3VLEA

Crystal structure of yeast proteasome interacting protein
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
456
structure length
435
Chain Sequence
NLLTQLENELNEDTLLRKCSLNLVTVMDVKPLLATIKRFLTSDYLLDVVDKLVPMADFDDVLEVYSAEDLVKALRSEIDPLKVAACRVIENSQPKGLFATSNIIDILLDILFDEKVENDKLITAIEKALERLSTDELIRRRLFDNNLPYLVSVKGRMETVSFVRLIDFLTIEFQFISGPEFKDIIFCFTKEEILKSVEDILVFIELVNYYTKFLLEIRNQDKYWALRHVKKILPVFAQLFEDTENYPDVRAFSTNCLLQLFAEVSRIEEDEYSLFKTMDKDSLKIGSEAKLITEWLELINPQYLVKYHKDVVENYFHVSGYSIGMLRNLSADEECFNAIRNKFSAEIVLRLPYLEQMQVVETLTRYEYTSKFLLNEMPKVMGSLIGDGSAGAIIDLETVHYRNSALRNLLDKGEEKLSVWYEPLLREYSKAVNGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA mismatch repair protein HSM3
publication title Structural basis for specific recognition of Rpt1, an ATPase subunit of the 26S proteasome, by a proteasome-dedicated chaperone Hsm3
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 167
structure length 435
sequence length 456
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18794 HSM3_C DNA mismatch repair protein HSM3, C terminal domain
A PF18795 HSM3_N DNA mismatch repair protein HSM3, N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.50 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 3vleA01
1.25.40.580 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3vleA02
3VLDA 3VLFA 4A3VA 4A3TA 4FP7A 3VLEA
chains in the Genus database with same CATH superfamily
4I6IA 4JL0A 4DX2A 1E8XA 3G2WA 3Q49B 5KJNA 4FHJA 5HI7A 1JDHA 4XE0A 5CL6A 3WOZA 1HF8A 3BWTA 1SZAA 3UI2A 3LY8A 2WQ7A 3ABME 2C2LA 2YNRA 3BSXA 1PJMB 3LDZA 4WNGA 3UMVA 1N4RA 4HQDA 2XEEA 2IQCA 4EV8A 3FH7A 4K92A 2AVPA 3LEWA 4UADA 4L7TA 4DX1A 3EIJA 1WM5A 1JPPA 4GPMA 3CEQA 2GRRB 1AP7A 1HG2A 1RZ4A 1IQ1C 3L3FX 2I1JA 2P9NG 4NACA 2XEHA 3FUFA 3RZXA 4I37A 3QAQA 2XQ0A 2P9UG 4DLQA 5H2WA 1MQSA 3ZIKA 2AW6A 4BT8A 4F1PA 2IW3A 3A6PA 2KZTB 4YVQC 4LUNU 1IKND 2NPPA 4HM9A 3SL9A 3V74A 2XGSA 4J7WA 3TT9A 2EIKE 1BLXB 3DSWA 5JHBA 4H3HA 1OCZE 4HB5A 2QY7A 3HXEA 2A5EA 2Q7FA 3MJWA 4GTMA 5E76A 5HS0A 3WPTA 3JXZA 4ATGA 3PVLA 1JUQA 4EVTA 4JA9A 4N39A 3PUKA 1MX4A 3WG7E 2WXHA 4AEZC 3PDNA 3UKRG 4ANXA 3Q0OA 4G24A 4LEUA 4DI4A 5B3SE 4RQIA 2FF4A 3UKUG 3QG9A 2X1GF 2WXFA 2DZOA 4F53A 3EJNA 2DYRE 2JKTA 2PKGA 1LF8A 3FTSA 5ENTD 4R0ZA 2GRMA 1PY1A 3SLAA 4I6EA 4FJZA 4RLYA 4OVVA 4UUCA 4EZLA 4ZDUA 3B7TA 5FC8E 3B95A 4DZSA 3NF1A 4UWHA 1GCJA 3ESLA 3DSVA 4DB8A 3MKQA 4LNUD 3K64A 3OBVA 3NBNB 3UL1B 3FUMA 3K9IA 5E6QB 4A3VA 1IXVA 3L13A 3NB2A 4WNFA 5FQ6A 3GQ2A 5ITZF 4B94A 3IXEA 1S0PA 3FTZA 3TG4A 3RIBA 4JD2G 3D9PA 3E4BA 5KCMA 1X81A 3G2TA 4Y6WA 5SVZA 4A63B 3O2SA 4B93B 3ZGQA 1S63A 4GTVA 4GAAA 5KL8A 3TWVA 3LTMA 4TUUA 5AARA 1JPWA 3GNIA 3QMLC 4GZ5A 3APCA 4L23A 3AAAC 3PUJA 2I6HA 3JXYA 5KUBA 2IU1A 3S7DA 2PQRA 1KT1A 4HRMB 4EHMA 3JQ1A 1K1AA 1E7UA 4BA3A 3JYSA 4BFRA 3ASFA 4JLQA 4HBDA 3QNKA 2IX3A 3L17A 4NIKA 1BI7B 3HXDA 4B18A 2YQ8A 3KEZA 3JCKC 1LRVA 3CK7A 3ASHA 4JA7A 4Z68A 4EPZA 4G8KA 1H6OA 2OV8A 2H6HA 2IAEB 1MX2A 4U2XD 1ZU2A 2VGXB 3CVYA 5KJLA 4XZ4A 3ODRA 3ML9A 3TWUA 3B7SA 4OAUC 1SQMA 3CLJA 3HDXA 5ENPD 5ARFA 3Q0MA 4J8YA 1MYOA 5CLEA 4I9CA 3UTMA 1BK6A 2RFMA 4FZDA 3UPVA 4GZ6A 3HVEB 3SNXA 5HUYC 2B6CA 4PH4B 3I4RB 5EYLA 1QYMA 3TG5A 2UY1B 3ZHEA 4DI3A 4FADA 4GMRA 3C3RA 1HO8A 3HXCA 1LSHA 3NOCD 4KZ0A 1UW4B 3CVNA 4L4IA 3LS8A 5EKFA 2Z5KA 2LUHA 2RKKA 3OXFA 4CZ2D 3CHSA 2EINE 4GB9A 2H6FA 1FT2A 5HHGE 3T8KA 3QOUA 4TRQA 1ELWA 1IALA 4HORA 2IF4A 3CSFA 2DCPA 5BZVA 4I1AA 4U04A 4ZFHA 4WNEA 4BX8A 1H2UA 3NZUA 4I6GA 1OWNA 2LSUA 2Y4UA 3MGBA 1NA0A 2VTBB 3TWTA 5A23A 3TWQA 2V5FA 4DX7D 4YDWA 1XQRA 2WTKA 5LSWA 2WXNA 3AU4A 1YYHA 1N4PA 1EE4A 2YINA 3RAUA 1YCSB 3CKCA 4UWFA 4GTSA 2WXGA 3UJ0A 2QMRA 4BSXA 3X2QE 3ZYQA 2V4LA 5FWQA 4JHJA 4O27A 3QKYA 2YNQA 3UKZB 3Q5UA 4B89A 3UIOC 1TR4A 4I0YA 4GA2A 3HG0D 4L1BA 3JUIA 1UPLA 4BT9A 4RVBA 3V2OA 3T8MA 1UJKA 3C5WA 4CRUB 1XNFA 5AN8A 3BQOA 1OWLA 4EZJA 3APFA 4JEHA 4Y6CA 2DZNA 3FEXC 5CL3A 3ZIPA 3ZKJA 4C48B 3VLFA 3GW4A 3FGAB 4WWOA 3MX3A 2PF4A 4I2WA 2VGYA 2ZXWE 2JKRA 2WQ6A 5EX3A 2PNNA 4GCOA 3MZLB 3AG4E 1H6KA 4U63A 3L6YA 3RRUA 4FHKA 3BCTA 5HUWC 4ANUA 3SQVA 4IMJA 3N71A 3OXGA 2P8QA 1TNBA 2AXVA 1MHQA 2JEKA 3LXUX 1KT0A 3ZUVB 2WMNA 1IBRB 4URKA 4CV5B 3DSSA 3BX3A 2BF0X 4LACA 4FULA 4LCTA 3IBVA 2WPVA 1TE4A 4CCAA 5D5KC 3K5YA 2X38A 2WXLA 4G25A 2XOAA 3E30A 3O48A 4HOUA 3ZHPA 4N5QA 1UG3A 3NZSA 4QFVA 4G1TA 3UT8A 4K5BA 1EF1C 3GAEA 3LVQE 3AS5A 4E85A 3ZN3A 2IO3C 3Q15A 1BPOA 3ZXPA 5HQ8A 3D9NA 3W9GA 4UQIB 4U3JC 3LY7A 3PE3A 1NZNA 3BEEA 3EDTB 3QB2A 4L9PA 2R05A 4B8AA 3PREA 1QGRA 5CMWA 3EUVA 2LSVA 4NRHB 2Y4TA 3FWVA 2QC9A 1NI1A 2XS8A 1NFIE 4ANWA 5KLAA 4KVOA 5FZQA 3LCAA 5KJKA 4H7XA 1OUVA 2FV2A 3T5VA 3L6XA 1QNFA 4Q94A 4A0CA 4YI0C 2P9IG 3D9HA 4UQZA 5CLDA 5BNWA 4GYYA 3FUNA 1S64A 2C1MA 1W63A 2WB2A 4XEIG 1V54E 4ME2A 2VJ8A 4DJSA 4U8YD 1D9SA 4CT6B 3Q75A 2XRZA 3IFQA 5A6CA 4U8HA 2VGLA 5J08A 1XM9A 2XENA 1H2TC 3LTJA 4GTRA 1Z3YA 4NURA 3FTXA 4E4VA 4XX5A 3FFLA 2ETAA 4FFBC 3FTUA 3T7UA 4MBGA 1ZB1A 1FVFA 3DRAA 2RU4A 2I1KA 2QNAA 3UT4A 3FUKA 5CRVA 4BPLA 4AVXA 2NYJA 5BUZA 4ILHB 1AWCB 4AM9A 3TL5A 1LTXA 3CHQA 5FJYA 5ENRD 1U3DA 3MKRA 3WOYA 2EQXA 2W3CA 2BAPA 3ML8A 5JHAA 3K7WA 3UL0B 3RO2A 4YGXA 4RSYA 3GVTA 5ANLA 3ULYA 2J08A 2LAIA 3QK0A 3AG1E 3LKUA 3KEAA 5E75A 5G05C 1B89A 5CERB 4HLLA 4AJWA 2F0YA 1WA5B 3KD7A 4JKQA 1DCEA 4XKCA 3CIAA 4G23A 2NSZA 3RKVA 5KBAA 3DWLG 2UWJG 4W9RA 2PM6A 3AS4A 4QMHA 4F7AA 4AXHA 1RW2A 2L0IA 5AQ7A 2V5QC 2LXMA 5LX8A 4WNDA 4TNMA 3IEGA 3EHNA 3B7RL 1TH1A 2IONA 3ISMC 4FC8A 2Z6HA 3FULA 5CEAA 4WWNA 2P58C 4U0SA 5CTTA 4NZWA 2MHKA 1OYZA 1LD7A 5FT9A 2H4MA 4C0MA 2BKUB 3ONKA 3APDA 2AWIA 2Z5OA 3DSTA 4J6IA 2ZU6B 2XA7B 4KXKB 4R7LA 1U6GC 2CHWA 3S7FA 2DWZA 4GCNA 5JJ6A 3TXNA 3VWAA 3K5QA 4BQKA 2QYUA 1OWPA 1UOHA 4B0ZA 1MZCA 2WXMA 2X6HA 3S7BA 5H7PA 4GPKA 3OAWA 3C3OA 3PEUB 4EZKA 1U3CA 2P2CP 2C0LA 2L6JA 4YK6A 2JKTB 4U7EB 3MV2B 3RZ9A 1HS6A 3QWVA 4DK5A 4XI0A 2IE3A 5H2XA 3RRMB 4YJLA 2XCCA 5ENQD 1EDUA 3CVQA 3ESKA 1N94A 2NYLB 3B7BA 4V3RA 3ODSA 2I9CA 3D9OA 2I2OA 3TX7A 1E8WA 5ENNA 5CL4A 3RRNB 4C9BB 2CFUA 3EU9A 3FTYA 4FA6A 3D9IA 1L5JA 2P9KG 5FTPA 3RK6A 2XPIA 3NQPA 3T8SA 3TGOA 4F3VA 4DVGB 4J8EA 5D0QD 2WMOA 1IYGA 2LNIA 4JZYA 2P9PG 1O1TA 3SBSA 2F8YA 5DN7A 4GMLA 2HM8A 5FQ8A 2ZGGA 2C1TA 4DB6A 2R03A 4A55A 3Q0PA 2OCCE 3P2BA 4CDMA 4I1OB 5JMND 3ASNE 1HE8A 3AU3A 4JPSA 1M8YA 2IWHA 4JVSA 4U8VD 2NXPA 4MFUA 3UJ4A 1TN7A 3C5RA 5AJDA 2VSNA 4B8CB 1OCRE 5CRUA 3ZINA 3QWWA 5KNGA 4U07A 3Q0NA 3V6YA 4HVBA 4UQYA 3S2AA 3ZFWA 4M7CA 