8JA 3APCA 4CGWA 5M72A 1QZ7A 5CMYA 4GB9A 1WY6A 2A5UA 3JYSA 3K5ZA 1HG5A 1TH1A 3T7UA 4N39A 1W63B 3EDTB 1Q1SC 4XX5A 1QNFA 4CDNA 4GZDA 3Q0NA 2GRLA 4G11A 4XIFA 4AJWA 3OXFA 3TJ3A 4FZDA 3UL1B 3GB8A 1KT1A 2AVPA 3CGHA 3EJNA 2UWJG 3ZINA 1LUJA 3L16A 3Q49B 4IULA 4W9RA 5D0QD 3MX3A 3DPDA 3Q4AB 5K6SA 2FI7A 3L3QA 3FUDA 2VGXA 3FY4A 3S2AA 3T8MA 1P5QA 3RRMB 3UL0B 2V5FA 3MV2B 1M1EA 2NYMA 2HR2A 4DJAA 1OYZA 3ODRA 4AV7A 4U63A 3K5YA 3QWWA 2ONDA 1IQ1C 5CL5A 5JHBA 2YHEA 2XOAA 2WXPA 3CIAA 5CLBA 4NEEA 3RRNB 3TGOA 2J9QA 3O2SA 3FH5A 3NF1A 2OF3A 2IU1A 3MZLB 3D9KA 2WXHA 4QFVA 3VTXA 4A55A 4OO6A 5E6QB 4I0YA 5KJNA 2FV2A 4U0SA 3C2GA 2X1GF 4PS3A 2JKRB 2Z5JA 1UG3A 3LTJA 3K62A 1IQRA 1UJKA 4YJEA 4I1OB 4J8SA 5EKQD 3OAWA 3UPVA 4L7MA 4I8MA 2Q5DA 1NZNA 4MS6A 4GMOA 3WYFC 3Q0MA 2RU4A 4BX9A 2X38A 3U3WA 4RV1A 4C0EA 4UI9K 4KMOA 5CCLA 3WXXA 4UQZA 1UPKA 2YNSA 3P2BA 2BCTA 2OVFA 2WXMA 4WAFA 4D4EA 4CRWA 4PUCA 5G04J 2VTBA 3CVUA 1EJYI 4U5UA 2P8QA 5FQ6A 1QZ2A 5LOZA 4Y5JA 2JDQA 1UN8A 1IBRB 1EYHA 3G2VA 2Z6GA 5LX8A 5HHGE 3ONLA 4CT7B 3O4ZA 4EVPA 5DN7A 3OPBA 3TPOA 1PAQA 3LY8A 1Y2AC 4J8DA 4A1SA 4F1SA 3AS4A 4DVGB 5LSWA 3L17A 2FF4A 3TJPA 1E8WA 2X6KA 3C98A 5G05C 3SZ7A 5BW8C 3EG5B 3KD7A 2CG3A 4PLSA 2BF0X 1I7WA 5KJLA 4L4IA 4U58A 3FEXC 3LVQE 4GA0A 3GZ2A 3ONKA 4NURA 1JPPA 4YGXA 2X6FA 4GCNA 5T4YA 5FQ4A 1UW4B 2XGMA 4J8FA 3ZYKA 1IYGA 3UT7A 1HE8A 3B7TA 3PZDA 3WPTA 3JY1A 3BX2A 3FH7A 3RO2A 5J08A 4I96A 2HO1A 2NYMB 2UY1A 2IE4A 1M8XA 4ATGA 4A1GA 3ASFA 5BNWA 2IAEB 3KAEA 3FU0A 2H4MA 2RG8A 4G26A 3B7RL 4PH4B 5EX3A 4HOQA 3UMVA 3URZA 5CL7A 4AEZC 3HDXA 2YNQA 2WMOA 4DJSA 3B7UX 2P58C 4U5SA 2WXNA 4RXHB 1UPLA 3B7SA 5ANRA 4CV5B 5CLCA 3QWVA 3CKCA 4V3RA 4XKCA 4CDMA 3ASGA 1HX8A 3K7WA 1IB2A 4I7IA 1OUVA 2WXFA 4KBQA 1G3JA 5ENNA 4MKTA 3A6PA 3APDA 2GRMA 4PS8A 3OXGA 3FGAA 3FUKA 2R59A 2J4DA 3UKYB 1BK6A 1ELWA 1WM5A 2PM7A 3AS5A 3QKYA 5ARGA 5JJ6A 1EJLI 4EZJA 3EBBA 3ZIPA 1Z3XA 5CL9A 3QGBA 5DBKA 4GPKA 2Z5MA 4R11A 3FDHA 3KEZA 1XQRA 5LCWC 3NQPA 2Z6HA 3D9MA 4U07A 2VSXE 3G2WA 2R17C 2DCPA 3PSTA 1UJJA 4FHJA 4L23A 4K92A 4JHRA 4ANXA 3FTSA 3P1UA 4ANVA 4P6ZB 4U5NA 4A0CA 3FUFA 1ELRA 4BWRA 1BPOA 2IF4A 4YJLA 3TJZB 1ELKA 3G2TA 5H2WA 5BPPA 2NYLA 4MLPA 1HG2A 4OVUA 4NQ0A 1U6GC 1V18A 3DBSA 4APOA 1N52A 2KM4A 2WMNA 3OBVA 3TG4A 3QHEA 3FUNA 4BTAA 3CVXA 2KCKA 3AU3A 5CL8A 4FZAA 4B8PA 3EIJA 4HORA 5H2XA 3NMWA 4FZFA 2C0MA 2YJYA 5C2YA 3EA5B 4A3TA 1WA5B 1H2TC 2KCVA 2PQNA 3LCAA 3MEKA 3CQGB 4ILIA 3ZYQA 1SZAA 3S7JA 4B0ZA 2E0IA 4N2QA 4J8EA 4FULA 3ZIMA 1QQEA 3D9LA 4I2WA 4GZCA 3ZHPA 4EVAA 1H0AA 2WXLA 3ZHEB 5BV1A 3V71A 1IQUA 1U3CA 4I9CA 4O6FA 3CHPA 2WPVA 2CG2A 3K61A 1U3DA 4WNFA 4CT0A 3I3NA 4RVBA 4I37A 5J90A 5A6CA 2A4ZA 3UKZB 3LY7A 1W3BA 3ZRHA 3LJ3A 5C1DA 3ML8A 3FEXA 3L3FX 4U5VA 4WNDA 4BPLA 4UWLA 4B8AA 4GMJA 2OV8A 4BT8A 2JKTA 3ZILA 4FQ3A 4WV6A 1FCHA 3CV0A 3VTYA 4HOTA 4JHKA 4TV3A 4JW3C 2LAIA 3HIZA 5BUZA 3G2SA 4CBAA 1KT0A 3IV0A 5CLEA 4KZ0A 3UUXA 5CL3A 4I9EA 4DB9A 3GZ1A 3K9IA 4UQXA 4MFVA 2IW3A 1XM9A 3RZXA 3CK9A 4FLBA 3Q5UA 4FFBC 2NPPA 2WXQA 4J0UA 4DPRA 4EVTA 2C0LA 5CLDA 1E7UA 2XEVA 4CCAA 3IFQA 2I2OA 4Y6WA 3Q47B 4FJYA 1JUQA 4GU5A 1O6PA 3SFZA 4K6JA 3ESLA 1EPUA 3CVQA 1QGKA 2HYZA 2X6JA 4UWHA 2XHEA 3JUIA 2C1TA 2FEZA 1IHGA 3SBSA 4KZCA 4N3BA 4EV9A 3TT9A 1HU3A 4C9BB 1E96B 2GGFA 3UT4A 4HTVA 2KZTB 3PH0C 4CEMA 3MCXA 4E85A 4JZYA 4U5OA 2WQHA 4LRZA 3LWWA 3C2HA 1M8ZA 2AXZA 3CHSA 3HVEB 3LDZA 4DI3A 1T08A 4E6HA 5EKGA 4V3OA 2PZIA 1SQMA 4I43A 3V6YA 2ILRA 4HXTA 2Y3AA 4JEHA 3ULQA 4BT9A 4LACA 5BZ5A 1E8XA 2BTDA 4B8CB 4GA1A 5FJYA 5KJKA 1GW6A 4DK5A 2J4BA 2I6HA 3K7VA 5D5KC 2XA7A 2MHKA 2V8SE 3H3DX 5JJAA 3CLJA 3RU0A 5KLRB 3FUHA 4GYWA 4RSYA 5G04C 4V3IA 1HF8A 4AVXA 3GNIA 3BG1B 3PDNA 4I17A 5SWFA 4AY6A 4I6JA 4YNDA 2LSUA 2WXRA 1FVFA 4O27A 2QY7A 3NMXA 5CL6A 1E8ZA 1E7VA 2J07A 2MRIA 3MKQA 3PREA 5AEIA 3PEVB 3GVTA 3RZ9A 3CSTA 4PVZA 3GW4A 1E90A 4UQIA 3I4RB 2OT8A 1TEZA 4B18A 4K0RA 4L2LA 5D0OD 5FZSA 5AYWD 4HLEA 5LP0A 4WNGA 2WXOA 3AS8A 3PRZA 5G05J 4N5CA 4F53A 3FTXA 3FU3A 1UN0A 3FULA 4FC8A 4TUUA 3U4TA 1H2UA 4KT6B 2J49A 1Q1TC 2QNAA 3L13A 1ZU2A 3R9AB 3FTYA 3TAXA 2IOLA 3FTWA 3S7FA 4RZPA 3R7RA 4AP2A 2F31A 4OIHA 2L0TB 2PQRA 5CCMA 3OUWA 5KCMA 5LFAA 4RG6A 4HS2A 2VGLB 3D9IA 4BX8A 3VLFA 3NMZA 3CR3A 4G2VA 3FUEA 3LKUA 1LRVA 5FZRA 4U0ZA 3EIQC 5KL1A 4JEUA 2WM9A 2X19B 3SD5A 4IMJA 3CK8A 1JWGA 3PE4A 3GQ2A 4JA9A 1DNPA 4EZKA 4DB6A 5JJTA 3LEWA 3RKVA 5BZVA 1NP7A 3CHQA 2C1MA 3CVLA 3LXUX 4Q96A 5A23A 1INZA 4R0ZA 4IMIA 1NA0A 1N54A 2AXUA 2HM8A 3B13A 3QK0A 4LEUA 4NACA 1I7XA 5EX0A 3QB2A 3FUJA 4TNMA 