3VLEA

Crystal structure of yeast proteasome interacting protein
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
456
structure length
435
Chain Sequence
NLLTQLENELNEDTLLRKCSLNLVTVMDVKPLLATIKRFLTSDYLLDVVDKLVPMADFDDVLEVYSAEDLVKALRSEIDPLKVAACRVIENSQPKGLFATSNIIDILLDILFDEKVENDKLITAIEKALERLSTDELIRRRLFDNNLPYLVSVKGRMETVSFVRLIDFLTIEFQFISGPEFKDIIFCFTKEEILKSVEDILVFIELVNYYTKFLLEIRNQDKYWALRHVKKILPVFAQLFEDTENYPDVRAFSTNCLLQLFAEVSRIEEDEYSLFKTMDKDSLKIGSEAKLITEWLELINPQYLVKYHKDVVENYFHVSGYSIGMLRNLSADEECFNAIRNKFSAEIVLRLPYLEQMQVVETLTRYEYTSKFLLNEMPKVMGSLIGDGSAGAIIDLETVHYRNSALRNLLDKGEEKLSVWYEPLLREYSKAVNGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for specific recognition of Rpt1, an ATPase subunit of the 26S proteasome, by a proteasome-dedicated chaperone Hsm3
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords DNA mismatch repair protein HSM3
total genus 167
structure length 435
sequence length 456
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18794 HSM3_C DNA mismatch repair protein HSM3, C terminal domain
A PF18795 HSM3_N DNA mismatch repair protein HSM3, N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.50 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 3vleA01
1.25.40.580 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3vleA02
3VLFA 4FP7A 4A3VA 3VLEA 3VLDA 4A3TA
chains in the Genus database with same CATH superfamily
4WNDA 5ENRD 4UAFB 3PSPA 4GTOA 3Q0MA 3Q78A 3NQPA 4H7XA 5KL8A 4YVOA 1E7UA 3V31A 1EJYI 1MZCA 2P58C 1OWMA 4CRWA 4BWRA 4GZ3A 3MV2B 3MA5A 1LD8A 3CVYA 4I3NA 5E6QB 4FADA 2X6JA 4U8HA 4CB8A 2VSYA 4K0RA 4M3OA 1FVFA 4U54A 3T8SA 3J5PA 2NPPA 2HR2A 2IJGX 1N94A 5KWDA 3BVSA 3I4RB 5HS0A 3OQSA 4PDXA 4CDNA 3SNXA 