3UKXB 4K6JA 5AQBA 3CVUA 3QDNA 3ZXSA 3I3NA 3UT7A 3NOWA 3PSPA 3K4EA 3TWXA 5CEDB 2V4HC 3SHFA 3W9FA 2MRIA 3U66A 5ENOD 4P6ZG 4I7IA 2R17C 3CQGB 1A17A 4JW3C 4HTVA 4XI9A 3ASDA 4IYPA 4MS6A 1WY6A 5G04C 1I7WA 2Y69E 3I4GA 3URZA 4AIFA 2JDQA 1Z3XA 4J0UA 2PQNA 5EIDA 4KZGA 3QC1A 5JJAA 4PS7A 2E2EA 2PZIA 3TPMA 1W9CA 3HXFA 2NC9A 5KJMA 3ULEG 3C2HA 2VGEA 1WG0A 3U3WA 4YDYA 3JQ0A 2JABA 5LCWC 5LOZA 2CG3A 3DXMG 3V71A 3FUEA 4HS2A 5SWFA 4O6FA 1ELKA 3EIQC 3D9JA 4P29A 4QMIA 3Q79A 2NYMB 4RZPA 4L7MA 2KCKA 1NA3A 5D2MC 4GU5A 4DJAA 4QMJA 4BERA 5CBNA 2XGMA 1A5EA 5FQ7A 3DEPA 4G11A 4P6ZB 3HRAA 1JCRA 3PEVB 2AJAA 4EBAG 4J8FA 3ZW3A 1OWOA 3FU3A 2WXQA 2FEZA 2CFZA 2IOLA 4G8LA 3GZSA 4U5NA 2A4ZA 3AG2E 3FUJA 5K9SA 1SZ9A 2Q5DA 3RJVA 1QZ7A 2DIWA 3UKYB 3Q0SA 1S70B 4ANVA 1Q1SC 1V55E 3L22A 3K49A 4AY5A 2IAEA 4KYOB 4EQFA 4HNAD 2ZIRA 2VGXA 5CHEE 1HG5A 1Q2ZA 1I7XA 3K62A 3B7UX 2BKKB 4JW2A 5M72A 5DBKA 5DIZA 3PZ2A 3U64A 3SO8A 4CB8A 5EN5D 3GZ1A 3UM3A 2GRNB 3C98A 2QK2A 2YHCA 2DVWA 2XZDG 4B8JA 4UI9K 3HVEA 2R02A 4FJYA 1Z2CB 5KLTB 2UY1A 5KL1A 5CBOA 4PLQA 4OIHA 1UN9A 4O60A 1UPKA 3DW8A 4U5VA 3OUXA 3WXXA 1O6OA 1F59A 5BT1A 3V79K 3BUAA 2OEWA 4FDDA 3QJZA 3AS8A 3FU0A 3QARA 4AP2A 3MV3B 4DX6D 4RG6A 4KMOA 4A1GA 4D49A 2DYSE 2GRQB 4N2SA 1N0QA 2WM9A 3BX2A 3U4TA 3FUDA 1HXIA 2WXPA 2VTBA 4U5LA 3QWPA 2ONDA 2CG2A 3TJPA 3EBBA 2H6GA 1O6PA 3ULQA 4APOA 1EE5A 2Y3AA 1E96B 4ILIA 3IV0A 2LO6A 4A1SA 4DRXE 5CCLA 4HRLA 3TPOA 3UX4A 4UAEA 3ASGA 3DADA 2RFAA 1IB2A 3UXGA 2HR2A 4FLHA 3L3QA 4AV7A 3ZYMA 1PJNB 3QGBA 5BV0A 4JHRA 5AIJA 4UQXA 5BXUA 3CVWA 1K1BA 3RSEG 5C2YA 3QHEA 3FP3A 4GA0A 1O5MA 1Z6TA 5BW8C 1QBKB 2OF3A 4XKBA 3LYAA 1H2VC 2Z5JA 3GVOA 1SVXA 1SW6A 3ZYKA 4FP7A 3CQCB 3Q0LA 4CRWA 3FGAA 4AY6A 1E7VA 5HRYA 4HLEA 1N4QA 3VTYA 4TUMA 2VSYA 4BTBA 3FH5A 3OPBA 3FTWA 1DC2A 4N5CA 2ZISA 3FEYC 4GTTA 4UI9C 4CRVB 5D0OD 4UWXA 3FEXA 4I43A 3PNTB 3FUIA 5EX0A 5BZ5A 4I2ZA 4U5OA 3Q0RA 2BKGA 3EG5B 4LRZA 3DPDA 5EKGA 3VTXA 3PSTA 3NAWA 2KC7A 3WYFC 1UKLA 1TN8A 1OT8A 1YA0A 4D10C 4DUIA 3ZIQA 5CL5A 2XPZA 1EYHA 1XGWA 2QK1A 1TYQG 2BEDA 2YNSA 1OY3D 1FPPA 2CHXA 4XZRB 5BPPA 1H0AA 1TNZA 2BCTA 2ETCA 1OCOE 1HX8A 2P9SG 1DNPA 2Z6GA 3PZ1A 2C0MA 3NMZA 5CECB 5JA4D 2X6FA 4LSZE 1VDYA 2OVFA 4JXTA 4YJEA 3RO3A 4TV3A 3W3UA 1QZ2A 4J8SA 4PVZA 4FZAA 1WA5C 3E32A 1KZOA 1TNOA 4K0RA 3E33A 4PUCA 3DPYA 3ZU7B 1QGKA 2VYIA 3P1UA 4Q96A 3IBEA 4MKTA 1DCQA 4F1SA 3BG1B 2WXRA 5G05J 4OVUA 3TJ3A 1WAO1 4UWGA 2OEVA 5CL9A 3UM1A 3SBTB 3HXBA 4DX5D 4L2LA 4HFGA 1TEZA 1WDYA 4N2QA 1UN0A 2GROB 2HYZA 2P9LG 4UWLA 5FIOA 2H6IA 4ADYA 1G3JA 4O1PA 1TJCA 2J49A 2E0IA 4BETA 2CHZA 5EKQD 3IHYA 2FO1E 1BU9A 3PNLB 4MZ5E 5LFAA 1N4SA 3Q9NC 1SA5A 3RU0A 4XIFA 1BK5A 5EIBE 1K8KG 3G2VA 5G55A 2X6KA 4DBAA 2HE0A 3ZNGA 4L2YA 3C3QA 3FTVA 4KVMA 3R7QA 3KSLA 4JHKA 4HI8A 5HKPA 4N3CA 3L6AA 3CGHA 2NPPB 3DEOA 2EILE 1N9AA 1Q1TC 1LD8A 3S7JA 2M63A 3V30A 3Q73A 2KATA 5CMYA 5D66A 1N0RA 2DBAA 4K5AB 2XGOA 4IN3B 1D8EA 5KWDA 2X6JA 4ATZD 1HFAA 2J8SD 1N52A 2GRPB 5B56A 2XRYA 1BD8A 5CL8A 2B0OE 2AXUA 2RG8A 4JB8P 3BTRC 3DSUA 3E34A 3AU5A 3Q47B 3FH8A 4QQIA 4HOTA 1EJYI 3ZKVA 2L0TB 2ILRA 2EIME 4GMJA 5ANRA 3OXLA 1N54A 2J9QA 2F37A 4I9EA 3ABKE 3SY2A 1V18A 4J8DA 1FVHA 1N11A 3SFZA 4U54A 5G2NA 3ND2A 4HNMA 3E37A 2FULA 3HYMB 3NMXA 4U0ZA 2BTDA 4MLPA 3PZDA 3ZILA 4I5NA 3PS6A 4BX9A 2X3MA 2IEJA 3R9MA 2XA7A 4I2SA 2XPYA 3VLEA 2HO1A 3MKQB 3BSBA 4PS3A 2WXJA 4B8PA 3D9LA 1JWFA 4I3NA 2KZTA 3Q78A 4BY6A 4PDXA 1YMPA 2J07A 2MOWA 3DXKG 3KNDA 1ZBPA 4Q69A 4U0UA 3AJIA 1TN6A 3F6QA 4I5LA 2IE4A 3EHMA 3O2TA 4FLBA 2IFUA 3O4ZA 3UVUA 3FY4A 2OVBA 3ZRHA 5EILA 4Y5JA 2V0PA 4ACLA 5J3VA 4TXPA 3MA5A 4WWPA 3CHOA 5EYPF 1NL4A 4JW1A 3GB8A 1MJ0A 4HXTA 2NYLA 3KAEA 2KXPC 2L9BA 1M8XA 4EVAA 3VLDA 1QBQA 1T08A 3FU6A 1Y2AC 3CR3A 4RG9A 4CEMA 1UN8A 5LP0A 2VSOE 2OT8A 1PC2A 2XCBA 3Q7FA 1XQSA 3KSQA 1M1EA 2X19B 4BTAA 4TXRA 4M3OA 1M5NS 1KLXA 5G04J 2FBNA 4YNDA 3G2SA 3ZPJA 3OTNA 2PM7A 5FZRA 4TXQA 2WXOA 4U96D 2IO2C 4GZ3A 1MX6A 4V3QA 4CT4A 1QQEA 3ASOE 4WV6A 1HU3A 4CT0A 4YDEA 2JAKA 4IULA 4U95D 2J4DA 3D9KA 1Y8MA 3NMWA 4E6HA 3O4XA 3CVVA 1O1RA 5LCWJ 3EHQA 4AOFA 2JLBA 4CYMD 1FCHA 2QZAA 4OAVB 3K5ZA 3ZHEB 4LERA 4V3IA 2KCVA 4YDOA 3ABLE 1IQUA 4OO6A 1IQRA 2LAHA 3D3MA 2F8XK 4CDNA 4V3OA 5A7DB 1H19A 5FQ4A 3CVLA 3HIZA 4CDRA 2XHEA 4U58A 4KZCA 3SZ7A 2DB0A 3LJ3A 5BV1A 2AXZA 4EECA 4ILGA 4N3BA 2A5UA 3SD5A 3TXMA 5JJ7A 3Q0QA 3OQSA 3K61A 4JW2B 5AYWD 4GMNA 3ZIRA 5KLRB 5AEIA 1P5QA 3Q9UC 3UUXA 3TJZB 3V31A 3CV0A 4CGWA 5CCMA 2X6IA 1H6PA 3CKBA 5BYMA 4R11A 3VE6A 4N3AA 1EPUA 4GA1A 4IRUA 3C2GA 3CHMA 2F31A 4HXIA 5FZSA 3CHRA 2XEVA 5BZUA 3TAXA 1UJJA 4GTOA 4GMOA 3CK9A 1OXJA 1X5BA 1JPLA 1IHGA 3HHMA 3IKOB 4G2VA 1NP7A 3GYZA 4B8OA 3FDHA 4NEEA 3C72A 2NYMA 4JC8A 4H7YA 1U2VG 2Z5MA 4I1MA 1OCCE 4OYSA 3D9MA 3SI5A 3PRZA 3V2XA 3UM0A 4FZFA 2QFCA 4MFVA 2VQ2A 3TWSA 5AENA 4BEPA 3MEKA 4PS8A 3FU5A 2JKRB 3SGHA 2R5SA 2WVIA 4MRUA 1GW6A 4UWKA 4PLSA 1TJFA 2BUGA 4NQ0A 3EA5B 5CLCA 4UAFB 2KM4A 4JEUA 3GS3A 5AQAA 5T8IA 1ELRA 1TNYA 2J4BA 3R9AB 3CK8A 3J5QB 3UQ3A 1JCSA 4I96A 4I1EA 4GTQA 4R10A 2FI7A 1EJLI 1N4KA 2V8SE 4GYWA 1M8WA 5JJTA 4ZHBA 4FQ3A 3CHPA 2WQHA 3NOGD 5AJLA 3ZIOA 2R59A 1G3NB 4GZCA 4U5SA 3MCXA 1Z5SC 5J90A 4G26A 4LNBA 3UINC 3ZIMA 4WUYA 3LJNA 2KCLA 2GW1A 4CGVA 4APFA 1W3BA 4I8MA 4U5UA 3CVPA 3TWWA 5CLAA 3LPZA 3H3DX 3ZVVA 4EBAA 4X8QA 5ARGA 3LWWA 4GZDA 3FUHA 3U9WA 1Y6IA 3JUEA 3SFXA 3ZYLA 4I6JA 2GRLA 3J5PA 4WAFA 2XS1A 3Q4AB 1KPSB 4ABNA 3L16A 4CBAA 4MZ6E 3BVSA 2QYJA 5BZ1A 3L82A 4KT6B 1DVPA 4CT7B 3JY1A 3ENEA 3TWRA 4GTPA 3R7RA 2RD0A 3UIPC 5C1DA 3EU5A 1JCQA 3QGCA 2WXIA 3L9TA 4HRNA 5KNHD 1BI8B 1M8ZA 2OOEA 2Y1LE 3SFYA 4PLRA 1O1SA 2YHEA 4UI9J 1FT1A 3CVXA 4C0EA 1SA4A 4DB9A 1W63B 4BWRA 4IMIA 3LVRE 3PH0C 4L4HA 2IJGX 2IOSA 3Q7AA 5EWPA 1JWGA 5T3RA 3AG3E 3Q5MA 4EV9A 2YJYA 1LUJA 2GGFA 2R2LA 5B1BE 3T5XA 2KBXA 1E90A 1KZPA 5B1AE 2VGLB 2L6BA 3SF4A 5SW9A 2FO7A 2MYOA 3B13A 5IY5E 4HOQA 1D8DA 2IY0C 4YVOA 1E8YA 4A3TA 4EVPA 2XZTG 1TNUA 3G2UA 4D4EA 5CLBA 4DLOA 4HOSA 4I17A 1E8ZA 2RU4B 4LNGA 5K6SA 3ZEFA 3O2QA 4UQIA 3BU8A 3GRLA 2EIJE 3PZ3A 2J09A 3UKWB 4GYOA 3CSTA 5BXOA 3JXIA 4G3AA 2GL7A 3JX7A 2Y0BG 1N95A 5AQ9A 3K7VA 2Z5NA 2ZGDA 4HI9A 3KS2A 3T9KA 1PAQA 3L08A 1HZ4A 5FINA 2BNXA 1IHBA 2LXLA 4FU3A 1OWMA 1B3UA 3PE4A 3MYVA 4K03A 2WXKA 3JXJA 4H3KA 4RV1A 4DPRA 3GZ2A 4ACKA 4CB9A 3IHVA 3FEYA 5AAOA 1K3ZD 3LY9A 3I5PA 5CL7A 3ONLA 3DSXA 4KBQA 3UM2A 4F6RD 5T4YA 3PZ4A 4O1OA 2ETBA 3DBSA 2PL2A 1INZA 4RXHB 1HH8A 4LG6A 4BESA 3FHEA 4BSZB 5EDSA 5ENSD 3L54A 3OUWA 3EHRA 2VSXE 4K5CA 3BG0B
chains in the Genus database with same CATH topology