3TPMA 2ZU6B 1A17A 4ZDUA 5AJDA 2DIWA 3TXMA 2WQ7A 3JXZA 2WXIA 2XPYA 3MKRA 3PUJA 3N71A 2IONA 4UI9C 4XI9A 1SZ9A 3UT8A 3S7DA 3FEYC 3Q0RA 5E76A 5A7DB 3ZGQA 1HO8A 2VGLA 4UWXA 5BYMA 4BQKA 4OVVA 3SGHA 4FADA 4I5NA 1M5NS 1TJFA 2IFUA 4FU3A 3D3MA 2JEKA 5AENA 2VSNA 1H6KA 3EHMA 3L6XA 4FDDA 2PM6A 3FH8A 3WOZA 3S7BA 2LAHA 4H7XA 2WB2A 3FUIA 2X6HA 4ACKA 2XRYA 3QARA 4JL0A 4JKQA 4AM9A 4BTBA 3HYMB 3I4GA 4JXTA 5SW9A 4UWGA 3ZPJA 3GRLA 3GYZA 1PC2A 4UQYA 4U3JC 4H7YA 5KL8A 4D49A 3D9PA 2BAPA 3KS2A 2WXJA 1F59A 4GA2A 1BK5A 1EDUA 3ZIRA 2KZTA 2IJGX 4UQIB 3IBVA 2R5SA 3NOWA 4JC8A 3R7QA 5FT9A 1HH8A 4IRUA 3VLEA 1JPWA 4JW2B 3CEQA 2BNXA 3K49A 3V74A 2PKGA 1UN9A 1ZBPA 1HXIA 3ND2A 3MKQB 4G1TA 4QMJA 5BZUA 4KVOA 5KJMA 4I5LA 3PNTB 4WWOA 4Y6CA 2VSYA 4I6GA 5EKFA 1Y8MA 3Q5MA 4GZ6A 1QBKB 2IAEA 3UVUA 1Y6IA 4LUNU 2XA7B 4PS7A 5CTTA 2XGOA 4H3KA 1W9CA 4FJZA 4JHJA 1DVPA 3IEGA 3SF4A 3GVOA 1HFAA 3FUMA 2I1JA 5CHEE 2FBNA 2Q7FA 2NPPB 4U2XD 3CVPA 2WVIA 4R7LA 1MHQA 2WQ6A 4JW2A 4ILHB 2M63A 1GCJA 3RIBA 3HVEA 3QGCA 2L9BA 2KC7A 3ESKA 3ZYLA 4FA6A 2V4LA 3RO3A 4LERA 3WOYA 5FTPA 2DB0A 5B56A 1L5JA 1YA0A 1Z3YA 4CGVA 1M8YA 1PJMB 3OXLA 4UADA 1JPLA 1UKLA 2XCCA 2X6IA 3IHVA 3PS6A 4U04A 4HVBA 4N3AA 1HZ4A 3CK7A 3Q0QA 4JPSA 4WWNA 4WUYA 2RD0A 3RRUA 3QC1A 3CVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VLE A;  4A3T A;  4FP7 A;  4A3V A;  3VLD A;  3VLF A; 
#chains in the Genus database with same CATH topology
 4DX5 D;  1BU9 A;  5K9S A;  4EV8 A;  4TRQ A;  3SHF A;  3K5Q A;  4EQF A;  3IBE A;  5T3R A;  3LS8 A;  3DW8 A;  1IAL A;  1Z2C B;  2CHW A;  5BV0 A;  4GAA A;  2AXV A;  4HOS A;  4QMH A;  3NZS A;  3V31 A;  3HG0 D;  2P2C P;  1N9A A;  3QNK A;  3OQS A;  1BI7 B;  4H3H A;  3O2Q A;  3LYA A;  5E75 A;  4HNM A;  3UQ3 A;  4EEC A;  4CDR A;  1JCR A;  3UM2 A;  2GRO B;  3PZ2 A;  5G55 A;  5CER B;  3SLA A;  3R7Q A;  2LUH A;  4XI0 A;  3T8K A;  4AIF A;  3HHM A;  3UJ0 A;  4AY5 A;  2AWI A;  4I2Z A;  2IY0 C;  3MV3 B;  2VJ8 A;  3HRA A;  1X81 A;  3GS3 A;  3OUX A;  2MOW A;  3ASH A;  2J09 A;  3VLD A;  2YHC A;  4KYO B;  3QML C;  5CL4 A;  4Q69 A;  4I6I A;  3T5V A;  2XCB A;  4GZ3 A;  1FT1 A;  2X3M A;  3R9M A;  4CT4 A;  1E8Y A;  3PNL B;  2GW1 A;  3JQ0 A;  3O48 A;  4V3Q A;  4BSZ B;  2Z5O A;  5ANL A;  2NXP A;  2VQ2 A;  1OWN A;  2DVW A;  3QG9 A;  3LPZ A;  3SNX A;  4U54 A;  4DZS A;  4YDY A;  3FHE A;  2CFU A;  4PLR A;  3AJI A;  1SW6 A;  2WXK A;  1IKN D;  3TG5 A;  3EU5 A;  2IOS A;  3C72 A;  2V5Q C;  3ZHE A;  2W3C A;  4GML A;  5DIZ A;  3TWS A;  1OCR E;  2Z5N A;  4GYY A;  4CB8 A;  2L0I A;  3CSF A;  3PVL A;  3AU4 A;  3AG3 E;  5G2N A;  3DXK G;  3U64 A;  3CVN A;  1OWM A;  3Q78 A;  4UAE A;  4L4H A;  3VWA A;  4JA7 A;  5CLA A;  3SBT B;  4GCO A;  2KCL A;  3APC A;  2IO3 C;  4CGW A;  2A5U A;  3K5Z A;  1LD8 A;  1D8D A;  4ATZ D;  3KSQ A;  4GZD A;  4FZD A;  3GB8 A;  3EJN A;  3L16 A;  2UWJ G;  3TJP A;  4HBD A;  4B93 B;  4GTP A;  3MV2 B;  2HR2 A;  1OYZ A;  3K5Y A;  2MYO A;  3QWW A;  5JHB A;  2P9K G;  3CIA A;  5CLB A;  3RRN B;  4F53 A;  3VTX A;  4A55 A;  5E6Q B;  4I0Y A;  2Z5J A;  1UG3 A;  3K62 A;  5EKQ D;  3OAW A;  4L7M A;  4I8M A;  3TWU A;  4UI9 K;  5CCL A;  4GTO A;  4UQZ A;  4U8Y D;  3P2B A;  2BCT A;  4PUC A;  1N4P A;  1UN8 A;  2PNN A;  1NL4 A;  2Z6G A;  3LY8 A;  4F1S A;  3AS4 A;  5G05 C;  3FEX C;  4NUR A;  1JPP A;  2XGM A;  1HE8 A;  3WPT A;  5AN8 A;  3JY1 A;  3RO2 A;  2UY1 A;  2IE4 A;  3ASF A;  1UOH A;  4G26 A;  3B7R L;  4PH4 B;  3URZ A;  5CL7 A;  3HDX A;  2P58 C;  2WXN A;  1UPL A;  5CLC A;  3QWV A;  4V3R A;  4XKC A;  1FPP A;  1HX8 A;  4I7I A;  5EID A;  1G3J A;  4BEP A;  4MKT A;  3A6P A;  1N4S A;  4PS8 A;  2FO1 E;  3FGA A;  1BK6 A;  1WM5 A;  3EU9 A;  4EZJ A;  3ZIP A;  2Z5M A;  4R11 A;  3BUA A;  1XQR A;  2Z6H A;  5AQA A;  3PST A;  4L23 A;  2ZIS A;  4BWR A;  1BPO A;  4YJL A;  3TJZ B;  5H2W A;  2NYL A;  1HG2 A;  4NQ0 A;  1U6G C;  4B8P A;  4C48 B;  3LCA A;  3ZYQ A;  3CQG B;  4ILI A;  3UJ4 A;  2E0I A;  3L82 A;  4FUL A;  1H0A A;  2WXL A;  4XEI G;  3K61 A;  1U3D A;  2A4Z A;  5C1D A;  1D9S A;  3ML8 A;  3FEX A;  1TN7 A;  2R03 A;  4B8A A;  5CBN A;  4BT8 A;  1OCZ E;  3ZIL A;  1FCH A;  3VTY A;  4JHK A;  2LAI A;  3ZKJ A;  3G2S A;  1KT0 A;  3ASN E;  1MJ0 A;  2ZGD A;  2EIK E;  4DPR A;  3Q5U A;  2NPP A;  2WXQ A;  4EVT A;  4U8V D;  2OCC E;  4Y6W A;  2XS8 A;  4GU5 A;  1KPS B;  1QGK A;  2HYZ A;  2XHE A;  1N4R A;  3SBS A;  4C9B B;  1E96 B;  4LRZ A;  3LWW A;  1M8Z A;  3LDZ A;  1T08 A;  5EKG A;  4BT9 A;  2Y3A A;  4CDN A;  4LAC A;  5BZ5 