3KEZA 3GW4A 2KC7A 3FY4A 2BUGA 5C2YA 1YMPA 3W9FA 4DI4A 3UVUA 4K5CA 1DVPA 4KXKB 1KZOA 4NEEA 2PZIA 3R7RA 1O1SA 4I6IA 3QWVA 2FF4A 2YNQA 3S7BA 5EIDA 5AJDA 5FIOA 4UWFA 5A23A 4Q94A 2NYLB 3MJWA 3U64A 4JW1A 3QOUA 4MS6A 2OEWA 3G2SA 4U0ZA 4WNEA 1ZBPA 1Z6TA 4EBAG 4N3AA 3C3OA 1X5BA 1V54E 3C3QA 3IXEA 3FH7A 3LTMA 4CEMA 4O27A 2UY1B 4PLSA 5CL8A 1N95A 5DBKA 4EZKA 2XOAA 4BSZB 3EU9A 4FJYA 2RG8A 1ZU2A 4GTPA 1IHGA 4NIKA 4HLLA 1KT0A 4CT6B 4EBAA 5AEIA 1IQRA 2X6FA 5CEAA 3C2HA 4ILGA 4L7MA 2X6HA 2R03A 3KSLA 1KZPA 5CLDA 5CLAA 5G05J 4UI9J 5J08A 4N3BA 2ZIRA 4NACA 4UQZA 5BZVA 2CHZA 1H19A 3WOYA 4PH4B 4ME2A 2IWHA 4QMIA 4GTVA 2J8SD 3CQGB 4RQIA 3SFYA 1O1RA 2AXVA 5ENNA 4CT4A 4OAUC 4CCAA 5FJYA 3ZHPA 3O2SA 3UINC 2WXRA 3ML9A 4TUUA 2CHXA 4GMLA 3SBTB 3K61A 4J0UA 4XIFA 1HFAA 4ZHBA 4IULA 2Y1LE 5EX0A 4G8KA 2WQ7A 3Q75A 4WWOA 3FUMA 4HS2A 4J8FA 2FBNA 1SZ9A 2AVPA 4DJSA 3ODRA 3FH5A 2Z5KA 3JUEA 3GVTA 4CV5B 2WXOA 3AS5A 4GPKA 4GYYA 3BCTA 4FLBA 1TR4A 3NZUA 4FP7A 4MFUA 3ZKJA 3KAEA 4F7AA 3L6YA 2XCBA 3J5QB 4MLPA 4JZYA 3CSFA 3CHPA 3TL5A 4JEHA 3FTUA 3Q15A 3L9TA 3B7SA 4BTAA 1YCSB 2IO2C 3D9NA 1H0AA 2AXZA 4MBGA 4L9PA 3NMZA 4F1SA 3VWAA 4WWPA 3C5WA 2YINA 4PLRA 1UJKA 4J8YA 3LXUX 2KCLA 3UIPC 4PLQA 4N2QA 3V6YA 1MX4A 5CBNA 2J07A 1V55E 3EHMA 4XEIG 4G24A 3B7UX 4G26A 4O6FA 4TV3A 4EHMA 2Z5OA 2IO3C 2DYRE 2JKRA 3UT7A 3PS6A 1N11A 3E33A 3OXLA 2XEHA 2C1MA 4N3CA 2VGEA 2NSZA 1A5EA 3K64A 4RXHB 4A3TA 3ZPJA 3AU4A 2GGFA 4A63B 4BEPA 4K5BA 3V79K 4V3OA 3ONKA 2JLBA 2P9KG 3U4TA 5EYPF 5BXUA 1K3ZD 1WDYA 3AG3E 4DZSA 1NA0A 5JA4D 3VTYA 4H3HA 3HXEA 2RU4A 1UPKA 3K62A 3Q0LA 3D9IA 4LNGA 4JHJA 2P9PG 4WWNA 3BU8A 3QC1A 1W63B 5H2WA 4HFGA 5EIBE 4G2VA 2ZGGA 4IMJA 4QMJA 1SW6A 4V3RA 1BD8A 3T5XA 1F59A 2MRIA 3FEYA 2HM8A 3DPYA 5CMWA 3V2OA 