4I6IA 4JL0A 1E8XA 3G2WA 3Q49B 5KJNA 4FHJA 5HI7A 1JDHA 4XE0A 5CL6A 3WOZA 1HF8A 3BWTA 1SZAA 2WQ7A 3LY8A 2C2LA 2YNRA 3BSXA 1PJMB 3LDZA 4WNGA 3UMVA 2IQCA 4EV8A 3FH7A 4K92A 2AVPA 3LEWA 4UADA 4L7TA 3EIJA 1WM5A 1JPPA 3CEQA 1HG2A 1IQ1C 3L3FX 2I1JA 4NACA 3FUFA 3RZXA 4I37A 3QAQA 2XQ0A 4DLQA 5H2WA 1MQSA 3ZIKA 2AW6A 4BT8A 2IW3A 3A6PA 2KZTB 4YVQC 4LUNU 2NPPA 4HM9A 3SL9A 3V74A 2XGSA 3TT9A 5JHBA 4H3HA 2QY7A 2Q7FA 3MJWA 5E76A 3WPTA 3JXZA 4ATGA 3PVLA 1JUQA 4EVTA 4JA9A 4N39A 3PUKA 2WXHA 4AEZC 3PDNA 4ANXA 3Q0OA 4G24A 4LEUA 4DI4A 2FF4A 3QG9A 2X1GF 2WXFA 4F53A 3EJNA 2JKTA 2PKGA 1LF8A 3FTSA 4R0ZA 2GRMA 1PY1A 3SLAA 4I6EA 4FJZA 4OVVA 4EZLA 4ZDUA 3B7TA 5FC8E 4DZSA 3NF1A 4UWHA 1GCJA 3ESLA 4DB8A 3MKQA 3K64A 3OBVA 3UL1B 3FUMA 3K9IA 5E6QB 4A3VA 3L13A 4WNFA 5FQ6A 3GQ2A 4B94A 1S0PA 3FTZA 3TG4A 3RIBA 3D9PA 3E4BA 5KCMA 3G2TA 4Y6WA 5SVZA 3O2SA 3ZGQA 4GAAA 5KL8A 3LTMA 4TUUA 1JPWA 3GNIA 3QMLC 4GZ5A 3APCA 4L23A 3PUJA 2I6HA 3JXYA 5KUBA 2IU1A 3S7DA 2PQRA 1KT1A 3JQ1A 1E7UA 4BA3A 3JYSA 4BFRA 3ASFA 4JLQA 3QNKA 2IX3A 3L17A 4B18A 2YQ8A 3KEZA 3JCKC 1LRVA 3CK7A 3ASHA 4JA7A 4EPZA 2OV8A 2IAEB 4U2XD 1ZU2A 2VGXB 3CVYA 5KJLA 4XZ4A 3ODRA 3ML9A 3B7SA 1SQMA 3CLJA 3HDXA 5ARFA 3Q0MA 5CLEA 4I9CA 1BK6A 4FZDA 3UPVA 4GZ6A 3HVEB 3SNXA 5HUYC 4PH4B 3I4RB 3ZHEA 3TG5A 2UY1B 4DI3A 4FADA 1HO8A 4KZ0A 1UW4B 3CVNA 4L4IA 3LS8A 5EKFA 2Z5KA 3OXFA 3CHSA 4GB9A 5HHGE 3QOUA 4TRQA 1ELWA 1IALA 4HORA 2IF4A 3CSFA 2DCPA 5BZVA 4I1AA 4U04A 4WNEA 4BX8A 1H2UA 3NZUA 4I6GA 1OWNA 2LSUA 2Y4UA 3MGBA 1NA0A 2VTBB 5A23A 2V5FA 1XQRA 2WTKA 5LSWA 2WXNA 3AU4A 1EE4A 2YINA 3CKCA 4UWFA 2WXGA 2QMRA 4BSXA 3ZYQA 2V4LA 5FWQA 4JHJA 4O27A 3QKYA 2YNQA 3UKZB 3Q5UA 4B89A 4I0YA 4GA2A 4L1BA 3JUIA 1UPLA 4BT9A 4RVBA 3T8MA 1UJKA 3C5WA 4CRUB 1XNFA 1OWLA 4EZJA 3APFA 4JEHA 4Y6CA 3FEXC 5CL3A 3ZIPA 3VLFA 3GW4A 3FGAB 4WWOA 3MX3A 2PF4A 4I2WA 2VGYA 2JKRA 2WQ6A 5EX3A 4GCOA 3MZLB 1H6KA 4U63A 3L6YA 3RRUA 4FHKA 3BCTA 5HUWC 4ANUA 4IMJA 3N71A 3OXGA 2P8QA 2AXVA 1MHQA 2JEKA 3LXUX 1KT0A 2WMNA 1IBRB 4URKA 4CV5B 3BX3A 2BF0X 4LACA 4FULA 4LCTA 3IBVA 2WPVA 1TE4A 4CCAA 5D5KC 3K5YA 2X38A 2WXLA 4G25A 2XOAA 3O48A 4HOUA 3ZHPA 1UG3A 3NZSA 4QFVA 4G1TA 3UT8A 1EF1C 3GAEA 3LVQE 3AS5A 4E85A 3ZN3A 3Q15A 1BPOA 5HQ8A 3D9NA 4UQIB 4U3JC 3LY7A 3PE3A 1NZNA 3BEEA 3EDTB 3QB2A 4B8AA 3PREA 1QGRA 5CMWA 2LSVA 4NRHB 2Y4TA 3FWVA 4ANWA 5KLAA 4KVOA 5FZQA 3LCAA 5KJKA 4H7XA 1OUVA 2FV2A 3T5VA 3L6XA 1QNFA 4Q94A 4A0CA 4YI0C 4UQZA 5CLDA 5BNWA 4GYYA 3FUNA 2C1MA 1W63A 2WB2A 4ME2A 2VJ8A 4DJSA 4CT6B 2XRZA 3IFQA 5A6CA 4U8HA 2VGLA 5J08A 1XM9A 1H2TC 3LTJA 1Z3YA 4NURA 3FTXA 4E4VA 4XX5A 3FFLA 4FFBC 3FTUA 3T7UA 1FVFA 2RU4A 2I1KA 2QNAA 3UT4A 3FUKA 4BPLA 4AVXA 5BUZA 4ILHB 4AM9A 3TL5A 3CHQA 5FJYA 1U3DA 3MKRA 3WOYA 2EQXA 2W3CA 2BAPA 3ML8A 5JHAA 3K7WA 3UL0B 3RO2A 4YGXA 4RSYA 3GVTA 5ANLA 2J08A 2LAIA 3QK0A 3LKUA 5E75A 5G05C 1B89A 4AJWA 1WA5B 3KD7A 4JKQA 4XKCA 3CIAA 4G23A 2NSZA 3RKVA 2UWJG 4W9RA 2PM6A 3AS4A 4QMHA 4F7AA 4AXHA 2L0IA 5LX8A 4WNDA 4TNMA 3IEGA 3EHNA 3B7RL 1TH1A 2IONA 4FC8A 2Z6HA 3FULA 4WWNA 2P58C 4U0SA 5CTTA 4NZWA 2MHKA 1OYZA 5FT9A 2H4MA 4C0MA 2BKUB 3ONKA 3APDA 2AWIA 2Z5OA 4J6IA 2ZU6B 2XA7B 4KXKB 4R7LA 1U6GC 2CHWA 3S7FA 4GCNA 5JJ6A 3TXNA 3VWAA 3K5QA 4BQKA 1OWPA 4B0ZA 2WXMA 2X6HA 3S7BA 4GPKA 3OAWA 3PEUB 4EZKA 1U3CA 2C0LA 2L6JA 4YK6A 2JKTB 3MV2B 3RZ9A 1HS6A 3QWVA 4DK5A 4XI0A 2IE3A 5H2XA 3RRMB 4YJLA 2XCCA 1EDUA 3CVQA 3ESKA 2NYLB 4V3RA 3ODSA 2I9CA 3D9OA 2I2OA 3TX7A 1E8WA 5ENNA 5CL4A 3RRNB 4C9BB 2CFUA 3FTYA 4FA6A 3D9IA 1L5JA 5FTPA 3RK6A 2XPIA 3NQPA 3TGOA 4F3VA 4DVGB 4J8EA 5D0QD 2WMOA 1IYGA 2LNIA 4JZYA 3SBSA 5DN7A 4GMLA 2HM8A 5FQ8A 2C1TA 4DB6A 4A55A 3Q0PA 3P2BA 4CDMA 4I1OB 1HE8A 3AU3A 4JPSA 1M8YA 2IWHA 4JVSA 2NXPA 4MFUA 5AJDA 2VSNA 4B8CB 3ZINA 3QWWA 4U07A 3Q0NA 3V6YA 4HVBA 4UQYA 3S2AA 3ZFWA 3UKXB 4K6JA 3CVUA 3QDNA 3ZXSA 3I3NA 3UT7A 3NOWA 3PSPA 3K4EA 3SHFA 2MRIA 3U66A 4P6ZG 4I7IA 2R17C 3CQGB 1A17A 4JW3C 4HTVA 4XI9A 3ASDA 4IYPA 4MS6A 1WY6A 5G04C 1I7WA 3I4GA 4AIFA 3URZA 2JDQA 1Z3XA 4J0UA 2PQNA 4KZGA 3QC1A 5JJAA 4PS7A 2E2EA 2PZIA 3TPMA 1W9CA 2NC9A 5KJMA 3C2HA 3U3WA 3JQ0A 5LCWC 5LOZA 2CG3A 3V71A 3FUEA 4HS2A 5SWFA 4O6FA 1ELKA 3EIQC 3D9JA 4P29A 4QMIA 2NYMB 4RZPA 4L7MA 2KCKA 1NA3A 4GU5A 4DJAA 4QMJA 2XGMA 5FQ7A 4G11A 4P6ZB 3PEVB 4EBAG 4J8FA 3ZW3A 1OWOA 3FU3A 2WXQA 2FEZA 2CFZA 2IOLA 3GZSA 4U5NA 2A4ZA 3FUJA 5K9SA 1SZ9A 2Q5DA 3RJVA 1QZ7A 2DIWA 3UKYB 3Q0SA 4ANVA 1Q1SC 3L22A 3K49A 4AY5A 2IAEA 4KYOB 4EQFA 2VGXA 5CHEE 1HG5A 1I7XA 3K62A 3B7UX 4JW2A 5M72A 5DBKA 5DIZA 3U64A 4CB8A 3GZ1A 3C98A 2QK2A 2YHCA 4B8JA 4UI9K 3HVEA 4FJYA 1Z2CB 5KLTB 2UY1A 5KL1A 4PLQA 4OIHA 1UN9A 1UPKA 3DW8A 4U5VA 3OUXA 3WXXA 1O6OA 1F59A 5BT1A 4FDDA 3QJZA 3AS8A 3FU0A 3QARA 4AP2A 3MV3B 4RG6A 4KMOA 4A1GA 4D49A 4N2SA 2WM9A 3BX2A 3U4TA 3FUDA 1HXIA 2WXPA 2VTBA 4U5LA 3QWPA 2ONDA 2CG2A 3TJPA 3EBBA 1O6PA 3ULQA 4APOA 1EE5A 2Y3AA 1E96B 4ILIA 3IV0A 2LO6A 4A1SA 5CCLA 3TPOA 3UX4A 4UAEA 3ASGA 3DADA 1IB2A 2HR2A 4FLHA 3L3QA 4AV7A 3ZYMA 1PJNB 3QGBA 5BV0A 4JHRA 5AIJA 4UQXA 3CVWA 5C2YA 3QHEA 3FP3A 4GA0A 1Z6TA 5BW8C 1QBKB 2OF3A 4XKBA 3LYAA 1H2VC 2Z5JA 3GVOA 3ZYKA 4FP7A 3CQCB 3Q0LA 4CRWA 3FGAA 4AY6A 1E7VA 4HLEA 3VTYA 2VSYA 4BTBA 3FH5A 3OPBA 3FTWA 4N5CA 3FEYC 4UI9C 4CRVB 5D0OD 4UWXA 3FEXA 4I43A 3PNTB 3FUIA 5EX0A 5BZ5A 4I2ZA 4U5OA 3Q0RA 4LRZA 3EG5B 3DPDA 5EKGA 3VTXA 3PSTA 2KC7A 3WYFC 1UKLA 1YA0A 4D10C 3ZIQA 5CL5A 2XPZA 1EYHA 1XGWA 2QK1A 2YNSA 2CHXA 4XZRB 5BPPA 1H0AA 2BCTA 1HX8A 1DNPA 2Z6GA 2C0MA 3NMZA 2X6FA 1VDYA 2OVFA 4JXTA 4YJEA 3RO3A 4TV3A 3W3UA 1QZ2A 4J8SA 4PVZA 4FZAA 1WA5C 4PUCA 4K0RA 1QGKA 2VYIA 3P1UA 4Q96A 3IBEA 4MKTA 4F1SA 3BG1B 2WXRA 5G05J 4OVUA 3TJ3A 1WAO1 4UWGA 5CL9A 3SBTB 4L2LA 4HFGA 1TEZA 4N2QA 1UN0A 4UWLA 2HYZA 4ADYA 1G3JA 1TJCA 2J49A 2E0IA 2CHZA 5EKQD 3IHYA 3PNLB 4MZ5E 5LFAA 3RU0A 4XIFA 1BK5A 3G2VA 5G55A 2X6KA 4DBAA 4L2YA 3R7QA 3FTVA 4KVMA 4JHKA 4N3CA 3L6AA 3CGHA 2NPPB 1Q1TC 3S7JA 2M63A 2KATA 5CMYA 2DBAA 2XGOA 4IN3B 2X6JA 1HFAA 1N52A 5B56A 2XRYA 5CL8A 2AXUA 2RG8A 3BTRC 3AU5A 3Q47B 3FH8A 4HOTA 1EJYI 3ZKVA 2L0TB 2ILRA 4GMJA 5ANRA 3OXLA 1N54A 2J9QA 4I9EA 1V18A 4J8DA 1FVHA 3SFZA 4U54A 5G2NA 3ND2A 4HNMA 2FULA 3HYMB 3NMXA 4U0ZA 2BTDA 4MLPA 3PZDA 3ZILA 4I5NA 3PS6A 4BX9A 2X3MA 2XA7A 4I2SA 2XPYA 3VLEA 2HO1A 3MKQB 3BSBA 4PS3A 2WXJA 4B8PA 3D9LA 1JWFA 4I3NA 2KZTA 4BY6A 4PDXA 2J07A 2MOWA 3KNDA 1ZBPA 4Q69A 4U0UA 4I5LA 2IE4A 3EHMA 3O2TA 4FLBA 2IFUA 3O4ZA 3UVUA 3FY4A 2OVBA 3ZRHA 4Y5JA 2V0PA 4ACLA 5J3VA 3MA5A 4WWPA 3CHOA 4JW1A 3GB8A 4HXTA 2NYLA 