A;  4B8C B;  4GA1 A;  5CED B;  2J4B A;  5G04 C;  3PDN A;  3BG1 B;  4YND A;  2P9P G;  2WXR A;  4O27 A;  5CL6 A;  1E7V A;  5EN5 D;  3PEV B;  3GW4 A;  2P9L G;  4B18 A;  2R2L A;  1U2V G;  3SO8 A;  4FC8 A;  3FUL A;  4TUU A;  1H2U A;  2J49 A;  1TN8 A;  3FTW A;  5ENP D;  3DST A;  2F31 A;  2L0T B;  2PQR A;  3OUW A;  5KCM A;  4RG6 A;  3NB2 A;  1MX4 A;  3NMZ A;  3UIN C;  5FIO A;  2RFA A;  1WG0 A;  4DB6 A;  1NP7 A;  3LXU X;  4R0Z A;  4IMI A;  1NA0 A;  2AXU A;  2B0O E;  2HM8 A;  4NAC A;  2XPY A;  2WXI A;  4UI9 C;  1SZ9 A;  3Q0R A;  1HO8 A;  4BQK A;  5AEN A;  2JEK A;  2VSN A;  4LG6 A;  2PM6 A;  3S7B A;  3FUI A;  2ZXW E;  2XRY A;  4JL0 A;  3D9H A;  4BTB A;  3ZPJ A;  4UQY A;  5EYP F;  2BAP A;  2WXJ A;  1BK5 A;  2IJG X;  4UUC A;  3CEQ A;  3MKQ B;  1K8K G;  3ABL E;  3PNT B;  5EKF A;  1Y8M A;  3C3Q A;  3UVU A;  4H3K A;  1DVP A;  3CVP A;  3PZ3 A;  1MHQ A;  4JW2 A;  2M63 A;  3RIB A;  2KC7 A;  5HS0 A;  4QQI A;  1YA0 A;  3SFX A;  3JXJ A;  2XCC A;  1HZ4 A;  3Q0Q A;  1K1A A;  4WWN A;  3NOG D;  3BVS A;  2GRN B;  3ZXS A;  1TNB A;  3MA5 A;  3QDN A;  4YVO A;  3QOU A;  3KND A;  3V79 K;  4MZ6 E;  4A63 B;  3DSV A;  5HI7 A;  2C2L A;  3CHM A;  2GL7 A;  4P6Z G;  3D9J A;  3MYV A;  4NIK A;  4ANW A;  5KLT B;  4BSX A;  4YI0 C;  3UKW B;  4WNE A;  3GZS A;  3FTZ A;  1QGR A;  4U5L A;  5KUB A;  4ME2 A;  2CHZ A;  5BZ1 A;  3Q0S A;  1XNF A;  3RSE G;  4BFR A;  1MQS A;  2I9C A;  3Q0O A;  2BED A;  4F6R D;  5AAR A;  2LSV A;  3K4E A;  3SI5 A;  3IKO B;  1B89 A;  2ZIR A;  4N2S A;  3UKR G;  2NYL B;  3APF A;  2GRQ B;  3UKX B;  2P9I G;  3G2U A;  1JCS A;  2VSO E;  3GAE A;  5ENT D;  4FHK A;  1WAO 1;  5JJ7 A;  1O6O A;  3Q7F A;  4LNB A;  2DBA A;  2KXP C;  3CHR A;  4YVQ C;  4U0U A;  2Y4T A;  3BWT A;  4CT6 B;  5HUY C;  4ACL A;  5B3S E;  1D8E A;  2ETB A;  1TE4 A;  4EBA G;  5CEA A;  4L2Y A;  3VE6 A;  1B3U A;  4B8O A;  4HM9 A;  4GZ5 A;  2RU4 B;  3LVR E;  4ZFH A;  3E4B A;  1LSH A;  2YNR A;  3BG0 B;  1AWC B;  3ZIQ A;  4XZ4 A;  2LNI A;  3L6A A;  4OYS A;  2CHX A;  4Q94 A;  3L22 A;  4I6E A;  1LF8 A;  1S0P A;  4PDX A;  4RQI A;  2QK1 A;  2LXM A;  4Z68 A;  4A3V A;  3W3U A;  4U8H A;  3IHY A;  2QFC A;  2PF4 A;  2XPI A;  2EQX A;  5KLA A;  1S64 A;  2FO7 A;  4DB8 A;  2EIM E;  3V2X A;  1TNU A;  3Q15 A;  3JQ1 A;  4DBA A;  4G24 A;  1PY1 A;  5CEC B;  4MRU A;  2QYJ A;  2WTK A;  3QAQ A;  1PJN B;  4XE0 A;  5ENR D;  2OOE A;  4MZ5 E;  4GMN A;  2VGX B;  4BET A;  1FVH A;  2YQ8 A;  4APF A;  3MJW A;  5T8I A;  4HFG A;  3K64 A;  4C0M A;  3NAW A;  2QC9 A;  5AJL A;  2QK2 A;  4B8J A;  1QZ7 A;  1Q1S C;  1JCQ A;  3Q0N A;  2AVP A;  3Q49 B;  1LUJ A;  4W9R A;  3Q4A B;  2FI7 A;  2VGX A;  3S2A A;  1M1E A;  4DJA A;  4AV7 A;  4U63 A;  1IQ1 C;  5CL5 A;  5JMN D;  2XOA A;  2WXP A;  3O2S A;  2OF3 A;  2IU1 A;  3MZL B;  2WXH A;  4OO6 A;  2FV2 A;  2JKR B;  4YJE A;  4MS6 A;  3Q0M A;  2RU4 A;  3U3W A;  4GTM A;  2YNS A;  2OVF A;  2WXM A;  3B7B A;  2VTB A;  3CVU A;  4U7E B;  2XEE A;  2JDQ A;  3ULE G;  1IBR B;  1EYH A;  3AG1 E;  3ONL A;  4A1S A;  5DN7 A;  3OPB A;  3TPO A;  3AG2 E;  4DVG B;  5LSW A;  3L17 A;  3SZ7 A;  1N0Q A;  2CG3 A;  4PLS A;  1I7W A;  2EIJ E;  1N4K A;  4YGX A;  2X6F A;  1UW4 B;  4DUI A;  4J8F A;  3UT7 A;  4YDW A;  3PZD A;  4MBG A;  4I96 A;  2NYM B;  1H6O A;  3C3R A;  4ATG A;  5BNW A;  2IAE B;  5EYL A;  4HOQ A;  4GTR A;  1N94 A;  4GTQ A;  3CKC A;  3JUE A;  3ASG A;  3K7W A;  1IB2 A;  5CBO A;  1OUV A;  5EIB E;  3APD A;  2GRM A;  5JA4 D;  5ARG A;  3UKY B;  3AS5 A;  3BQO A;  4K5B A;  3EBB A;  5CL9 A;  3QGB A;  5DBK A;  4GPK A;  3KEZ A;  3NQP A;  2DCP A;  5AQ9 A;  1ELR A;  3G2T A;  1Z5S C;  1IXV A;  3DBS A;  3DEO A;  1N52 A;  2KM4 A;  2WMN A;  1SA4 A;  2KBX A;  3QHE A;  3TG4 A;  4BTA A;  3CVX A;  3AU3 A;  4HOR A;  2C0M A;  5C2Y A;  1WA5 B;  1H2T C;  2KCV A;  4J8E A;  4DLO A;  3ZIM A;  4EVA A;  3V71 A;  4I9C A;  3UM1 A;  4O6F A;  3DSS A;  2WPV A;  2CG2 A;  4CT0 A;  3I3N A;  5BXO A;  4I37 A;  3C3O A;  3ZRH A;  2B6C A;  1W3B A;  3LY7 A;  3LJ3 A;  2BKK B;  2JKT A;  4CZ2 D;  3TWT A;  4HOT A;  4TV3 A;  1S70 B;  4J7W A;  5BUZ A;  3IV0 A;  5CLE A;  3UUX A;  4I9E A;  4DB9 A;  3K9I A;  4MFV A;  2IW3 A;  3RZX A;  2ETA A;  2DWZ A;  1O6P A;  3SFZ A;  3ESL A;  2X6J A;  5BXU A;  4N3B A;  1TNO A;  4HTV A;  4U5O A;  3RAU A;  3UTM A;  3C2H A;  3CHS A;  3HVE B;  4DI3 A;  4V3O A;  3ULQ A;  1SQM A;  3V6Y A;  4HXT A;  3BU8 A;  2I6H A;  3W9F A;  3H3D X;  4RSY A;  1HF8 A;  4I17 A;  4AY6 A;  1FVF A;  2QY7 A;  3B95 