1I7WA 2X19B 1Q1TC 1NFIE 3FU5A 3TWXA 1LSHA 3CK9A 3PZ2A 1KLXA 2C0LA 3UM3A 3N71A 1OWLA 4M7CA 4ZDUA 3U3WA 2WXFA 4GMNA 1SVXA 4L1BA 3AJIA 1XGWA 5H2XA 3JXZA 3ZYKA 3HVEB 1GW6A 4LRZA 4AP2A 3FTZA 4A1GA 5CEDB 3WYFC 3TAXA 4TXPA 3S7FA 2B6CA 4AVXA 1MX2A 1FT2A 4L7TA 2QYUA 4CBAA 2I2OA 3ABME 3Q9UC 2Y69E 4TXQA 1B89A 2LO6A 1YYHA 3BSBA 3PZ4A 1HS6A 3CHRA 2XA7A 3SQVA 4OVUA 1IHBA 1T08A 3UUXA 3PE3A 3RSEG 3ZVVA 1UJJA 3LKUA 4HXTA 2EINE 3ZEFA 4FZDA 3ASNE 5EILA 4FA6A 4N5CA 3ULQA 3ZHEB 4U3JC 3TG4A 4DB6A 1IBRB 4A3VA 5LX8A 3FUEA 2F0YA 4O1PA 2IW3A 4I7IA 5CL5A 1BI7B 2QNAA 2BKGA 4CT0A 3T8KA 3UKXB 2QYJA 5D5KC 5B1BE 2R17C 2OV8A 5AQAA 4UWGA 4MFVA 1PJMB 2KXPC 1SQMA 1WAO1 1Y2AC 3KNDA 5D0QD 5BUZA 4WAFA 3IBEA 2IF4A 3K9IA 5CL4A 3Q49B 2BTDA 5CL3A 4PS7A 3DSSA 3GB8A 4U5SA 3ASFA 3D3MA 4R0ZA 3EIQC 4CRUB 3IHYA 4G25A 5AENA 3FUKA 3QB2A 4LCTA 3CVVA 4RZPA 4J8SA 2PL2A 3CHSA 3ONLA 4GTQA 4WNFA 3CVUA 3TWUA 3ML8A 3ZXSA 2OVBA 4ANWA 2CFZA 2YJYA 2JKTA 1UN0A 1TNYA 3PREA 2KBXA 4UADA 2IFUA 1EJLI 2HE0A 3UI2A 2X6IA 4APFA 5SVZA 5DN7A 4ILHB 3X2QE 3HXFA 2LNIA 3GRLA 3L16A 5CCMA 1Z3YA 5G05C 4E85A 1QBKB 4HNMA 3Q5MA 3NOGD 4I1OB 5LFAA 4FJZA 5FINA 5CECB 1SA4A 4RG6A 5E75A 3MKRA 3CVWA 4UUCA 1IXVA 4YI0C 4LG6A 4AJWA 5AJLA 4HLEA 3P2BA 3FUHA 3UT4A 3QWWA 3TXMA 1V18A 5HKPA 4GCNA 1BPOA 4AY6A 3ASGA 3UQ3A 3Q47B 1N4KA 2CHWA 5SW9A 4U5UA 5BZ5A 4O60A 1FCHA 2XENA 4WUYA 1LUJA 1K1BA 4D49A 3OPBA 1EE4A 1D8EA 4RLYA 3WPTA 3UL1B 4I9EA 5CMYA 2Y4UA 4FU3A 2YQ8A 3HRAA 5KCMA 4N5QA 5T3RA 2AJAA 2H4MA 5IY5E 4I43A 4KVOA 3AG2E 3K49A 1Z2CB 3UKWB 3FU0A 2P2CP 1O5MA 2QY7A 3K5ZA 3SL9A 4FLHA 1EYHA 3ZYQA 3DBSA 2F37A 1Q1SC 3HDXA 5DIZA 3CVQA 2HYZA 4TRQA 3NMWA 5D0OD 4AXHA 4UAEA 4K92A 1OT8A 5JJTA 4KZCA 5A7DB 3QG9A 2J08A 1MHQA 3B95A 4N2SA 5J90A 2IEJA 