3KAEA 2L9BA 1M8XA 4EVAA 3VLDA 1T08A 3FU6A 1Y2AC 3CR3A 4RG9A 4CEMA 1UN8A 5LP0A 2VSOE 2OT8A 1PC2A 2XCBA 1XQSA 1M1EA 2X19B 4BTAA 4M3OA 1M5NS 1KLXA 5G04J 2FBNA 4YNDA 3G2SA 3ZPJA 3OTNA 2PM7A 5FZRA 2WXOA 4GZ3A 4V3QA 4CT4A 1QQEA 4WV6A 1HU3A 4CT0A 2JAKA 4IULA 2J4DA 3D9KA 1Y8MA 3NMWA 4E6HA 3O4XA 3CVVA 5LCWJ 4AOFA 2JLBA 1FCHA 3K5ZA 3ZHEB 4LERA 4V3IA 2KCVA 1IQUA 4OO6A 1IQRA 2LAHA 3D3MA 4CDNA 4V3OA 5A7DB 1H19A 5FQ4A 3CVLA 3HIZA 4CDRA 2XHEA 4U58A 4KZCA 3SZ7A 2DB0A 3LJ3A 5BV1A 2AXZA 4EECA 4ILGA 4N3BA 2A5UA 3SD5A 3TXMA 5JJ7A 3Q0QA 3OQSA 3K61A 4JW2B 5AYWD 4GMNA 3ZIRA 5KLRB 5AEIA 1P5QA 3UUXA 3TJZB 3CV0A 4CGWA 5CCMA 2X6IA 3CKBA 5BYMA 4R11A 3VE6A 4N3AA 1EPUA 4GA1A 4IRUA 3C2GA 3CHMA 2F31A 4HXIA 5FZSA 3CHRA 2XEVA 5BZUA 3TAXA 1UJJA 4GMOA 3CK9A 1X5BA 1JPLA 1IHGA 3HHMA 3IKOB 4G2VA 1NP7A 3GYZA 4B8OA 3FDHA 4NEEA 4JC8A 2NYMA 4H7YA 2Z5MA 4I1MA 4OYSA 3D9MA 3SI5A 3PRZA 4FZFA 2QFCA 4MFVA 2VQ2A 5AENA 3MEKA 4PS8A 3FU5A 2JKRB 3SGHA 2R5SA 2WVIA 4MRUA 1GW6A 4UWKA 4PLSA 1TJFA 2BUGA 4NQ0A 3EA5B 5CLCA 4UAFB 2KM4A 4JEUA 3GS3A 5T8IA 1ELRA 2J4BA 3R9AB 3CK8A 3UQ3A 4I96A 4I1EA 4R10A 2FI7A 1EJLI 2V8SE 4GYWA 1M8WA 5JJTA 4FQ3A 3CHPA 2WQHA 5AJLA 3ZIOA 2R59A 4GZCA 4U5SA 3MCXA 5J90A 4G26A 3ZIMA 4WUYA 2KCLA 2GW1A 4CGVA 4APFA 1W3BA 4I8MA 4U5UA 3CVPA 5CLAA 3LPZA 3H3DX 3ZVVA 4EBAA 5ARGA 3LWWA 4GZDA 3FUHA 3U9WA 1Y6IA 3ZYLA 4I6JA 2GRLA 4WAFA 3Q4AB 4ABNA 3L16A 4CBAA 4MZ6E 3BVSA 5BZ1A 4KT6B 1DVPA 4CT7B 3JY1A 3ENEA 3R7RA 2RD0A 5C1DA 3QGCA 2WXIA 1M8ZA 2OOEA 4PLRA 2YHEA 4UI9J 3CVXA 4C0EA 4DB9A 1W63B 4BWRA 4IMIA 3LVRE 3PH0C 4L4HA 2IJGX 2IOSA 5EWPA 1JWGA 5T3RA 3Q5MA 4EV9A 2YJYA 1LUJA 2GGFA 3T5XA 1E90A 2VGLB 3SF4A 5SW9A 2FO7A 3B13A 4HOQA 4YVOA 1E8YA 4A3TA 4EVPA 3G2UA 4D4EA 5CLBA 4DLOA 4HOSA 4I17A 1E8ZA 2RU4B 5K6SA 3ZEFA 3O2QA 4UQIA 3GRLA 2J09A 3UKWB 4GYOA 3CSTA 4G3AA 2GL7A 3JX7A 3K7VA 2Z5NA 3KS2A 1PAQA 3L08A 1HZ4A 2BNXA 4FU3A 1OWMA 1B3UA 3PE4A 3MYVA 4K03A 2WXKA 4H3KA 4RV1A 4DPRA 3GZ2A 4ACKA 4CB9A 3IHVA 3FEYA 3LY9A 3I5PA 5CL7A 3ONLA 4KBQA 5T4YA 3DBSA 2PL2A 1INZA 4RXHB 1HH8A 3FHEA 5EDSA 3L54A 3OUWA 2VSXE 3BG0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VLD A;  3VLF A;  4A3V A;  4A3T A;  4FP7 A;  3VLE A; 
#chains in the Genus database with same CATH topology
 4I6I A;  4JL0 A;  4DX2 A;  1E8X A;  3G2W A;  3Q49 B;  5KJN A;  4FHJ A;  5HI7 A;  1JDH A;  4XE0 A;  5CL6 A;  3WOZ A;  1HF8 A;  3BWT A;  1SZA A;  3UI2 A;  3LY8 A;  2WQ7 A;  3ABM E;  2C2L A;  2YNR A;  3BSX A;  1PJM B;  3LDZ A;  4WNG A;  3UMV A;  1N4R A;  4HQD A;  2XEE A;  2IQC A;  4EV8 A;  3FH7 A;  4K92 A;  2AVP A;  3LEW A;  4UAD A;  4L7T A;  4DX1 A;  3EIJ A;  1WM5 A;  1JPP A;  4GPM A;  3CEQ A;  2GRR B;  1AP7 A;  1HG2 A;  1RZ4 A;  1IQ1 C;  3L3F X;  2I1J A;  2P9N G;  4NAC A;  2XEH A;  3FUF A;  3RZX A;  4I37 A;  3QAQ A;  2XQ0 A;  2P9U G;  4DLQ A;  5H2W A;  1MQS A;  3ZIK A;  2AW6 A;  4BT8 A;  4F1P A;  2IW3 A;  3A6P A;  2KZT B;  4YVQ C;  4LUN U;  1IKN D;  2NPP A;  4HM9 A;  3SL9 A;  3V74 A;  2XGS A;  4J7W A;  3TT9 A;  2EIK E;  1BLX B;  3DSW A;  5JHB A;  4H3H A;  1OCZ E;  4HB5 A;  2QY7 A;  3HXE A;  2A5E A;  2Q7F A;  3MJW A;  4GTM A;  5E76 A;  5HS0 A;  3WPT A;  3JXZ A;  4ATG A;  3PVL A;  1JUQ A;  4EVT A;  4JA9 A;  4N39 A;  3PUK A;  1MX4 A;  3WG7 E;  2WXH A;  4AEZ C;  3PDN A;  3UKR G;  4ANX A;  3Q0O A;  4G24 A;  4LEU A;  4DI4 A;  5B3S E;  4RQI A;  2FF4 A;  3UKU G;  3QG9 A;  2X1G F;  2WXF A;  2DZO A;  4F53 A;  3EJN A;  2DYR E;  2JKT A;  2PKG A;  1LF8 A;  3FTS A;  5ENT D;  4R0Z A;  2GRM A;  1PY1 A;  3SLA A;  4I6E A;  4FJZ A;  4RLY A;  4OVV A;  4UUC A;  4EZL A;  4ZDU A;  3B7T A;  5FC8 E;  3B95 A;  4DZS A;  3NF1 A;  4UWH A;  1GCJ A;  3ESL A;  3DSV A;  4DB8 A;  3MKQ A;  4LNU D;  3K64 A;  3OBV A;  3NBN B;  3UL1 B;  3FUM A;  3K9I A;  5E6Q B;  4A3V A;  1IXV A;  3L13 A;  3NB2 A;  4WNF A;  5FQ6 A;  3GQ2 A;  5ITZ F;  4B94 A;  3IXE A;  1S0P A;  3FTZ A;  3TG4 A;  3RIB A;  4JD2 G;  3D9P A;  3E4B A;  5KCM A;  1X81 A;  3G2T A;  4Y6W A;  5SVZ A;  4A63 B;  3O2S A;  4B93 B;  3ZGQ A;  1S63 A;  4GTV A;  4GAA A;  5KL8 A;  3TWV A;  3LTM A;  4TUU A;  5AAR A;  1JPW A;  3GNI A;  3QML C;  4GZ5 A;  3APC A;  4L23 A;  3AAA C;  3PUJ A;  2I6H A;  3JXY A;  5KUB A;  2IU1 A;  3S7D A;  2PQR A;  1KT1 A;  4HRM B;  4EHM A;  3JQ1 A;  1K1A A;  1E7U A;  4BA3 A;  3JYS A;  4BFR A;  3ASF A;  4JLQ A;  4HBD A;  3QNK A;  2IX3 A;  3L17 A;  4NIK A;  1BI7 B;  3HXD A;  4B18 A;  2YQ8 A;  3KEZ A;  3JCK C;  1LRV A;  3CK7 A;  3ASH A;  4JA7 A;  4Z68 A;  4EPZ A;  4G8K A;  1H6O A;  2OV8 A;  2H6H A;  2IAE B;  1MX2 A;  4U2X D;  1ZU2 A;  2VGX B;  3CVY A;  5KJL A;  4XZ4 A;  3ODR A;  3ML9 A;  3TWU A;  3B7S A;  4OAU C;  1SQM A;  3CLJ A;  3HDX A;  5ENP D;  5ARF A;  3Q0M A;  4J8Y A;  1MYO A;  5CLE A;  4I9C A;  3UTM A;  1BK6 A;  2RFM A;  4FZD A;  3UPV A;  4GZ6 A;  3HVE B;  3SNX A;  5HUY C;  2B6C A;  4PH4 B;  3I4R B;  5EYL A;  1QYM A;  3TG5 A;  2UY1 B;  3ZHE A;  4DI3 A;  4FAD A;  4GMR A;  3C3R A;  1HO8 A;  3HXC A;  1LSH A;  3NOC D;  4KZ0 A;  1UW4 B;  3CVN A;  4L4I A;  3LS8 A;  5EKF A;  2Z5K A;  2LUH A;  2RKK A;  3OXF A;  4CZ2 D;  3CHS A;  2EIN E;  4GB9 A;  2H6F A;  1FT2 A;  5HHG E;  3T8K A;  3QOU A;  4TRQ A;  1ELW A;  1IAL A;  4HOR A;  2IF4 A;  3CSF A;  2DCP A;  5BZV A;  4I1A A;  4U04 A;  4ZFH A;  4WNE A;  4BX8 A;  1H2U A;  3NZU A;  4I6G A;  1OWN A;  2LSU A;  2Y4U A;  3MGB A;  1NA0 A;  2VTB B;  3TWT A;  5A23 A;  3TWQ A;  2V5F A;  4DX7 D;  4YDW A;  1XQR A;  2WTK A;  5LSW A;  2WXN A;  3AU4 A;  1YYH A;  1N4P A;  1EE4 A;  2YIN A;  3RAU A;  1YCS B;  3CKC A;  4UWF A;  4GTS A;  2WXG A;  3UJ0 A;  2QMR A;  4BSX A;  3X2Q E;  3ZYQ A;  2V4L A;  5FWQ A;  4JHJ A;  4O27 A;  3QKY A;  2YNQ A;  3UKZ B;  3Q5U A;  4B89 A;  3UIO C;  1TR4 A;  4I0Y A;  4GA2 A;  3HG0 D;  4L1B A;  3JUI A;  1UPL A;  4BT9 A;  4RVB A;  3V2O A;  3T8M A;  1UJK A;  3C5W A;  4CRU B;  1XNF A;  5AN8 A;  3BQO A;  1OWL A;  4EZJ A;  3APF A;  4JEH A;  4Y6C A;  2DZN A;  3FEX C;  5CL3 A;  3ZIP A;  3ZKJ A;  4C48 B;  3VLF A;  3GW4 A;  3FGA B;  4WWO A;  3MX3 A;  2PF4 A;  4I2W A;  2VGY A;  2ZXW E;  2JKR A;  2WQ6 A;  5EX3 A;  2PNN A;  4GCO A;  3MZL B;  3AG4 E;  1H6K A;  4U63 A;  3L6Y A;  3RRU A;  4FHK A;  3BCT A;  5HUW C;  4ANU A;  3SQV A;  4IMJ A;  3N71 A;  3OXG A;  2P8Q A;  1TNB A;  2AXV A;  1MHQ A;  2JEK A;  3LXU X;  1KT0 A;  3ZUV B;  2WMN A;  1IBR B;  4URK A;  4CV5 B;  3DSS A;  3BX3 A;  2BF0 X;  4LAC A;  4FUL A;  4LCT A;  3IBV A;  2WPV A;  1TE4 A;  4CCA