A;  2MRI A;  5CRU A;  3PRE A;  3RZ9 A;  4UQI A;  3I4R B;  1SA5 A;  5FZS A;  2GRP B;  5AYW D;  4HLE A;  4WNG A;  2WXO A;  5G05 J;  3PRZ A;  4LNG A;  4N5C A;  1DCQ A;  3FTX A;  3FU3 A;  4KT6 B;  3DSX A;  2DYS E;  1ZU2 A;  3PZ4 A;  3TAX A;  2IOL A;  5LFA A;  4YDO A;  3DRA A;  1MYO A;  4BX8 A;  4G2V A;  3FUE A;  4U0Z A;  5KL1 A;  2X19 B;  4TXR A;  2ETC A;  1JWG A;  3LEW A;  5BZV A;  3CHQ A;  4L9P A;  2C1M A;  3B13 A;  5EX0 A;  3QB2 A;  2IEJ A;  1A17 A;  4ZDU A;  3TXM A;  2R02 A;  4XI9 A;  5A7D B;  1MZC A;  4OVV A;  4UWX A;  3SGH A;  3HXC A;  4FU3 A;  2XEH A;  1H6K A;  3L6X A;  4FDD A;  3FH8 A;  4H7X A;  4ACK A;  4JKQ A;  3GRL A;  1PC2 A;  5KL8 A;  4D49 A;  4JW1 A;  1F59 A;  2R5S A;  4JC8 A;  5FT9 A;  3K49 A;  1MX6 A;  4KVO A;  1OY3 D;  4G1T A;  4QMJ A;  5BZU A;  5KJM A;  4I5L A;  3Q7A A;  4F1P A;  4Y6C A;  2VSY A;  4I6G A;  3TWX A;  4FJZ A;  4ZHB A;  3GVO A;  1HFA A;  2FBN A;  2NPP B;  1GCJ A;  3QGC A;  3ESK A;  5AQ7 A;  4FA6 A;  3RO3 A;  2DB0 A;  2P9N G;  2F8Y A;  2Y69 E;  3OXL A;  4HVB A;  2F37 A;  3CK7 A;  4WUY A;  2RD0 A;  3QC1 A;  2BUG A;  4IN3 B;  3L54 A;  5B1A E;  4L1B A;  3BX3 A;  2H6G A;  1KLX A;  4I1E A;  3BSX A;  2XGS A;  2V4H C;  3OTN A;  2H6H A;  4UWF A;  5ENO D;  1EE4 A;  5AAO A;  2PL2 A;  3JXY A;  1Z6T A;  4F3V A;  1EE5 A;  1XQS A;  3L6Y A;  4KZG A;  4WWP A;  2WXG A;  4UAF B;  3UIP C;  2R05 A;  5KWD A;  1VDY A;  2RFM A;  4F7A A;  3PSP A;  1WA5 C;  3FGA B;  4I2S A;  3SL9 A;  3CHO A;  2IX3 A;  3SFY A;  3EUV A;  4O60 A;  4XKB A;  2XQ0 A;  4CRU B;  4NRH B;  5J3V A;  1OWO A;  3BSB A;  3ZNG A;  1OWL A;  1TYQ G;  4N3C A;  2IWH A;  3ZEF A;  3FTU A;  5ARF A;  3EHQ A;  2YIN A;  4E4V A;  5BT1 A;  4OAV B;  3FP3 A;  4M3O A;  5FWQ A;  2E2E A;  3FFL A;  3ASD A;  4BY6 A;  3PUK A;  3NZU A;  4BA3 A;  3DSW A;  5FQ8 A;  4X8Q A;  5JHA A;  2J08 A;  3FU6 A;  4G25 A;  2XS1 A;  4DLQ A;  4HRL A;  2UY1 B;  4I1M A;  4K03 A;  4EBA A;  3ML9 A;  5HUW C;  4PLQ A;  2FUL A;  3JCK C;  3DPY A;  1TN6 A;  2V0P A;  3RK6 A;  1EF1 C;  1NA3 A;  4XZR B;  5FIN A;  5AQB A;  2IE3 A;  4I3N A;  5SVZ A;  2NSZ A;  3JX7 A;  3LJN A;  1H19 A;  4JB8 P;  3D9O A;  4L7T A;  5FC8 E;  3UX4 A;  4EZL A;  3FU5 A;  4MFU A;  1XGW A;  3TX7 A;  5ENQ D;  4CB9 A;  1X5B A;  4HOU A;  2CFZ A;  4KXK B;  1OWP A;  4RG9 A;  4IYP A;  4UI9 J;  2VGE A;  4UWK A;  4CRV B;  1BI8 B;  5B1B E;  1WDY A;  5CMY A;  1WY6 A;  3TWR A;  1HG5 A;  1TH1 A;  1W63 B;  2GRL A;  4O1O A;  4G11 A;  4DRX E;  4HXI A;  3TJ3 A;  3UL1 B;  4LNU D;  3ZIN A;  3ABM E;  3MX3 A;  3DPD A;  3L3Q A;  3FUD A;  3FY4 A;  3T8M A;  1S63 A;  2V5F A;  2NYM A;  3ODR A;  2AJA A;  2YHE A;  4NEE A;  3TGO A;  4QFV A;  4BER A;  3D9K A;  4TXP A;  4U0S A;  4PS3 A;  4I1O B;  5ENS D;  2Q5D A;  1N11 A;  4BX9 A;  4RV1 A;  4KMO A;  1BD8 A;  4GTT A;  1UPK A;  4CRW A;  1LTX A;  3UM0 A;  2P8Q A;  4Y5J A;  3Q79 A;  3G2V A;  5LX8 A;  4CT7 B;  1PAQ A;  1Y2A C;  4N5Q A;  4EPZ A;  2FF4 A;  1E8W A;  3C98 A;  1OCO E;  3T9K A;  4L4I A;  3LVQ E;  3GZ2 A;  5T4Y A;  4CDM A;  5FQ4 A;  3BX2 A;  5J08 A;  3FH7 A;  2HO1 A;  1M8X A;  3L9T A;  3KAE A;  2H4M A;  2RG8 A;  5HKP A;  4AEZ C;  3UMV A;  1DCE A;  4DJS A;  3B7U X;  3B7S A;  3DSU A;  2EIN E;  2WXF A;  3J5Q B;  4KBQ A;  3OXG A;  4G8K A;  3FUK A;  2R59 A;  2J4D A;  2PM7 A;  3QKY A;  4ANV A;  1EJL I;  1N4Q A;  1Z3X A;  3FDH A;  2Y1L E;  4U07 A;  2VSX E;  2R17 C;  1IHB A;  1UJJ A;  4ANX A;  4K92 A;  4JHR A;  4P6Z B;  4A0C A;  2DZN A;  3UM3 A;  4HRM B;  2BKG A;  4HRN A;  5BPP A;  1V18 A;  4APO A;  3OBV A;  3FUN A;  5CL8 A;  5D66 A;  3SQV A;  3E33 A;  5H2X A;  4FZF A;  4LSZ E;  3RRM B;  3MEK A;  4A3T A;  5A6C A;  1O1R A;  1G3N B;  1K3Z D;  1SZA A;  3S7J A;  4B0Z A;  1QQE A;  3D9L A;  4GZC A;  4GTV A;  4RLY A;  3ZHE B;  1U3C A;  3CHP A;  3SY2 A;  2OEV A;  1RZ4 A;  2H6I A;  4WNF A;  4U5V A;  2OV8 A;  4WV6 A;  3CV0 A;  1OCC E;  3HIZ A;  4KZ0 A;  3GZ1 A;  4CYM D;  3CK9 A;  5D2M C;  4FFB C;  2C0L A;  1E7U A;  2XEV A;  3Q75 A;  3IFQ A;  2I2O A;  3NOC D;  3Q47 B;  4FJY A;  1A5E A;  1JUQ A;  1EPU A;  4JD2 G;  4U96 D;  2FEZ A;  1IHG A;  4KZC A;  4DX7 D;  2KZT B;  3PH0 C;  4JZY A;  2AXZ A;  2EIL E;  2DYR E;  2ILR A;  4JEH A;  1E8X A;  5FJY A;  1GW6 A;  3K7V A;  2MHK A;  2XA7 A;  3CLJ A;  3RU0 A;  3TWV A;  3FUH A;  4GYW A;  3GNI A;  3NMX A;  4PVZ A;  3J5P A;  1E90 A;  3HXF A;  2OT8 A;  4K0R A;  5LP0 A;  1UN0 A;  3DWL G;  4HI9 A;  1V55 E;  3R7R A;  5CCM A;  4OIH A;  4HS2 A;  1ZB1 A;  3VLF