3ZN3A 1TN8A 1VDYA 1TH1A 4XZRB 3K7WA 2WVIA 3OUWA 1AWCB 4AY5A 3B7TA 4CZ2D 1K1AA 4DBAA 3MGBA 1MQSA 4HI8A 2GW1A 5JHBA 4CDMA 1EDUA 3TGOA 3HHMA 3ESLA 5KBAA 5CLBA 3EHRA 2OF3A 5FZSA 4EQFA 3O48A 1SZAA 4DRXE 1N54A 3FWVA 5CHEE 1H2TC 3RAUA 5KLRB 3MCXA 4GA0A 3G2VA 2GRNB 2XPZA 3EIJA 3LTJA 5EWPA 3HXCA 3ABKE 3PUJA 3Q0RA 3RJVA 4GTRA 2F8YA 4HM9A 1QNFA 1JWFA 1DC2A 1XQSA 3FULA 1M5NS 3I4GA 1LRVA 2XHEA 3B7BA 2YNRA 2IY0C 2FI7A 3ZUVB 2QMRA 2RFAA 3L3FX 5EKQD 4CGWA 2IAEB 2RKKA 3LY7A 5CTTA 4B18A 2KCVA 2WXHA 4GAAA 3ZYLA 2EIME 3Q9NC 2WB2A 4U58A 5B3SE 1H2UA 2MOWA 4GZ5A 4XE0A 3CVNA 4P29A 1TYQG 3L6AA 4E4VA 4YK6A 4ACKA 3FH8A 4RVBA 2PQNA 3L82A 5HI7A 4DK5A 2DBAA 3QHEA 2XZDG 3QGCA 1BU9A 4KZ0A 3DSVA 4LUNU 4R11A 4RSYA 4JD2G 1PAQA 4HOQA 2Q7FA 2QC9A 4CRVB 2JABA 3TXNA 5JJAA 2W3CA 3MKQA 3TPOA 3ND2A 3CHMA 4ANUA 4EECA 1WM5A 2C0MA 1EF1C 2AWIA 4LACA 2MHKA 1ELWA 5ENQD 3V74A 3LWWA 3TG5A 2CG2A 4IN3B 1YA0A 3TPMA 3DEOA 5FZQA 1BI8B 1HU3A 4OO6A 3PZDA 5ENTD 3SGHA 4GYOA 4O1OA 4WV6A 3FUJA 5ANLA 5HUYC 1MYOA 4DJAA 3ODSA 3FTWA 1E90A 2PM6A 4JXTA 5CRUA 2V4HC 4HTVA 4I0YA 3DXKG 3GZ1A 3L54A 3VLFA 3CVLA 1H6KA 2IQCA 4BTBA 4UWKA 4HB5A 3NMXA 4ANXA 1N52A 2RFMA 5KJKA 3DRAA 4JC8A 4BA3A 4EZLA 3UKZB 4LEUA 5CCLA 4V3IA 2ZGDA 3FUIA 1JPWA 2WXGA 4LNBA 2H6IA 3DSWA 4B0ZA 2JKRB 2WXMA 4NQ0A 2VSXE 3QGBA 3KSQA 4TXRA 1W63A 3L08A 1MX6A 5E76A 3B13A 3GZSA 1OWNA 1HO8A 3PNLB 5AYWD 1S64A 3JXJA 5FQ6A 1I7XA 4HORA 1UG3A 3DSUA 1AP7A 3UKUG 4DLQA 4CDRA 1TE4A 2WXNA 4IYPA 4JA9A 3QAQA 3Q79A 4B8AA 3EG5B 3L17A 2XRYA 4ZFHA 2BKUB 3O2TA 4PVZA 4UQIB 2FV2A 3RRNB 2VTBB 5ENOD 3SD5A 2OEVA 3FEXA 1XNFA 3JYSA 2GRRB 3FUDA 4Q69A 3RIBA 4QFVA 4YDWA 3OXGA 2L0IA 4C9BB 3P1UA 3QMLC 3RO2A 3SI5A 1HX8A 3V71A 1S63A 4U8VD 5CRVA 4DB8A 2Y3AA 3VLEA 2JKTB 4H3KA 