A;  5D5K C;  3K5Y A;  2X38 A;  2WXL A;  4G25 A;  2XOA A;  3E30 A;  3O48 A;  4HOU A;  3ZHP A;  4N5Q A;  1UG3 A;  3NZS A;  4QFV A;  4G1T A;  3UT8 A;  4K5B A;  1EF1 C;  3GAE A;  3LVQ E;  3AS5 A;  4E85 A;  3ZN3 A;  2IO3 C;  3Q15 A;  1BPO A;  3ZXP A;  5HQ8 A;  3D9N A;  3W9G A;  4UQI B;  4U3J C;  3LY7 A;  3PE3 A;  1NZN A;  3BEE A;  3EDT B;  3QB2 A;  4L9P A;  2R05 A;  4B8A A;  3PRE A;  1QGR A;  5CMW A;  3EUV A;  2LSV A;  4NRH B;  2Y4T A;  3FWV A;  2QC9 A;  1NI1 A;  2XS8 A;  1NFI E;  4ANW A;  5KLA A;  4KVO A;  5FZQ A;  3LCA A;  5KJK A;  4H7X A;  1OUV A;  2FV2 A;  3T5V A;  3L6X A;  1QNF A;  4Q94 A;  4A0C A;  4YI0 C;  2P9I G;  3D9H A;  4UQZ A;  5CLD A;  5BNW A;  4GYY A;  3FUN A;  1S64 A;  2C1M A;  1W63 A;  2WB2 A;  4XEI G;  1V54 E;  4ME2 A;  2VJ8 A;  4DJS A;  4U8Y D;  1D9S A;  4CT6 B;  3Q75 A;  2XRZ A;  3IFQ A;  5A6C A;  4U8H A;  2VGL A;  5J08 A;  1XM9 A;  2XEN A;  1H2T C;  3LTJ A;  4GTR A;  1Z3Y A;  4NUR A;  3FTX A;  4E4V A;  4XX5 A;  3FFL A;  2ETA A;  4FFB C;  3FTU A;  3T7U A;  4MBG A;  1ZB1 A;  1FVF A;  3DRA A;  2RU4 A;  2I1K A;  2QNA A;  3UT4 A;  3FUK A;  5CRV A;  4BPL A;  4AVX A;  2NYJ A;  5BUZ A;  4ILH B;  1AWC B;  4AM9 A;  3TL5 A;  1LTX A;  3CHQ A;  5FJY A;  5ENR D;  1U3D A;  3MKR A;  3WOY A;  2EQX A;  2W3C A;  2BAP A;  3ML8 A;  5JHA A;  3K7W A;  3UL0 B;  3RO2 A;  4YGX A;  4RSY A;  3GVT A;  5ANL A;  3ULY A;  2J08 A;  2LAI A;  3QK0 A;  3AG1 E;  3LKU A;  3KEA A;  5E75 A;  5G05 C;  1B89 A;  5CER B;  4HLL A;  4AJW A;  2F0Y A;  1WA5 B;  3KD7 A;  4JKQ A;  1DCE A;  4XKC A;  3CIA A;  4G23 A;  2NSZ A;  3RKV A;  5KBA A;  3DWL G;  2UWJ G;  4W9R A;  2PM6 A;  3AS4 A;  4QMH A;  4F7A A;  4AXH A;  1RW2 A;  2L0I A;  5AQ7 A;  2V5Q C;  2LXM A;  5LX8 A;  4WND A;  4TNM A;  3IEG A;  3EHN A;  3B7R L;  1TH1 A;  2ION A;  3ISM C;  4FC8 A;  2Z6H A;  3FUL A;  5CEA A;  4WWN A;  2P58 C;  4U0S A;  5CTT A;  4NZW A;  2MHK A;  1OYZ A;  1LD7 A;  5FT9 A;  2H4M A;  4C0M A;  2BKU B;  3ONK A;  3APD A;  2AWI A;  2Z5O A;  3DST A;  4J6I A;  2ZU6 B;  2XA7 B;  4KXK B;  4R7L A;  1U6G C;  2CHW A;  3S7F A;  2DWZ A;  4GCN A;  5JJ6 A;  3TXN A;  3VWA A;  3K5Q A;  4BQK A;  2QYU A;  1OWP A;  1UOH A;  4B0Z A;  1MZC A;  2WXM A;  2X6H A;  3S7B A;  5H7P A;  4GPK A;  3OAW A;  3C3O A;  3PEU B;  4EZK A;  1U3C A;  2P2C P;  2C0L A;  2L6J A;  4YK6 A;  2JKT B;  4U7E B;  3MV2 B;  3RZ9 A;  1HS6 A;  3QWV A;  4DK5 A;  4XI0 A;  2IE3 A;  5H2X A;  3RRM B;  4YJL A;  2XCC A;  5ENQ D;  1EDU A;  3CVQ A;  3ESK A;  1N94 A;  2NYL B;  3B7B A;  4V3R A;  3ODS A;  2I9C A;  3D9O A;  2I2O A;  3TX7 A;  1E8W A;  5ENN A;  5CL4 A;  3RRN B;  4C9B B;  2CFU A;  3EU9 A;  3FTY A;  4FA6 A;  3D9I A;  1L5J A;  2P9K G;  5FTP A;  3RK6 A;  2XPI A;  3NQP A;  3T8S A;  3TGO A;  4F3V A;  4DVG B;  4J8E A;  5D0Q D;  2WMO A;  1IYG A;  2LNI A;  4JZY A;  2P9P G;  1O1T A;  3SBS A;  2F8Y A;  5DN7 A;  4GML A;  2HM8 A;  5FQ8 A;  2ZGG A;  2C1T A;  4DB6 A;  2R03 A;  4A55 A;  3Q0P A;  2OCC E;  3P2B A;  4CDM A;  4I1O B;  5JMN D;  3ASN E;  1HE8 A;  3AU3 A;  4JPS A;  1M8Y A;  2IWH A;  4JVS A;  4U8V D;  2NXP A;  4MFU A;  3UJ4 A;  1TN7 A;  3C5R A;  5AJD A;  2VSN A;  4B8C B;  1OCR E;  5CRU A;  3ZIN A;  3QWW A;  5KNG A;  4U07 A;  3Q0N A;  3V6Y A;  4HVB A;  4UQY A;  3S2A A;  3ZFW A;  4M7C A;  3UKX B;  4K6J A;  5AQB A;  3CVU A;  3QDN A;  3ZXS A;  3I3N A;  3UT7 A;  3NOW A;  3PSP A;  3K4E A;  3TWX A;  5CED B;  2V4H C;  3SHF A;  3W9F A;  2MRI A;  3U66 A;  5ENO D;  4P6Z G;  4I7I A;  2R17 C;  3CQG B;  1A17 A;  4JW3 C;  4HTV A;  4XI9 A;  3ASD A;  4IYP A;  4MS6 A;  1WY6 A;  5G04 C;  1I7W A;  2Y69 E;  3I4G A;  3URZ A;  4AIF A;  2JDQ A;  1Z3X A;  4J0U A;  2PQN A;  5EID A;  4KZG A;  3QC1 A;  5JJA A;  4PS7 A;  2E2E A;  2PZI A;  3TPM A;  1W9C A;  3HXF A;  2NC9 A;  5KJM A;  3ULE G;  3C2H A;  2VGE A;  1WG0 A;  3U3W A;  4YDY A;  3JQ0 A;  2JAB A;  5LCW C;  5LOZ A;  2CG3 A;  3DXM G;  3V71 A;  3FUE A;  4HS2 A;  5SWF A;  4O6F A;  1ELK A;  3EIQ C;  3D9J A;  4P29 A;  4QMI A;  3Q79 A;  2NYM B;  4RZP A;  4L7M A;  2KCK A;  1NA3 A;  5D2M C;  4GU5 A;  4DJA A;  4QMJ A;  4BER A;  5CBN A;  2XGM A;  1A5E A;  5FQ7 A;  3DEP A;  4G11 A;  4P6Z B;  3HRA A;  1JCR A;  3PEV B;  2AJA A;  4EBA G;  4J8F A;  3ZW3 A;  1OWO A;  3FU3 A;  2WXQ A;  2FEZ A;  2CFZ A;  2IOL A;  4G8L A;  3GZS A;  4U5N A;  2A4Z A;  3AG2 E;  3FUJ A;  5K9S A;  1SZ9 A;  2Q5D A;  3RJV A;  1QZ7 A;  2DIW A;  3UKY B;  3Q0S A;  1S70 B;  4ANV A;  1Q1S C;  1V55 E;  3L22 A;  3K49 A;  4AY5 A;  2IAE A;  4KYO B;  4EQF A;  4HNA D;  2ZIR A;  2VGX A;  5CHE E;  1HG5 A;  1Q2Z A;  1I7X A;  3K62 A;  3B7U X;  2BKK B;  4JW2 A;  5M72 A;  5DBK A;  5DIZ A;  3PZ2 A;  3U64 A;  3SO8 A;  4CB8 A;  5EN5 D;  3GZ1 A;  3UM3 A;  2GRN B;  3C98 A;  2QK2 A;  2YHC A;  2DVW A;  2XZD G;  4B8J A;  4UI9 K;  3HVE A;  2R02 A;  4FJY A;  1Z2C B;  5KLT B;  2UY1 A;  5KL1 A;  5CBO A;  4PLQ A;  4OIH A;  1UN9 A;  4O60 A;  1UPK A;  3DW8 A;  4U5V A;  3OUX A;  3WXX A;  1O6O A;  1F59 A;  5BT1 A;  3V79 K;  3BUA A;  2OEW A;  4FDD A;  3QJZ A;  3AS8 A;  3FU0 A;  3QAR A;  4AP2 A;  3MV3 B;  4DX6 D;  4RG6 A;  4KMO A;  4A1G A;  4D49 A;  2DYS E;  2GRQ B;  4N2S A;  1N0Q A;  2WM9 A;  3BX2 A;  3U4T A;  3FUD A;  1HXI A;  2WXP A;  2VTB A;  4U5L A;  3QWP A;  2OND A;  2CG2 A;  3TJP A;  3EBB A;  2H6G A;  1O6P A;  3ULQ A;  4APO A;  1EE5 A;  2Y3A A;  1E96 B;  4ILI A;  3IV0 A;  2LO6 A;  4A1S A;  4DRX E;  5CCL A;  4HRL A;  3TPO A;  3UX4 A;  4UAE A;  3ASG A;  3DAD A;  2RFA A;  1IB2 A;  3UXG A;  2HR2 A;  4FLH A;  3L3Q A;  4AV7 A;  3ZYM A;  1PJN B;  3QGB A;  5BV0 A;  4JHR A;  5AIJ A;  4UQX A;  5BXU A;  3CVW A;  1K1B A;  3RSE G;  5C2Y A;  3QHE A;  3FP3 A;  4GA0 A;  1O5M A;  1Z6T A;  5BW8 C;  1QBK B;  2OF3 A;  4XKB A;  3LYA A;  1H2V C;  2Z5J A;  3GVO A;  1SVX A;  1SW6 A;  3ZYK A;  4FP7 A;  3CQC B;  3Q0L A;  4CRW A;  3FGA A;  4AY6 A;  1E7V A;  5HRY A;  4HLE A;  1N4Q A;  3VTY A;  4TUM A;  2VSY A;  4BTB A;  3FH5 A;  3OPB A;  3FTW A;  1DC2 A;  4N5C A;  2ZIS A;  3FEY C;  4GTT A;  4UI9 C;  4CRV B;  5D0O D;  4UWX A;  3FEX A;  4I43 A;  3PNT B;  3FUI A;  5EX0 A;  5BZ5 A;  4I2Z A;  4U5O A;  3Q0R A;  2BKG A;  3EG5 B;  4LRZ A;  3DPD A;  5EKG A;  3VTX A;  3PST A;  3NAW A;  2KC7 A;  3WYF C;  1UKL A;  1TN8 A;  1OT8 A;  1YA0 A;  4D10 C;  4DUI A;  3ZIQ A;  5CL5 A;  2XPZ A;  1EYH A;  1XGW A;  2QK1 A;  1TYQ G;  2BED A;  2YNS A;  1OY3 D;  1FPP A;  2CHX A;  4XZR B;  5BPP A;  1H0A A;  1TNZ A;  2BCT A;  2ETC