A;  3F6Q A;  3EIQ C;  4JEU A;  2WM9 A;  3CK8 A;  1YCS B;  1FT2 A;  3PE4 A;  3GQ2 A;  4JA9 A;  1DNP A;  5IY5 E;  3QK0 A;  2XEN A;  1NFI E;  3FUJ A;  2WQ7 A;  3JXZ A;  3PUJ A;  3UT8 A;  3N71 A;  2ION A;  2XZD G;  3FEY C;  1TR4 A;  3ZGQ A;  3EHR A;  5BYM A;  4HLL A;  4FAD A;  4I5N A;  1TJF A;  4U95 D;  4K5A B;  2WB2 A;  2X6H A;  2L6B A;  3QAR A;  4AM9 A;  4JXT A;  4UWG A;  5SW9 A;  3AG4 E;  3HXB A;  4BES A;  2KZT A;  4UQI B;  3NOW A;  5KBA A;  3VLE A;  1JPW A;  4JW2 B;  5KNH D;  3UIO C;  2PKG A;  1HXI A;  3ND2 A;  4WWO A;  3KSL A;  3Q5M A;  5EIL A;  1QYM A;  1QBQ A;  1QBK B;  2XA7 B;  3ISM C;  1W9C A;  4JHJ A;  3SF4 A;  5CHE E;  3FUM A;  2I1J A;  4U2X D;  1YYH A;  4ILH B;  2L9B A;  3ZYL A;  3JXI A;  3WOY A;  5FTP A;  2ZGG A;  1L5J A;  3E37 A;  1Z3Y A;  3Q9U C;  2XZT G;  1M8Y A;  2RKK A;  1PJM B;  4UAD A;  1UKL A;  4U04 A;  2X6I A;  3IHV A;  1O5M A;  4N3A A;  3KEA A;  3RRU A;  3TXN A;  3CVY A;  3ZUV B;  2JAB A;  3FTV A;  2P9U G;  2QMR A;  3ZIK A;  4B89 A;  3QJZ A;  4KVM A;  3V2O A;  3D9N A;  4LCT A;  5CMW A;  3EHN A;  2VGY A;  4A1G A;  3FEY A;  3U66 A;  4YDE A;  4URK A;  4J6I A;  4P29 A;  4GTS A;  2JKT B;  3C5W A;  1OXJ A;  2VYI A;  4DX2 A;  3BTR C;  5EWP A;  4JLQ A;  3X2Q E;  3UKU G;  4B94 A;  3O4X A;  1K1B A;  4ABN A;  1W63 A;  3Q0L A;  3QWP A;  4GYO A;  4G3A A;  3AU5 A;  4G23 A;  2IQC A;  2QYU A;  3RJV A;  4FP7 A;  4ILG A;  3T5X A;  3ZVV A;  4YK6 A;  5FQ7 A;  3V30 A;  1TJC A;  2JLB A;  1M8W A;  1TNY A;  3ZYM A;  3ZW3 A;  3CQC B;  1JWF A;  2NYJ A;  4JVS A;  4QMI A;  1BLX B;  4G8L A;  3TL5 A;  3ENE A;  4D10 C;  3E32 A;  2NC9 A;  3PE3 A;  2VTB B;  3ZIO A;  3LY9 A;  3ZFW A;  3BEE A;  3E34 A;  3FWV A;  4DI4 A;  3U9W A;  4R10 A;  1JDH A;  5HQ8 A;  2JAK A;  4K5C A;  3L08 A;  2I1K A;  4I1A A;  3ZN3 A;  4FLH A;  2IO2 C;  3O2T A;  4AOF A;  2XPZ A;  2BKU B;  3I5P A;  2Y4U A;  2OVB A;  4NZW A;  3DAD A;  3PEU B;  2LO6 A;  4OAU C;  3AAA C;  2AW6 A;  2XRZ A;  3CKB A;  5FZQ A;  2Z5K A;  1H2V C;  3CVW A;  5AIJ A;  2JKR A;  3CVV A;  4DX6 D;  5EDS A;  2L6J A;  3LTM A;  3ODS A;  3BCT A;  3MGB A;  5H7P A;  4ADY A;  3Q0P A;  3ZKV A;  5LCW J;  1O1S A;  4ANU A;  4AXH A;  2KAT A;  5M72 A;  1HS6 A;  4J8Y A;  3TWQ A;  3DXM G;  4GB9 A;  3JYS A;  3T7U A;  4N39 A;  3EDT B;  3Q9N C;  4XX5 A;  1QNF A;  4AJW A;  4XIF A;  3OXF A;  1KT1 A;  2HE0 A;  3CGH A;  5D0Q D;  4IUL A;  5K6S A;  2LXL A;  1P5Q A;  3ZU7 B;  3UL0 B;  3PZ1 A;  4TUM A;  2OND A;  4HB5 A;  1KZP A;  2J9Q A;  3FH5 A;  3NF1 A;  4AVX A;  2P9S G;  5KJN A;  3C2G A;  2X1G F;  1UJK A;  3LTJ A;  1IQR A;  4J8S A;  3UPV A;  2F0Y A;  1NZN A;  4GMO A;  3WYF C;  2X38 A;  3WXX A;  4WAF A;  4D4E A;  5G04 J;  1EJY I;  4U5U A;  5FQ6 A;  1QZ2 A;  5LOZ A;  5HHG E;  3O4Z A;  4EVP A;  4J8D A;  2X6K A;  5BW8 C;  3EG5 B;  3KD7 A;  2BF0 X;  1MX2 A;  4U58 A;  4GA0 A;  3ONK A;  4GCN A;  3ZYK A;  3B7T A;  1IYG A;  3WG7 E;  3FU0 A;  3TWW A;  5EX3 A;  2YNQ A;  2WMO A;  5ANR A;  4U5S A;  4RXH B;  4CV5 B;  1TNZ A;  5ENN A;  1V54 E;  3UXG A;  3W9G A;  1ELW A;  3ABK E;  5JJ6 A;  4O1P A;  5LCW C;  3D9M A;  3G2W A;  4FHJ A;  3C5R A;  3FTS A;  3P1U A;  4U5N A;  3FUF A;  2IF4 A;  2OEW A;  1ELK A;  4MLP A;  4OVU A;  4DX1 A;  2KCK A;  4FZA A;  3EIJ A;  3NMW A;  5CRV A;  2YJY A;  3EA5 B;  2PQN A;  3DEP A;  2QZA A;  4I2W A;  5BV1 A;  3ZHP A;  5KJL A;  4N2Q A;  1IQU A;  4EHM A;  4RVB A;  5J90 A;  3UKZ B;  3L3F X;  4WND A;  4BPL A;  4UWL A;  1Q2Z A;  1YMP A;  4GMJ A;  1AP7 A;  4FQ3 A;  2J8S D;  4JW3 C;  1LD7 A;  4CBA A;  5CL3 A;  4UQX A;  4J0U A;  1XM9 A;  4FLB A;  4HI8 A;  5CLD A;  4HNA D;  4CCA A;  4K6J A;  3CVQ A;  4UWH A;  3JUI A;  2C1T A;  1RW2 A;  4EV9 A;  3TT9 A;  1HU3 A;  2GGF A;  3UT4 A;  2GRR B;  4CEM A;  4GMR A;  3MCX A;  4E85 A;  2WQH A;  4E6H A;  1SVX A;  2PZI A;  4I43 A;  2BTD A;  5KJK A;  4DK5 A;  1N0R A;  5D5K C;  2V8S E;  5JJA A;  5KLR B;  4V3I A;  2F8X K;  1H6P A;  3UI2 A;  5SWF A;  4I6J A;  2LSU A;  2H6F A;  1KZO A;  1E8Z A;  3MKQ A;  2J07 A;  5AEI A;  3GVT A;  3CST A;  1TEZ A;  5D0O D;  3E30 A;  4L2L A;  3AS8 A;  1NI1 A;  4HQD A;  3ULY A;  3HXD A;  3U4T A;  3IXE A;  1Q1T C;  2QNA A;  3L13 A;  3R9A B;  3FTY A;  5ITZ F;  3S7F A;  4RZP A;  1DC2 A;  4AP2 A;  3Q73 A;  2DZO A;  2VGL B;  3D9I A;  3CR3 A;  3LKU A;  1LRV A;  5FZR A;  1OT8 A;  3SD5 A;  4IMJ A;  1O1T A;  4EZK A;  5JJT A;  3RKV A;  3HXE A;  3ZXP A;  4Q96 A;  3CVL A;  5A23 A;  1INZ A;  1N54 A;  4LEU A;  1I7X A;  4TNM A;  3TPM A;  2ZU6 B;  5AJD A;  2A5E A;  2DIW A;  3MKR A;  3ASO E;  5KNG A;  3S7D A;  5E76 A;  2VGL A;  1M5N S;  2IFU A;  3D3M A;  3EHM A;  3WOZ A;  2LAH A;  3HYM B;  3I4G A;  3GYZ A;  4U3J C;  3T8S A;  4H7Y A;  3D9P A;  4GA2 A;  3KS2 A;  4C0E A;  1EDU A;  3ZIR A;  4M7C A;  3IBV A;  1HH8 A;  4IRU A;  2BNX A;  1ZBP A;  3V74 A;  1UN9 A;  1N95 A;  4GPM A;  4GZ6 A;  5HRY A;  2IAE A;  1Y6I A;  4LUN U;  4PS7 A;  5CTT A;  2XGO A;  3NBN B;  3IEG A;  4TXQ A;  2Q7F A;  2WVI A;  4R7L A;  2WQ6 A;  3HVE A;  2V4L A;  4LER A;  2Y0B G;  5B56 A;  4CGV A;  1JPL A;  3PS6 A;  4JPS A; 