1IQUA 3Q4AB 4E6HA 4I96A 2B0OE 4B94A 3ULYA 4JKQA 2KZTA 3ZHEA 1JUQA 5FZRA 4U2XD 3KEAA 4HBDA 2WMNA 1O6PA 4BX8A 1NZNA 3HG0D 4KT6B 4LSZE 1ZB1A 4JW2B 4TNMA 4IMIA 3CK8A 2P8QA 4CT7B 2XPIA 4GB9A 3E4BA 3ESKA 2GL7A 3TJ3A 4CYMD 5ITZF 4FDDA 4U07A 4DUIA 2KATA 1H6OA 3JUIA 2VGLA 3SZ7A 3E32A 3FHEA 3UJ4A 5KLAA 3C98A 4IRUA 3NOWA 1Z5SC 3UM1A 4U8YD 4UI9C 3FGAA 1HH8A 4YDEA 5AQ7A 2J09A 2XGMA 2Z6GA 5KJLA 3BQOA 4V3QA 3EBBA 2AXUA 4JL0A 4HQDA 4DX1A 5BXOA 4I1EA 3FP3A 4UQIA 3QDNA 3BTRC 2BAPA 1TN7A 3L3QA 3L13A 2WTKA 3CR3A 1E8ZA 4GA1A 3CVPA 3E37A 2F31A 5BPPA 2WXJA 3C5RA 5AQBA 2NYLA 1UN9A 1INZA 3AS8A 1U3CA 2LSVA 4A55A 2GRPB 3TWQA 3K5QA 1TNOA 2Z6HA 1HZ4A 3GZ2A 3PDNA 3PNTB 3OUXA 1E8YA 2A5EA 3HIZA 5AARA 4I6JA 4P6ZG 2A5UA 4HVBA 2VYIA 2Z5JA 3LYAA 1N4PA 4JW3C 1UPLA 2C1TA 4GZ6A 3C72A 1JPPA 2VGXB 2YHEA 5K6SA 2LSUA 4CGVA 4HOSA 3U9WA 2J4DA 3HYMB 5JMND 1O6OA 4Y6CA 1DCQA 2E2EA 4A0CA 1GCJA 5J3VA 4GU5A 3T8MA 3VE6A 1QQEA 3LDZA 2KCKA 5CBOA 3ASOE 4P6ZB 5FQ7A 4N39A 5B1AE 2Z5NA 2IU1A 3E34A 5KL1A 4B8OA 4LERA 1M1EA 2WXQA 4U96D 2BCTA 2UY1A 1WA5C 2CFUA 2R5SA 5BV1A 3PUKA 3OAWA 1OYZA 3TWRA 2XRZA 4JEUA 2XGOA 2XPYA 3FDHA 4GA2A 3SFZA 1W3BA 1E96B 3ZGQA 1OXJA 4WNGA 1QZ2A 3ABLE 3URZA 4L4IA 3A6PA 2RD0A 3MKQB 4BX9A 2I1JA 1QBQA 4GTTA 4URKA 4GYWA 5LOZA 3UIOC 1MJ0A 2L0TB 1G3NB 1UOHA 3FTXA 5SWFA 3Q0PA 4BFRA 1PJNB 2DB0A 3CHOA 1S70B 1OUVA 3CLJA 4L23A 3GVOA 3MV3B 3ZW3A 2R02A 2IAEA 2F8XK 3Q5UA 2ETBA 1UN8A 2WXLA 4ADYA 2ZXWE 3DW8A 5BW8C 2WQ6A 4EVAA 4MRUA 1NA3A 5CERB 4PS8A 4I1MA 2VGXA 4ATZD 3K5YA 4K03A 2V4LA 1N0RA 1DCEA 1WA5B 5KJMA 3ZRHA 1TNUA 1L5JA 4YGXA 4BERA 3IV0A 5G04J 1E7VA 2DCPA 4XKCA 4DX6D 2EIKE 5FWQA 2J4BA 4HRNA 3QWPA 3UPVA 3MYVA 3DPDA 2NYMB 2R2LA 2OT8A 4U0SA 3FTYA 5ENPD 3T9KA 3RK6A 4UWHA 3SBSA 4J8EA 