A;  1OCO E;  1HX8 A;  2P9S G;  1DNP A;  2Z6G A;  3PZ1 A;  2C0M A;  3NMZ A;  5CEC B;  5JA4 D;  2X6F A;  4LSZ E;  1VDY A;  2OVF A;  4JXT A;  4YJE A;  3RO3 A;  4TV3 A;  3W3U A;  1QZ2 A;  4J8S A;  4PVZ A;  4FZA A;  1WA5 C;  3E32 A;  1KZO A;  1TNO A;  4K0R A;  3E33 A;  4PUC A;  3DPY A;  3ZU7 B;  1QGK A;  2VYI A;  3P1U A;  4Q96 A;  3IBE A;  4MKT A;  1DCQ A;  4F1S A;  3BG1 B;  2WXR A;  5G05 J;  4OVU A;  3TJ3 A;  1WAO 1;  4UWG A;  2OEV A;  5CL9 A;  3UM1 A;  3SBT B;  3HXB A;  4DX5 D;  4L2L A;  4HFG A;  1TEZ A;  1WDY A;  4N2Q A;  1UN0 A;  2GRO B;  2HYZ A;  2P9L G;  4UWL A;  5FIO A;  2H6I A;  4ADY A;  1G3J A;  4O1P A;  1TJC A;  2J49 A;  2E0I A;  4BET A;  2CHZ A;  5EKQ D;  3IHY A;  2FO1 E;  1BU9 A;  3PNL B;  4MZ5 E;  5LFA A;  1N4S A;  3Q9N C;  1SA5 A;  3RU0 A;  4XIF A;  1BK5 A;  5EIB E;  1K8K G;  3G2V A;  5G55 A;  2X6K A;  4DBA A;  2HE0 A;  3ZNG A;  4L2Y A;  3C3Q A;  3FTV A;  4KVM A;  3R7Q A;  3KSL A;  4JHK A;  4HI8 A;  5HKP A;  4N3C A;  3L6A A;  3CGH A;  2NPP B;  3DEO A;  2EIL E;  1N9A A;  1Q1T C;  1LD8 A;  3S7J A;  2M63 A;  3V30 A;  3Q73 A;  2KAT A;  5CMY A;  5D66 A;  1N0R A;  2DBA A;  4K5A B;  2XGO A;  4IN3 B;  1D8E A;  5KWD A;  2X6J A;  4ATZ D;  1HFA A;  2J8S D;  1N52 A;  2GRP B;  5B56 A;  2XRY A;  1BD8 A;  5CL8 A;  2B0O E;  2AXU A;  2RG8 A;  4JB8 P;  3BTR C;  3DSU A;  3E34 A;  3AU5 A;  3Q47 B;  3FH8 A;  4QQI A;  4HOT A;  1EJY I;  3ZKV A;  2L0T B;  2ILR A;  2EIM E;  4GMJ A;  5ANR A;  3OXL A;  1N54 A;  2J9Q A;  2F37 A;  4I9E A;  3ABK E;  3SY2 A;  1V18 A;  4J8D A;  1FVH A;  1N11 A;  3SFZ A;  4U54 A;  5G2N A;  3ND2 A;  4HNM A;  3E37 A;  2FUL A;  3HYM B;  3NMX A;  4U0Z A;  2BTD A;  4MLP A;  3PZD A;  3ZIL A;  4I5N A;  3PS6 A;  4BX9 A;  2X3M A;  2IEJ A;  3R9M A;  2XA7 A;  4I2S A;  2XPY A;  3VLE A;  2HO1 A;  3MKQ B;  3BSB A;  4PS3 A;  2WXJ A;  4B8P A;  3D9L A;  1JWF A;  4I3N A;  2KZT A;  3Q78 A;  4BY6 A;  4PDX A;  1YMP A;  2J07 A;  2MOW A;  3DXK G;  3KND A;  1ZBP A;  4Q69 A;  4U0U A;  3AJI A;  1TN6 A;  3F6Q A;  4I5L A;  2IE4 A;  3EHM A;  3O2T A;  4FLB A;  2IFU A;  3O4Z A;  3UVU A;  3FY4 A;  2OVB A;  3ZRH A;  5EIL A;  4Y5J A;  2V0P A;  4ACL A;  5J3V A;  4TXP A;  3MA5 A;  4WWP A;  3CHO A;  5EYP F;  1NL4 A;  4JW1 A;  3GB8 A;  1MJ0 A;  4HXT A;  2NYL A;  3KAE A;  2KXP C;  2L9B A;  1M8X A;  4EVA A;  3VLD A;  1QBQ A;  1T08 A;  3FU6 A;  1Y2A C;  3CR3 A;  4RG9 A;  4CEM A;  1UN8 A;  5LP0 A;  2VSO E;  2OT8 A;  1PC2 A;  2XCB A;  3Q7F A;  1XQS A;  3KSQ A;  1M1E A;  2X19 B;  4BTA A;  4TXR A;  4M3O A;  1M5N S;  1KLX A;  5G04 J;  2FBN A;  4YND A;  3G2S A;  3ZPJ A;  3OTN A;  2PM7 A;  5FZR A;  4TXQ A;  2WXO A;  4U96 D;  2IO2 C;  4GZ3 A;  1MX6 A;  4V3Q A;  4CT4 A;  1QQE A;  3ASO E;  4WV6 A;  1HU3 A;  4CT0 A;  4YDE A;  2JAK A;  4IUL A;  4U95 D;  2J4D A;  3D9K A;  1Y8M A;  3NMW A;  4E6H A;  3O4X A;  3CVV A;  1O1R A;  5LCW J;  3EHQ A;  4AOF A;  2JLB A;  4CYM D;  1FCH A;  2QZA A;  4OAV B;  3K5Z A;  3ZHE B;  4LER A;  4V3I A;  2KCV A;  4YDO A;  3ABL E;  1IQU A;  4OO6 A;  1IQR A;  2LAH A;  3D3M A;  2F8X K;  4CDN A;  4V3O A;  5A7D B;  1H19 A;  5FQ4 A;  3CVL A;  3HIZ A;  4CDR A;  2XHE A;  4U58 A;  4KZC A;  3SZ7 A;  2DB0 A;  3LJ3 A;  5BV1 A;  2AXZ A;  4EEC A;  4ILG A;  4N3B A;  2A5U A;  3SD5 A;  3TXM A;  5JJ7 A;  3Q0Q A;  3OQS A;  3K61 A;  4JW2 B;  5AYW D;  4GMN A;  3ZIR A;  5KLR B;  5AEI A;  1P5Q A;  3Q9U C;  3UUX A;  3TJZ B;  3V31 A;  3CV0 A;  4CGW A;  5CCM A;  2X6I A;  1H6P A;  3CKB A;  5BYM A;  4R11 A;  3VE6 A;  4N3A A;  1EPU A;  4GA1 A;  4IRU A;  3C2G A;  3CHM A;  2F31 A;  4HXI A;  5FZS A;  3CHR A;  2XEV A;  5BZU A;  3TAX A;  1UJJ A;  4GTO A;  4GMO A;  3CK9 A;  1OXJ A;  1X5B A;  1JPL A;  1IHG A;  3HHM A;  3IKO B;  4G2V A;  1NP7 A;  3GYZ A;  4B8O A;  3FDH A;  4NEE A;  3C72 A;  2NYM A;  4JC8 A;  4H7Y A;  1U2V G;  2Z5M A;  4I1M A;  1OCC E;  4OYS A;  3D9M A;  3SI5 A;  3PRZ A;  3V2X A;  3UM0 A;  4FZF A;  2QFC A;  4MFV A;  2VQ2 A;  3TWS A;  5AEN A;  4BEP A;  3MEK A;  4PS8 A;  3FU5 A;  2JKR B;  3SGH A;  2R5S A;  2WVI A;  4MRU A;  1GW6 A;  4UWK A;  4PLS A;  1TJF A;  2BUG A;  4NQ0 A;  3EA5 B;  5CLC A;  4UAF B;  2KM4 A;  4JEU A;  3GS3 A;  5AQA A;  5T8I A;  1ELR A;  1TNY A;  2J4B A;  3R9A B;  3CK8 A;  3J5Q B;  3UQ3 A;  1JCS A;  4I96 A;  4I1E A;  4GTQ A;  4R10 A;  2FI7 A;  1EJL I;  1N4K A;  2V8S E;  4GYW A;  1M8W A;  5JJT A;  4ZHB A;  4FQ3 A;  3CHP A;  2WQH A;  3NOG D;  5AJL A;  3ZIO A;  2R59 A;  1G3N B;  4GZC A;  4U5S A;  3MCX A;  1Z5S C;  5J90 A;  4G26 A;  4LNB A;  3UIN C;  3ZIM A;  4WUY A;  3LJN A;  2KCL A;  2GW1 A;  4CGV A;  4APF A;  1W3B A;  4I8M A;  4U5U A;  3CVP A;  3TWW A;  5CLA A;  3LPZ A;  3H3D X;  3ZVV A;  4EBA A;  4X8Q A;  5ARG A;  3LWW A;  4GZD A;  3FUH A;  3U9W A;  1Y6I A;  3JUE A;  3SFX A;  3ZYL A;  4I6J A;  2GRL A;  3J5P A;  4WAF A;  2XS1 A;  3Q4A B;  1KPS B;  4ABN A;  3L16 A;  4CBA A;  4MZ6 E;  3BVS A;  2QYJ A;  5BZ1 A;  3L82 A;  4KT6 B;  1DVP A;  4CT7 B;  3JY1 A;  3ENE A;  3TWR A;  4GTP A;  3R7R A;  2RD0 A;  3UIP C;  5C1D A;  3EU5 A;  1JCQ A;  3QGC A;  2WXI A;  3L9T A;  4HRN A;  5KNH D;  1BI8 B;  1M8Z A;  2OOE A;  2Y1L E;  3SFY A;  4PLR A;  1O1S A;  2YHE A;  4UI9 J;  1FT1 A;  3CVX A;  4C0E A;  1SA4 A;  4DB9 A;  1W63 B;  4BWR A;  4IMI A;  3LVR E;  3PH0 C;  4L4H A;  2IJG X;  2IOS A;  3Q7A A;  5EWP A;  1JWG A;  5T3R A;  3AG3 E;  3Q5M A;  4EV9 A;  2YJY A;  1LUJ A;  2GGF A;  2R2L A;  5B1B E;  3T5X A;  2KBX A;  1E90 A;  1KZP A;  5B1A E;  2VGL B;  2L6B A;  3SF4 A;  5SW9 A;  2FO7 A;  2MYO A;  3B13 A;  5IY5 E;  4HOQ A;  1D8D A;  2IY0 C;  4YVO A;  1E8Y A;  4A3T A;  4EVP A;  2XZT G;  1TNU A;  3G2U A;  4D4E A;  5CLB A;  4DLO A;  4HOS A;  4I17 A;  1E8Z A;  2RU4 B;  4LNG A;  5K6S A;  3ZEF A;  3O2Q A;  4UQI A;  3BU8 A;  3GRL A;  2EIJ E;  3PZ3 A;  2J09 A;  3UKW B;  4GYO A;  3CST A;  5BXO A;  3JXI A;  4G3A A;  2GL7 A;  3JX7 A;  2Y0B G;  1N95 A;  5AQ9 A;  3K7V A;  2Z5N A;  2ZGD A;  4HI9 A;  3KS2 A;  3T9K A;  1PAQ A;  3L08 A;  1HZ4 A;  5FIN A;  2BNX A;  1IHB A;  2LXL A;  4FU3 A;  1OWM A;  1B3U A;  3PE4 A;  3MYV A;  4K03 A;  2WXK A;  3JXJ A;  4H3K A;  4RV1 A;  4DPR A;  3GZ2 A;  4ACK A;  4CB9 A;  3IHV A;  3FEY A;  5AAO A;  1K3Z D;  3LY9 A;  3I5P A;  5CL7 A;  3ONL A;  3DSX A;  4KBQ A;  3UM2 A;  4F6R D;  5T4Y A;  3PZ4 A;  4O1O A;  2ETB A;  3DBS A;  2PL2 A;  1INZ A;  4RXH B;  1HH8 A;  4LG6 A;  4BES A;  3FHE A;  4BSZ B;  5EDS A;  5ENS D;  3L54 A;  3OUW A;  3EHR A;  2VSX E;  4K5C A;  3BG0 B; 