#chains in the Genus database with same CATH homology
 2BUG A;  5K9S A;  4EV8 A;  4IN3 B;  3L54 A;  3BVS A;  4TRQ A;  3ZXS A;  3FTV A;  4L1B A;  3SHF A;  3BX3 A;  3K5Q A;  3MA5 A;  4EQF A;  2QMR A;  3IBE A;  3ZIK A;  4B89 A;  4HXI A;  5T3R A;  3QJZ A;  1KLX A;  4KVM A;  4I1E A;  3LS8 A;  3QDN A;  3BSX A;  3D9N A;  3QOU A;  4LCT A;  3KND A;  2XGS A;  4YVO A;  3U66 A;  4MZ6 E;  5CMW A;  3OTN A;  3DW8 A;  4UWF A;  5HI7 A;  1EE4 A;  1IAL A;  3EHN A;  2C2L A;  1Z2C B;  2GL7 A;  4P6Z G;  2PL2 A;  2VGY A;  3CHM A;  3D9J A;  3FEY A;  3JXY A;  2CHW A;  3MYV A;  4ANW A;  5KLT B;  4GAA A;  4BSX A;  2AXV A;  5BV0 A;  4J6I A;  4URK A;  1Z6T A;  4YI0 C;  3UKW B;  4P29 A;  4WNE A;  4F3V A;  2JKT B;  1EE5 A;  3C5W A;  3FTZ A;  3GZS A;  4HOS A;  1QGR A;  4QMH A;  4U5L A;  1XQS A;  3NZS A;  5KUB A;  3L6Y A;  4KZG A;  4WWP A;  4ME2 A;  2CHZ A;  2WXG A;  5BZ1 A;  3Q0S A;  1XNF A;  2VYI A;  3QNK A;  4BFR A;  1MQS A;  2I9C A;  3BTR C;  3OQS A;  5EWP A;  3Q0O A;  4UAF B;  4H3H A;  3O2Q A;  3LYA A;  5E75 A;  2LSV A;  4JLQ A;  4HNM A;  3K4E A;  1VDY A;  3UQ3 A;  4B94 A;  3SI5 A;  3O4X A;  3IKO B;  4EEC A;  1B89 A;  3PSP A;  4F7A A;  1WA5 C;  3FGA B;  4I2S A;  4CDR A;  3SL9 A;  1W63 A;  4ABN A;  5G55 A;  3CHO A;  3Q0L A;  2IX3 A;  4N2S A;  3QWP A;  3SLA A;  4XKB A;  2XQ0 A;  4CRU B;  4GYO A;  4NRH B;  4XI0 A;  2NYL B;  4G3A A;  3AU5 A;  3APF A;  3UKX B;  4AIF A;  3G2U A;  3HHM A;  2IQC A;  4G23 A;  4AY5 A;  2AWI A;  3GAE A;  2VSO E;  4I2Z A;  5J3V A;  3RJV A;  4FHK A;  1WAO 1;  3MV3 B;  2VJ8 A;  1OWO A;  3BSB A;  1O6O A;  5JJ7 A;  3GS3 A;  3OUX A;  4FP7 A;  1OWL A;  2DBA A;  2MOW A;  4ILG A;  3T5X A;  3CHR A;  4N3C A;  3ZVV A;  4YVQ C;  4YK6 A;  2IWH A;  3ASH A;  3ZEF A;  2J09 A;  5FQ7 A;  4U0U A;  2Y4T A;  3BWT A;  1TJC A;  2JLB A;  3FTU A;  5ARF A;  3VLD A;  1M8W A;  2YHC A;  2YIN A;  4E4V A;  5BT1 A;  4CT6 B;  4KYO B;  3QML C;  5CL4 A;  5HUY C;  3ZYM A;  3FP3 A;  4M3O A;  5FWQ A;  4DLO A;  4Q69 A;  4ACL A;  3CQC B;  3ZW3 A;  2E2E A;  3FFL A;  3ASD A;  4I6I A;  1JWF A;  4BY6 A;  3T5V A;  3PUK A;  4JVS A;  4QMI A;  1TE4 A;  2XCB A;  3NZU A;  4GZ3 A;  4EBA G;  4BA3 A;  3TL5 A;  2X3M A;  5FQ8 A;  5JHA A;  4CT4 A;  4L2Y A;  3VE6 A;  3ENE A;  4D10 C;  2J08 A;  1E8Y A;  1B3U A;  3FU6 A;  4G25 A;  4DLQ A;  3PNL B;  4B8O A;  2NC9 A;  3PE3 A;  2VTB B;  3ZIO A;  2GW1 A;  4HM9 A;  2UY1 B;  3LY9 A;  4I1M A;  4K03 A;  3ZFW A;  4EBA A;  4GZ5 A;  3BEE A;  3JQ0 A;  3O48 A;  3ML9 A;  3FWV A;  4DI4 A;  2RU4 B;  3LVR E;  4V3Q A;  5HUW C;  3U9W A;  3E4B A;  4PLQ A;  4R10 A;  1JDH A;  2FUL A;  2Z5O A;  3JCK C;  2YNR A;  3BG0 B;  5ANL A;  2JAK A;  5HQ8 A;  3L08 A;  2I1K A;  2NXP A;  2VQ2 A;  2V0P A;  3RK6 A;  3ZIQ A;  4I1A A;  4XZ4 A;  3ZN3 A;  1OWN A;  1EF1 C;  3QG9 A;  2LNI A;  3L6A A;  3LPZ A;  1NA3 A;  4FLH A;  4OYS A;  4U54 A;  2CHX A;  3O2T A;  4Q94 A;  4DZS A;  4AOF A;  2XPZ A;  3FHE A;  2CFU A;  3L22 A;  4PLR A;  2BKU B;  1LF8 A;  3I5P A;  4I6E A;  4XZR B;  1S0P A;  2WXK A;  4PDX A;  2QK1 A;  2Y4U A;  2IE3 A;  3TG5 A;  4I3N A;  2IOS A;  2OVB A;  4NZW A;  4JW1 A;  5SVZ A;  4A3V A;  3DAD A;  3W3U A;  3PEU B;  2NSZ A;  3IHY A;  4U8H A;  3JX7 A;  2LO6 A;  2QFC A;  2PF4 A;  1H19 A;  3ZHE A;  2AW6 A;  2W3C A;  2XPI A;  3D9O A;  2XRZ A;  3CKB A;  2EQX A;  5KLA A;  4GML A;  5DIZ A;  4L7T A;  2Z5K A;  5FC8 E;  5FZQ A;  1H2V C;  3UX4 A;  2FO7 A;  4EZL A;  3CVW A;  4DB8 A;  3FU5 A;  5AIJ A;  2JKR A;  2Z5N A;  4GYY A;  4CB8 A;  3CVV A;  4G24 A;  3Q15 A;  2L6J A;  4DBA A;  3JQ1 A;  3SNX A;  5EDS A;  1PY1 A;  2L0I A;  3LTM A;  3CSF A;  4MRU A;  3PVL A;  3AU4 A;  2WTK A;  4MFU A;  1XGW A;  3ODS A;  3TX7 A;  3BCT A;  3QAQ A;  5G2N A;  1PJN B;  3U64 A;  3CVN A;  4CB9 A;  4XE0 A;  1X5B A;  4HOU A;  3MGB A;  1OWM A;  2CFZ A;  4UAE A;  4L4H A;  4ADY A;  2OOE A;  4MZ5 E;  4KXK B;  4GMN A;  4EPZ A;  3VWA A;  3Q0P A;  1OWP A;  4RG9 A;  2VGX B;  4JA7 A;  3TXN A;  3ZKV A;  1FVH A;  4IYP A;  4UI9 J;  2YQ8 A;  5CLA A;  4APF A;  3SBT B;  5LCW J;  3MJW A;  4UWK A;  2KAT A;  4HFG A;  3K64 A;  4GCO A;  4CRV B;  5T8I A;  4AXH A;  4ANU A;  2KCL A;  5AJL A;  4C0M A;  2QK2 A;  1HS6 A;  4B8J A;  3APC A;  4CGW A;  5M72 A;  1QZ7 A;  5CMY A;  4GB9 A;  1WY6 A;  2A5U A;  3JYS A;  3K5Z A;  1HG5 A;  1TH1 A;  3T7U A;  4N39 A;  1W63 B;  3EDT B;  1Q1S C;  4XX5 A;  1QNF A;  4CDN A;  4GZD A;  3Q0N A;  2GRL A;  4G11 A;  4XIF A;  4AJW A;  3OXF A;  3TJ3 A;  4FZD A;  3UL1 B;  3GB8 A;  1KT1 A;  2AVP A;  3CGH A;  3EJN A;  2UWJ G;  3ZIN A;  1LUJ A;  3L16 A;  3Q49 B;  4IUL A;  4W9R A;  5D0Q D;  3MX3 A;  3DPD A;  3Q4A B;  5K6S A;  2FI7 A;  3L3Q A;  3FUD A;  2VGX A;  3FY4 A;  3S2A A;  3T8M A;  1P5Q A;  3RRM B;  3UL0 B;  2V5F A;  3MV2 B;  1M1E A;  2NYM A;  2HR2 A;  4DJA A;  1OYZ A;  3ODR A;  4AV7 A;  4U63 A;  3K5Y A;  3QWW A;  2OND A;  1IQ1 C;  5CL5 A;  5JHB A;  2YHE A;  2XOA A;  2WXP A;  3CIA A;  5CLB A;  4NEE A;  3RRN B;  3TGO A;  2J9Q A;  3O2S A;  3FH5 A;  3NF1 A;  2OF3 A;  2IU1 A;  3MZL B;  3D9K A;  2WXH A;  4QFV A;  3VTX A;  4A55 A;  4OO6 A;  5E6Q B;  4I0Y A;  5KJN A;  2FV2 A;  4U0S A;  3C2G A;  2X1G F;  4PS3 A;  2JKR B;  2Z5J A;  1UG3 A;  3LTJ A;  3K62 A;  1IQR A;  1UJK A;  4YJE A;  4I1O B;  4J8S A;  5EKQ D;  3OAW A;  3UPV A;  4L7M A;  4I8M A;  2Q5D A;  1NZN A;  4MS6 A;  4GMO A;  3WYF C;  3Q0M A;  2RU4 A;  4BX9 A;  2X38 A;  3U3W A;  4RV1 A;  4C0E A;  4UI9 K;  4KMO A;  5CCL A;  3WXX A;  4UQZ A;  1UPK A;  2YNS A;  3P2B A;  2BCT A;  2OVF A;  2WXM A;  4WAF A;  4D4E A;  4CRW A;  4PUC A;  5G04 J;  2VTB A;  3CVU A;  1EJY I;  4U5U A;  2P8Q A;  5FQ6 A;  1QZ2 A;  5LOZ A;  4Y5J A;  2JDQ A;  1UN8 A;  1IBR B;  1EYH A;  3G2V A;  2Z6G A;  5LX8 A;  5HHG E;  3ONL A;  4CT7 B;  3O4Z A;  4EVP A;  5DN7 A;  3OPB A;  3TPO A;  1PAQ A;  3LY8 A;  1Y2A C;  4J8D A;  4A1S A;  4F1S A;  3AS4 A;  4DVG B;  5LSW A;  3L17 A;  2FF4 A;  3TJP A;  1E8W A;  2X6K A;  3C98 A;  5G05 C;  3SZ7 A;  5BW8 C;  3EG5 B;  3KD7 A;  2CG3 A;  4PLS A;  2BF0 X;  1I7W A;  5KJL A;  4L4I A;  4U58 A;  3FEX C;  3LVQ E;  4GA0 A;  3GZ2 A;  3ONK A;  4NUR A;  1JPP A;  4YGX A;  2X6F A;  4GCN A;  5T4Y A;  5FQ4 A;  1UW4 B;  2XGM A;  4J8F A;  3ZYK A;  1IYG A;  3UT7 A;  1HE8 A;  3B7T A;  3PZD A;  3WPT A;  3JY1 A;  3BX2 A;  3FH7 A;  3RO2 A;  5J08 A;  4I96 A;  2HO1 A;  2NYM B;  2UY1 A;  2IE4 A;  1M8X A;  4ATG A;  4A1G A;  3ASF A;  5BNW A;  2IAE B;  3KAE A;  3FU0 A;  2H4M A;  2RG8 A;  4G26 A;  3B7R L;  4PH4 B;  5EX3 A;  4HOQ A;  3UMV A;  3URZ A;  5CL7 A;  4AEZ C;  3HDX A;  2YNQ A;  2WMO A;  4DJS A;  3B7U X;  2P58 C;  4U5S A;  2WXN A;  4RXH B;  1UPL A;  3B7S A;  5ANR A;  4CV5 B;  5CLC A;  3QWV A;  3CKC A;  4V3R A;  4XKC A;  4CDM A;  3ASG A;  1HX8 A;  3K7W A;  1IB2 A;  4I7I A;  1OUV A;  2WXF A;  4KBQ A;  1G3J A;  5ENN A;  4MKT A;  3A6P A;  3APD A;  2GRM A;  4PS8 A;  3OXG A;  3FGA A;  3FUK A;  2R59 A;  2J4D A;  3UKY B;  1BK6 A;  1ELW A;  1WM5 A;  2PM7 A;  3AS5 A;  3QKY A;  5ARG A;  5JJ6 A;  1EJL I;  4EZJ A;  3EBB A;  3ZIP A;  1Z3X A;  5CL9 A;  3QGB A;  5DBK A;  4GPK A;  2Z5M A;  4R11 A;  3FDH A;  3KEZ A;  1XQR A;  5LCW C;  3NQP A;  2Z6H A;  3D9M A;  4U07 A;  2VSX E;  3G2W A;  2R17 C;  2DCP A;  3PST A;  1UJJ A;  4FHJ A;  4L23 A;  4K92 A;  4JHR A;  4ANX A;  3FTS A;  3P1U A;  4ANV A;  4P6Z B;  4U5N A;  4A0C A;  3FUF A;  1ELR A;  4BWR A;  1BPO A;  2IF4 A;  4YJL A;  3TJZ B;  1ELK A;  3G2T A;  5H2W A;  5BPP A;  2NYL A;  4MLP A;  1HG2 A;  4OVU A;  4NQ0 A;  1U6G C;  1V18 A;  3DBS A;  4APO A;  1N52 A;  2KM4 A;  2WMN A;  3OBV A;  3TG4 A;  3QHE A;  3FUN A;  4BTA A;  3CVX A;  2KCK A;  3AU3 A;  5CL8 A;  4FZA A;  4B8P A;  3EIJ A;  4HOR A;  5H2X A;  3NMW A;  4FZF A;  2C0M A;  2YJY A;  5C2Y A;  3EA5 B;  4A3T A;  1WA5 B;  1H2T C;  2KCV A;  2PQN A;  3LCA A;  3MEK A;  3CQG B;  4ILI A;  3ZYQ A;  1SZA A;  3S7J A;  4B0Z A;  2E0I A;  4N2Q A;  4J8E A;  4FUL A;  3ZIM A;  1QQE A;  3D9L A;  4I2W A;  4GZC A;  3ZHP A;  4EVA A;  1H0A A;  2WXL A;  3ZHE B;  5BV1 A;  3V71 A;  1IQU A;  1U3C A;  4I9C A;  4O6F A;  3CHP A;  2WPV A;  2CG2 A;  3K61 A;  1U3D A;  4WNF A;  4CT0 A;  3I3N A;  4RVB A;  4I37 A;  5J90 A;  5A6C A;  2A4Z A;  3UKZ B;  3LY7 A;  1W3B A;  3ZRH A;  3LJ3 A;  5C1D A;  3ML8 A;  3FEX A;  3L3F X;  4U5V A;  4WND A;  4BPL A;  4UWL A;  4B8A A;  4GMJ A;  2OV8 A;  4BT8 A;  2JKT A;  3ZIL A;  4FQ3 A;  4WV6 A;  1FCH