#chains in the Genus database with same CATH homology
 4I6I A;  4JL0 A;  1E8X A;  3G2W A;  3Q49 B;  5KJN A;  4FHJ A;  5HI7 A;  1JDH A;  4XE0 A;  5CL6 A;  3WOZ A;  1HF8 A;  3BWT A;  1SZA A;  2WQ7 A;  3LY8 A;  2C2L A;  2YNR A;  3BSX A;  1PJM B;  3LDZ A;  4WNG A;  3UMV A;  2IQC A;  4EV8 A;  3FH7 A;  4K92 A;  2AVP A;  3LEW A;  4UAD A;  4L7T A;  3EIJ A;  1WM5 A;  1JPP A;  3CEQ A;  1HG2 A;  1IQ1 C;  3L3F X;  2I1J A;  4NAC A;  3FUF A;  3RZX A;  4I37 A;  3QAQ A;  2XQ0 A;  4DLQ A;  5H2W A;  1MQS A;  3ZIK A;  2AW6 A;  4BT8 A;  2IW3 A;  3A6P A;  2KZT B;  4YVQ C;  4LUN U;  2NPP A;  4HM9 A;  3SL9 A;  3V74 A;  2XGS A;  3TT9 A;  5JHB A;  4H3H A;  2QY7 A;  2Q7F A;  3MJW A;  5E76 A;  3WPT A;  3JXZ A;  4ATG A;  3PVL A;  1JUQ A;  4EVT A;  4JA9 A;  4N39 A;  3PUK A;  2WXH A;  4AEZ C;  3PDN A;  4ANX A;  3Q0O A;  4G24 A;  4LEU A;  4DI4 A;  2FF4 A;  3QG9 A;  2X1G F;  2WXF A;  4F53 A;  3EJN A;  2JKT A;  2PKG A;  1LF8 A;  3FTS A;  4R0Z A;  2GRM A;  1PY1 A;  3SLA A;  4I6E A;  4FJZ A;  4OVV A;  4EZL A;  4ZDU A;  3B7T A;  5FC8 E;  4DZS A;  3NF1 A;  4UWH A;  1GCJ A;  3ESL A;  4DB8 A;  3MKQ A;  3K64 A;  3OBV A;  3UL1 B;  3FUM A;  3K9I A;  5E6Q B;  4A3V A;  3L13 A;  4WNF A;  5FQ6 A;  3GQ2 A;  4B94 A;  1S0P A;  3FTZ A;  3TG4 A;  3RIB A;  3D9P A;  3E4B A;  5KCM A;  3G2T A;  4Y6W A;  5SVZ A;  3O2S A;  3ZGQ A;  4GAA A;  5KL8 A;  3LTM A;  4TUU A;  1JPW A;  3GNI A;  3QML C;  4GZ5 A;  3APC A;  4L23 A;  3PUJ A;  2I6H A;  3JXY A;  5KUB A;  2IU1 A;  3S7D A;  2PQR A;  1KT1 A;  3JQ1 A;  1E7U A;  4BA3 A;  3JYS A;  4BFR A;  3ASF A;  4JLQ A;  3QNK A;  2IX3 A;  3L17 A;  4B18 A;  2YQ8 A;  3KEZ A;  3JCK C;  1LRV A;  3CK7 A;  3ASH A;  4JA7 A;  4EPZ A;  2OV8 A;  2IAE B;  4U2X D;  1ZU2 A;  2VGX B;  3CVY A;  5KJL A;  4XZ4 A;  3ODR A;  3ML9 A;  3B7S A;  1SQM A;  3CLJ A;  3HDX A;  5ARF A;  3Q0M A;  5CLE A;  4I9C A;  1BK6 A;  4FZD A;  3UPV A;  4GZ6 A;  3HVE B;  3SNX A;  5HUY C;  4PH4 B;  3I4R B;  3ZHE A;  3TG5 A;  2UY1 B;  4DI3 A;  4FAD A;  1HO8 A;  4KZ0 A;  1UW4 B;  3CVN A;  4L4I A;  3LS8 A;  5EKF A;  2Z5K A;  3OXF A;  3CHS A;  4GB9 A;  5HHG E;  3QOU A;  4TRQ A;  1ELW A;  1IAL A;  4HOR A;  2IF4 A;  3CSF A;  2DCP A;  5BZV A;  4I1A A;  4U04 A;  4WNE A;  4BX8 A;  1H2U A;  3NZU A;  4I6G A;  1OWN A;  2LSU A;  2Y4U A;  3MGB A;  1NA0 A;  2VTB B;  5A23 A;  2V5F A;  1XQR A;  2WTK A;  5LSW A;  2WXN A;  3AU4 A;  1EE4 A;  2YIN A;  3CKC A;  4UWF A;  2WXG A;  2QMR A;  4BSX A;  3ZYQ A;  2V4L A;  5FWQ A;  4JHJ A;  4O27 A;  3QKY A;  2YNQ A;  3UKZ B;  3Q5U A;  4B89 A;  4I0Y A;  4GA2 A;  4L1B A;  3JUI A;  1UPL A;  4BT9 A;  4RVB A;  3T8M A;  1UJK A;  3C5W A;  4CRU B;  1XNF A;  1OWL A;  4EZJ A;  3APF A;  4JEH A;  4Y6C A;  3FEX C;  5CL3 A;  3ZIP A;  3VLF A;  3GW4 A;  3FGA B;  4WWO A;  3MX3 A;  2PF4 A;  4I2W A;  2VGY A;  2JKR A;  2WQ6 A;  5EX3 A;  4GCO A;  3MZL B;  1H6K A;  4U63 A;  3L6Y A;  3RRU A;  4FHK A;  3BCT A;  5HUW C;  4ANU A;  4IMJ A;  3N71 A;  3OXG A;  2P8Q A;  2AXV A;  1MHQ A;  2JEK A;  3LXU X;  1KT0 A;  2WMN A;  1IBR B;  4URK A;  4CV5 B;  3BX3 A;  2BF0 X;  4LAC A;  4FUL A;  4LCT A;  3IBV A;  2WPV A;  1TE4 A;  4CCA A;  5D5K C;  3K5Y A;  2X38 A;  2WXL A;  4G25 A;  2XOA A;  3O48 A;  4HOU A;  3ZHP A;  1UG3 A;  3NZS A;  4QFV A;  4G1T A;  3UT8 A;  1EF1 C;  3GAE A;  3LVQ E;  3AS5 A;  4E85 A;  3ZN3 A;  3Q15 A;  1BPO A;  5HQ8 A;  3D9N A;  4UQI B;  4U3J C;  3LY7 A;  3PE3 A;  1NZN A;  3BEE A;  3EDT B;  3QB2 A;  4B8A A;  3PRE A;  1QGR A;  5CMW A;  2LSV A;  4NRH B;  2Y4T A;  3FWV A;  4ANW A;  5KLA A;  4KVO A;  5FZQ A;  3LCA A;  5KJK A;  4H7X A;  1OUV A;  2FV2 A;  3T5V A;  3L6X A;  1QNF A;  4Q94 A;  4A0C A;  4YI0 C;  4UQZ A;  5CLD A;  5BNW A;  4GYY A;  3FUN A;  2C1M A;  1W63 A;  2WB2 A;  4ME2 A;  2VJ8 A;  4DJS A;  4CT6 B;  2XRZ A;  3IFQ A;  5A6C A;  4U8H A;  2VGL A;  5J08 A;  1XM9 A;  1H2T C;  3LTJ A;  1Z3Y A;  4NUR A;  3FTX A;  4E4V A;  4XX5 A;  3FFL A;  4FFB C;  3FTU A;  3T7U A;  1FVF A;  2RU4 A;  2I1K A;  2QNA A;  3UT4 A;  3FUK A;  4BPL A;  4AVX A;  5BUZ A;  4ILH B;  4AM9 A;  3TL5 A;  3CHQ A;  5FJY A;  1U3D A;  3MKR A;  3WOY A;  2EQX A;  2W3C A;  2BAP A;  3ML8 A;  5JHA A;  3K7W A;  3UL0 B;  3RO2 A;  4YGX A;  4RSY A;  3GVT A;  5ANL A;  2J08 A;  2LAI A;  3QK0 A;  3LKU A;  5E75 A;  5G05 C;  1B89 A;  4AJW A;  1WA5 B;  3KD7 A;  4JKQ A;  4XKC A;  3CIA A;  4G23 A;  2NSZ A;  3RKV A;  2UWJ G;  4W9R A;  2PM6 A;  3AS4 A;  4QMH A;  4F7A A;  4AXH A;  2L0I A;  5LX8 A;  4WND A;  4TNM A;  3IEG A;  3EHN A;  3B7R L;  1TH1 A;  2ION A;  4FC8 A;  2Z6H A;  3FUL A;  4WWN A;  2P58 C;  4U0S A;  5CTT A;  4NZW A;  2MHK A;  1OYZ A;  5FT9 A;  2H4M A;  4C0M A;  2BKU B;  3ONK A;  3APD A;  2AWI A;  2Z5O A;  4J6I A;  2ZU6 B;  2XA7 B;  4KXK B;  4R7L A;  1U6G C;  2CHW A;  3S7F A;  4GCN A;  5JJ6 A;  3TXN A;  3VWA A;  3K5Q A;  4BQK A;  1OWP A;  4B0Z A;  2WXM A;  2X6H A;  3S7B A;  4GPK A;  3OAW A;  3PEU B;  4EZK A;  1U3C A;  2C0L A;  2L6J A;  4YK6 A;  2JKT B;  3MV2 B;  3RZ9 A;  1HS6 A;  3QWV A;  4DK5 A;  4XI0 A;  2IE3 A;  5H2X A;  3RRM B;  4YJL A;  2XCC A;  1EDU A;  3CVQ A;  3ESK A;  2NYL B;  4V3R A;  3ODS A;  2I9C A;  3D9O A;  2I2O A;  3TX7 A;  1E8W A;  5ENN A;  5CL4 A;  3RRN B;  4C9B B;  2CFU A;  3FTY A;  4FA6 A;  3D9I A;  1L5J A;  5FTP A;  3RK6 A;  2XPI A;  3NQP A;  3TGO A;  4F3V A;  4DVG B;  4J8E A;  5D0Q D;  2WMO A;  1IYG A;  2LNI A;  4JZY A;  3SBS A;  5DN7 A;  4GML A;  2HM8 A;  5FQ8 A;  2C1T A;  4DB6 A;  4A55 A;  3Q0P A;  3P2B A;  4CDM A;  4I1O B;  1HE8 A;  3AU3 A;  4JPS A;  1M8Y A;  2IWH A;  4JVS A;  2NXP A;  4MFU A;  5AJD A;  2VSN A;  4B8C B;  3ZIN A;  3QWW A;  4U07 A;  3Q0N A;  3V6Y A;  4HVB A;  4UQY A;  3S2A A;  3ZFW A;  3UKX B;  4K6J A;  3CVU A;  3QDN A;  3ZXS A;  3I3N A;  3UT7 A;  3NOW A;  3PSP A;  3K4E A;  3SHF A;  2MRI A;  3U66 A;  4P6Z G;  4I7I A;  2R17 C;  3CQG B;  1A17 A;  4JW3 C;  4HTV A;  4XI9 A;  3ASD A;  4IYP A;  4MS6 A;  1WY6 A;  5G04 C;  1I7W A;  3I4G A;  4AIF A;  3URZ A;  2JDQ A;  1Z3X A;  4J0U A;  2PQN A;  4KZG A;  3QC1 A;  5JJA A;  4PS7 A;  2E2E A;  2PZI A;  3TPM A;  1W9C A;  2NC9 A;  5KJM A;  3C2H A;  3U3W A;  3JQ0 A;  5LCW C;  5LOZ A;  2CG3 A;  3V71 A;  3FUE A;  4HS2 A;  5SWF A;  4O6F A;  1ELK A;  3EIQ C;  3D9J A;  4P29 A;  4QMI A;  2NYM B;  4RZP A;  4L7M A;  2KCK A;  1NA3 A;  4GU5 A;  4DJA A;  4QMJ A;  2XGM A;  5FQ7 A;  4G11 A;  4P6Z B;  3PEV B;  4EBA G;  4J8F A;  3ZW3 A;  1OWO