A;  3CV0 A;  3VTY A;  4HOT A;  4JHK A;  4TV3 A;  4JW3 C;  2LAI A;  3HIZ A;  5BUZ A;  3G2S A;  4CBA A;  1KT0 A;  3IV0 A;  5CLE A;  4KZ0 A;  3UUX A;  5CL3 A;  4I9E A;  4DB9 A;  3GZ1 A;  3K9I A;  4UQX A;  4MFV A;  2IW3 A;  1XM9 A;  3RZX A;  3CK9 A;  4FLB A;  3Q5U A;  4FFB C;  2NPP A;  2WXQ A;  4J0U A;  4DPR A;  4EVT A;  2C0L A;  5CLD A;  1E7U A;  2XEV A;  4CCA A;  3IFQ A;  2I2O A;  4Y6W A;  3Q47 B;  4FJY A;  1JUQ A;  4GU5 A;  1O6P A;  3SFZ A;  4K6J A;  3ESL A;  1EPU A;  3CVQ A;  1QGK A;  2HYZ A;  2X6J A;  4UWH A;  2XHE A;  3JUI A;  2C1T A;  2FEZ A;  1IHG A;  3SBS A;  4KZC A;  4N3B A;  4EV9 A;  3TT9 A;  1HU3 A;  4C9B B;  1E96 B;  2GGF A;  3UT4 A;  4HTV A;  2KZT B;  3PH0 C;  4CEM A;  3MCX A;  4E85 A;  4JZY A;  4U5O A;  2WQH A;  4LRZ A;  3LWW A;  3C2H A;  1M8Z A;  2AXZ A;  3CHS A;  3HVE B;  3LDZ A;  4DI3 A;  1T08 A;  4E6H A;  5EKG A;  4V3O A;  2PZI A;  1SQM A;  4I43 A;  3V6Y A;  2ILR A;  4HXT A;  2Y3A A;  4JEH A;  3ULQ A;  4BT9 A;  4LAC A;  5BZ5 A;  1E8X A;  2BTD A;  4B8C B;  4GA1 A;  5FJY A;  5KJK A;  1GW6 A;  4DK5 A;  2J4B A;  2I6H A;  3K7V A;  5D5K C;  2XA7 A;  2MHK A;  2V8S E;  3H3D X;  5JJA A;  3CLJ A;  3RU0 A;  5KLR B;  3FUH A;  4GYW A;  4RSY A;  5G04 C;  4V3I A;  1HF8 A;  4AVX A;  3GNI A;  3BG1 B;  3PDN A;  4I17 A;  5SWF A;  4AY6 A;  4I6J A;  4YND A;  2LSU A;  2WXR A;  1FVF A;  4O27 A;  2QY7 A;  3NMX A;  5CL6 A;  1E8Z A;  1E7V A;  2J07 A;  2MRI A;  3MKQ A;  3PRE A;  5AEI A;  3PEV B;  3GVT A;  3RZ9 A;  3CST A;  4PVZ A;  3GW4 A;  1E90 A;  4UQI A;  3I4R B;  2OT8 A;  1TEZ A;  4B18 A;  4K0R A;  4L2L A;  5D0O D;  5FZS A;  5AYW D;  4HLE A;  5LP0 A;  4WNG A;  2WXO A;  3AS8 A;  3PRZ A;  5G05 J;  4N5C A;  4F53 A;  3FTX A;  3FU3 A;  1UN0 A;  3FUL A;  4FC8 A;  4TUU A;  3U4T A;  1H2U A;  4KT6 B;  2J49 A;  1Q1T C;  2QNA A;  3L13 A;  1ZU2 A;  3R9A B;  3FTY A;  3TAX A;  2IOL A;  3FTW A;  3S7F A;  4RZP A;  3R7R A;  4AP2 A;  2F31 A;  4OIH A;  2L0T B;  2PQR A;  5CCM A;  3OUW A;  5KCM A;  5LFA A;  4RG6 A;  4HS2 A;  2VGL B;  3D9I A;  4BX8 A;  3VLF A;  3NMZ A;  3CR3 A;  4G2V A;  3FUE A;  3LKU A;  1LRV A;  5FZR A;  4U0Z A;  3EIQ C;  5KL1 A;  4JEU A;  2WM9 A;  2X19 B;  3SD5 A;  4IMJ A;  3CK8 A;  1JWG A;  3PE4 A;  3GQ2 A;  4JA9 A;  1DNP A;  4EZK A;  4DB6 A;  5JJT A;  3LEW A;  3RKV A;  5BZV A;  1NP7 A;  3CHQ A;  2C1M A;  3CVL A;  3LXU X;  4Q96 A;  5A23 A;  1INZ A;  4R0Z A;  4IMI A;  1NA0 A;  1N54 A;  2AXU A;  2HM8 A;  3B13 A;  3QK0 A;  4LEU A;  4NAC A;  1I7X A;  5EX0 A;  3QB2 A;  3FUJ A;  4TNM A;  3TPM A;  2ZU6 B;  1A17 A;  4ZDU A;  5AJD A;  2DIW A;  3TXM A;  2WQ7 A;  3JXZ A;  2WXI A;  2XPY A;  3MKR A;  3PUJ A;  3N71 A;  2ION A;  4UI9 C;  4XI9 A;  1SZ9 A;  3UT8 A;  3S7D A;  3FEY C;  3Q0R A;  5E76 A;  5A7D B;  3ZGQ A;  1HO8 A;  2VGL A;  4UWX A;  5BYM A;  4BQK A;  4OVV A;  3SGH A;  4FAD A;  4I5N A;  1M5N S;  1TJF A;  2IFU A;  4FU3 A;  3D3M A;  2JEK A;  5AEN A;  2VSN A;  1H6K A;  3EHM A;  3L6X A;  4FDD A;  2PM6 A;  3FH8 A;  3WOZ A;  3S7B A;  2LAH A;  4H7X A;  2WB2 A;  3FUI A;  2X6H A;  4ACK A;  2XRY A;  3QAR A;  4JL0 A;  4JKQ A;  4AM9 A;  4BTB A;  3HYM B;  3I4G A;  4JXT A;  5SW9 A;  4UWG A;  3ZPJ A;  3GRL A;  3GYZ A;  1PC2 A;  4UQY A;  4U3J C;  4H7Y A;  5KL8 A;  4D49 A;  3D9P A;  2BAP A;  3KS2 A;  2WXJ A;  1F59 A;  4GA2 A;  1BK5 A;  1EDU A;  3ZIR A;  2KZT A;  2IJG X;  4UQI B;  3IBV A;  2R5S A;  3NOW A;  4JC8 A;  3R7Q A;  5FT9 A;  1HH8 A;  4IRU A;  3VLE A;  1JPW A;  4JW2 B;  3CEQ A;  2BNX A;  3K49 A;  3V74 A;  2PKG A;  1UN9 A;  1ZBP A;  1HXI A;  3ND2 A;  3MKQ B;  4G1T A;  4QMJ A;  5BZU A;  4KVO A;  5KJM A;  4I5L A;  3PNT B;  4WWO A;  4Y6C A;  2VSY A;  4I6G A;  5EKF A;  1Y8M A;  3Q5M A;  4GZ6 A;  1QBK B;  2IAE A;  3UVU A;  1Y6I A;  4LUN U;  2XA7 B;  4PS7 A;  5CTT A;  2XGO A;  4H3K A;  1W9C A;  4FJZ A;  4JHJ A;  1DVP A;  3IEG A;  3SF4 A;  3GVO A;  1HFA A;  3FUM A;  2I1J A;  5CHE E;  2FBN A;  2Q7F A;  2NPP B;  4U2X D;  3CVP A;  2WVI A;  4R7L A;  1MHQ A;  2WQ6 A;  4JW2 A;  4ILH B;  2M63 A;  1GCJ A;  3RIB A;  3HVE A;  3QGC A;  2L9B A;  2KC7 A;  3ESK A;  3ZYL A;  4FA6 A;  2V4L A;  3RO3 A;  4LER A;  3WOY A;  5FTP A;  2DB0 A;  5B56 A;  1L5J A;  1YA0 A;  1Z3Y A;  4CGV A;  1M8Y A;  1PJM B;  3OXL A;  4UAD A;  1JPL A;  1UKL A;  2XCC A;  2X6I A;  3IHV A;  3PS6 A;  4U04 A;  4HVB A;  4N3A A;  1HZ4 A;  3CK7 A;  3Q0Q A;  4JPS A;  4WWN A;  4WUY A;  2RD0 A;  3RRU A;  3QC1 A;  3CVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...