A;  3FU3 A;  2WXQ A;  2FEZ A;  2CFZ A;  2IOL A;  3GZS A;  4U5N A;  2A4Z A;  3FUJ A;  5K9S A;  1SZ9 A;  2Q5D A;  3RJV A;  1QZ7 A;  2DIW A;  3UKY B;  3Q0S A;  4ANV A;  1Q1S C;  3L22 A;  3K49 A;  4AY5 A;  2IAE A;  4KYO B;  4EQF A;  2VGX A;  5CHE E;  1HG5 A;  1I7X A;  3K62 A;  3B7U X;  4JW2 A;  5M72 A;  5DBK A;  5DIZ A;  3U64 A;  4CB8 A;  3GZ1 A;  3C98 A;  2QK2 A;  2YHC A;  4B8J A;  4UI9 K;  3HVE A;  4FJY A;  1Z2C B;  5KLT B;  2UY1 A;  5KL1 A;  4PLQ A;  4OIH A;  1UN9 A;  1UPK A;  3DW8 A;  4U5V A;  3OUX A;  3WXX A;  1O6O A;  1F59 A;  5BT1 A;  4FDD A;  3QJZ A;  3AS8 A;  3FU0 A;  3QAR A;  4AP2 A;  3MV3 B;  4RG6 A;  4KMO A;  4A1G A;  4D49 A;  4N2S A;  2WM9 A;  3BX2 A;  3U4T A;  3FUD A;  1HXI A;  2WXP A;  2VTB A;  4U5L A;  3QWP A;  2OND A;  2CG2 A;  3TJP A;  3EBB A;  1O6P A;  3ULQ A;  4APO A;  1EE5 A;  2Y3A A;  1E96 B;  4ILI A;  3IV0 A;  2LO6 A;  4A1S A;  5CCL A;  3TPO A;  3UX4 A;  4UAE A;  3ASG A;  3DAD A;  1IB2 A;  2HR2 A;  4FLH A;  3L3Q A;  4AV7 A;  3ZYM A;  1PJN B;  3QGB A;  5BV0 A;  4JHR A;  5AIJ A;  4UQX A;  3CVW A;  5C2Y A;  3QHE A;  3FP3 A;  4GA0 A;  1Z6T A;  5BW8 C;  1QBK B;  2OF3 A;  4XKB A;  3LYA A;  1H2V C;  2Z5J A;  3GVO A;  3ZYK A;  4FP7 A;  3CQC B;  3Q0L A;  4CRW A;  3FGA A;  4AY6 A;  1E7V A;  4HLE A;  3VTY A;  2VSY A;  4BTB A;  3FH5 A;  3OPB A;  3FTW A;  4N5C A;  3FEY C;  4UI9 C;  4CRV B;  5D0O D;  4UWX A;  3FEX A;  4I43 A;  3PNT B;  3FUI A;  5EX0 A;  5BZ5 A;  4I2Z A;  4U5O A;  3Q0R A;  4LRZ A;  3EG5 B;  3DPD A;  5EKG A;  3VTX A;  3PST A;  2KC7 A;  3WYF C;  1UKL A;  1YA0 A;  4D10 C;  3ZIQ A;  5CL5 A;  2XPZ A;  1EYH A;  1XGW A;  2QK1 A;  2YNS A;  2CHX A;  4XZR B;  5BPP A;  1H0A A;  2BCT A;  1HX8 A;  1DNP A;  2Z6G A;  2C0M A;  3NMZ A;  2X6F A;  1VDY A;  2OVF A;  4JXT A;  4YJE A;  3RO3 A;  4TV3 A;  3W3U A;  1QZ2 A;  4J8S A;  4PVZ A;  4FZA A;  1WA5 C;  4PUC A;  4K0R A;  1QGK A;  2VYI A;  3P1U A;  4Q96 A;  3IBE A;  4MKT A;  4F1S A;  3BG1 B;  2WXR A;  5G05 J;  4OVU A;  3TJ3 A;  1WAO 1;  4UWG A;  5CL9 A;  3SBT B;  4L2L A;  4HFG A;  1TEZ A;  4N2Q A;  1UN0 A;  4UWL A;  2HYZ A;  4ADY A;  1G3J A;  1TJC A;  2J49 A;  2E0I A;  2CHZ A;  5EKQ D;  3IHY A;  3PNL B;  4MZ5 E;  5LFA A;  3RU0 A;  4XIF A;  1BK5 A;  3G2V A;  5G55 A;  2X6K A;  4DBA A;  4L2Y A;  3R7Q A;  3FTV A;  4KVM A;  4JHK A;  4N3C A;  3L6A A;  3CGH A;  2NPP B;  1Q1T C;  3S7J A;  2M63 A;  2KAT A;  5CMY A;  2DBA A;  2XGO A;  4IN3 B;  2X6J A;  1HFA A;  1N52 A;  5B56 A;  2XRY A;  5CL8 A;  2AXU A;  2RG8 A;  3BTR C;  3AU5 A;  3Q47 B;  3FH8 A;  4HOT A;  1EJY I;  3ZKV A;  2L0T B;  2ILR A;  4GMJ A;  5ANR A;  3OXL A;  1N54 A;  2J9Q A;  4I9E A;  1V18 A;  4J8D A;  1FVH A;  3SFZ A;  4U54 A;  5G2N A;  3ND2 A;  4HNM A;  2FUL A;  3HYM B;  3NMX A;  4U0Z A;  2BTD A;  4MLP A;  3PZD A;  3ZIL A;  4I5N A;  3PS6 A;  4BX9 A;  2X3M A;  2XA7 A;  4I2S A;  2XPY A;  3VLE A;  2HO1 A;  3MKQ B;  3BSB A;  4PS3 A;  2WXJ A;  4B8P A;  3D9L A;  1JWF A;  4I3N A;  2KZT A;  4BY6 A;  4PDX A;  2J07 A;  2MOW A;  3KND A;  1ZBP A;  4Q69 A;  4U0U A;  4I5L A;  2IE4 A;  3EHM A;  3O2T A;  4FLB A;  2IFU A;  3O4Z A;  3UVU A;  3FY4 A;  2OVB A;  3ZRH A;  4Y5J A;  2V0P A;  4ACL A;  5J3V A;  3MA5 A;  4WWP A;  3CHO A;  4JW1 A;  3GB8 A;  4HXT A;  2NYL A;  3KAE A;  2L9B A;  1M8X A;  4EVA A;  3VLD A;  1T08 A;  3FU6 A;  1Y2A C;  3CR3 A;  4RG9 A;  4CEM A;  1UN8 A;  5LP0 A;  2VSO E;  2OT8 A;  1PC2 A;  2XCB A;  1XQS A;  1M1E A;  2X19 B;  4BTA A;  4M3O A;  1M5N S;  1KLX A;  5G04 J;  2FBN A;  4YND A;  3G2S A;  3ZPJ A;  3OTN A;  2PM7 A;  5FZR A;  2WXO A;  4GZ3 A;  4V3Q A;  4CT4 A;  1QQE A;  4WV6 A;  1HU3 A;  4CT0 A;  2JAK A;  4IUL A;  2J4D A;  3D9K A;  1Y8M A;  3NMW A;  4E6H A;  3O4X A;  3CVV A;  5LCW J;  4AOF A;  2JLB A;  1FCH A;  3K5Z A;  3ZHE B;  4LER A;  4V3I A;  2KCV A;  1IQU A;  4OO6 A;  1IQR A;  2LAH A;  3D3M A;  4CDN A;  4V3O A;  5A7D B;  1H19 A;  5FQ4 A;  3CVL A;  3HIZ A;  4CDR A;  2XHE A;  4U58 A;  4KZC A;  3SZ7 A;  2DB0 A;  3LJ3 A;  5BV1 A;  2AXZ A;  4EEC A;  4ILG A;  4N3B A;  2A5U A;  3SD5 A;  3TXM A;  5JJ7 A;  3Q0Q A;  3OQS A;  3K61 A;  4JW2 B;  5AYW D;  4GMN A;  3ZIR A;  5KLR B;  5AEI A;  1P5Q A;  3UUX A;  3TJZ B;  3CV0 A;  4CGW A;  5CCM A;  2X6I A;  3CKB A;  5BYM A;  4R11 A;  3VE6 A;  4N3A A;  1EPU A;  4GA1 A;  4IRU A;  3C2G A;  3CHM A;  2F31 A;  4HXI A;  5FZS A;  3CHR A;  2XEV A;  5BZU A;  3TAX A;  1UJJ A;  4GMO A;  3CK9 A;  1X5B A;  1JPL A;  1IHG A;  3HHM A;  3IKO B;  4G2V A;  1NP7 A;  3GYZ A;  4B8O A;  3FDH A;  4NEE A;  4JC8 A;  2NYM A;  4H7Y A;  2Z5M A;  4I1M A;  4OYS A;  3D9M A;  3SI5 A;  3PRZ A;  4FZF A;  2QFC A;  4MFV A;  2VQ2 A;  5AEN A;  3MEK A;  4PS8 A;  3FU5 A;  2JKR B;  3SGH A;  2R5S A;  2WVI A;  4MRU A;  1GW6 A;  4UWK A;  4PLS A;  1TJF A;  2BUG A;  4NQ0 A;  3EA5 B;  5CLC A;  4UAF B;  2KM4 A;  4JEU A;  3GS3 A;  5T8I A;  1ELR A;  2J4B A;  3R9A B;  3CK8 A;  3UQ3 A;  4I96 A;  4I1E A;  4R10 A;  2FI7 A;  1EJL I;  2V8S E;  4GYW A;  1M8W A;  5JJT A;  4FQ3 A;  3CHP A;  2WQH A;  5AJL A;  3ZIO A;  2R59 A;  4GZC A;  4U5S A;  3MCX A;  5J90 A;  4G26 A;  3ZIM A;  4WUY A;  2KCL A;  2GW1 A;  4CGV A;  4APF A;  1W3B A;  4I8M A;  4U5U A;  3CVP A;  5CLA A;  3LPZ A;  3H3D X;  3ZVV A;  4EBA A;  5ARG A;  3LWW A;  4GZD A;  3FUH A;  3U9W A;  1Y6I A;  3ZYL A;  4I6J A;  2GRL A;  4WAF A;  3Q4A B;  4ABN A;  3L16 A;  4CBA A;  4MZ6 E;  3BVS A;  5BZ1 A;  4KT6 B;  1DVP A;  4CT7 B;  3JY1 A;  3ENE A;  3R7R A;  2RD0 A;  5C1D A;  3QGC A;  2WXI A;  1M8Z A;  2OOE A;  4PLR A;  2YHE A;  4UI9 J;  3CVX A;  4C0E A;  4DB9 A;  1W63 B;  4BWR A;  4IMI A;  3LVR E;  3PH0 C;  4L4H A;  2IJG X;  2IOS A;  5EWP A;  1JWG A;  5T3R A;  3Q5M A;  4EV9 A;  2YJY A;  1LUJ A;  2GGF A;  3T5X A;  1E90 A;  2VGL B;  3SF4 A;  5SW9 A;  2FO7 A;  3B13 A;  4HOQ A;  4YVO A;  1E8Y A;  4A3T A;  4EVP A;  3G2U A;  4D4E A;  5CLB A;  4DLO A;  4HOS A;  4I17 A;  1E8Z A;  2RU4 B;  5K6S A;  3ZEF A;  3O2Q A;  4UQI A;  3GRL A;  2J09 A;  3UKW B;  4GYO A;  3CST A;  4G3A A;  2GL7 A;  3JX7 A;  3K7V A;  2Z5N A;  3KS2 A;  1PAQ A;  3L08 A;  1HZ4 A;  2BNX A;  4FU3 A;  1OWM A;  1B3U A;  3PE4 A;  3MYV A;  4K03 A;  2WXK A;  4H3K A;  4RV1 A;  4DPR A;  3GZ2 A;  4ACK A;  4CB9 A;  3IHV A;  3FEY A;  3LY9 A;  3I5P A;  5CL7 A;  3ONL A;  4KBQ A;  5T4Y A;  3DBS A;  2PL2 A;  1INZ A;  4RXH B;  1HH8 A;  3FHE A;  5EDS A;  3L54 A;  3OUW A;  2VSX E;  3BG0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...