2IOSA 3G2WA 3CVXA 4L2YA 3FFLA 1XM9A 3MX3A 1IQ1C 4B8PA 4FHKA 1KPSB 2I9CA 2GROB 3EA5B 3V30A 3ZIPA 3TJZB 4FQ3A 1QYMA 4QQIA 3Q73A 3TWWA 4FC8A 4NRHB 1Y6IA 4Z68A 3ZXPA 2XEEA 4ACLA 2FO7A 2A4ZA 3CGHA 4ANVA 3D9MA 3WG7E 1DNPA 1N0QA 4GTMA 4I1AA 4JHKA 3CSTA 4FZAA 1LD7A 2WM9A 3FUFA 5BZUA 3UTMA 2ZISA 2OOEA 4QMHA 1G3JA 4HI9A 1TJFA 3EUVA 1H6PA 3JCKC 3AU5A 1K8KG 4U63A 2H6FA 3Q0SA 3C3RA 3EHNA 5HRYA 2L6BA 4HOUA 3PH0C 3DSTA 3JY1A 2FO1E 1S0PA 2I1KA 2VGYA 3L6XA 3TT9A 3ZFWA 4F3VA 3QARA 4KVMA 1U3DA 4I5LA 1ELKA 3TWVA 1U6GC 4JB8P 1HF8A 2V5FA 4EVTA 4Y5JA 2UWJG 4TUMA 4W9RA 3NB2A 2YHCA 1OCRE 2IONA 3ASHA 3NF1A 4R7LA 5KJNA 2AW6A 3PEVB 3HXBA 2X1GF 1N4SA 3ZILA 3CQCB 4F6RD 4OVVA 4B93B 3FTVA 3E30A 1B3UA 3Q0QA 1FT1A 1JCQA 3O2QA 2DWZA 4EV8A 2PM7A 4OIHA 1E8XA 4RV1A 3DADA 3BWTA 3W9GA 4C0EA 1IKND 2FULA 1OWPA 4F1PA 3G2UA 3ZYMA 2PKGA 4DI3A 3U66A 4C0MA 4JA7A 3CKCA 2QK2A 3G2TA 2XCCA 4I2ZA 2VQ2A 2LAIA 2ETCA 4U95D 4KYOB 2ETAA 4HNAD 3ZU7B 3O4XA 2LAHA 4F53A 3RKVA 3D9OA 3UM2A 3ASDA 1HG2A 2X3MA 3S7DA 3QK0A 3WXXA 3RU0A 4EPZA 4G23A 3R7QA 1M8WA 3NOCD 1A17A 1JWGA 3CKBA 1PC2A 3BEEA 2IE4A 3NAWA 5FC8E 4NURA 5EN5D 3SF4A 5KUBA 1U2VG 2Q5DA 2XEVA 5KNGA 5JJ6A 1M8XA 2E0IA 4FZFA 3S2AA 5FQ8A 3UX4A 2XQ0A 4YJEA 3JXYA 1P5QA 3IHVA 1OCZE 3TX7A 3UKYB 1HG5A 2P9LG 3UJ0A 2R59A 3UM0A 2FEZA 4GCOA 3F6QA 3CHQA 4I5NA 5T8IA 4YNDA 3O4ZA 4L2LA 1JCSA 3K4EA 1OWOA 5CL9A 1UKLA 4D10C 3SY2A 1BLXB 4OAVB 3EU5A 2WQHA 3MZLB 1OY3D 4XI0A 3PVLA 3RZ9A 3ULEG 3UXGA 3I3NA 2VJ8A 2BNXA 3ZINA 5CL6A 4I17A 2L6JA 4GMRA 3AS4A 3TJPA 3UMVA 4JHRA 4XKBA 4FFBC 2NYJA 4JLQA 1UW4B 5EKFA 4GZDA 2HO1A 4J8DA 4EV9A 3JQ1A 4LNUD 1BK5A 3LY8A 1W9CA 4GTSA 4KMOA 2XZTG 4JPSA 2WXPA 1Y8MA 2WPVA 3GQ2A 3D9HA 4AV7A 5BNWA 5B56A 3HXDA 5BZ1A 4C48B 2XGSA 4UWXA 4U7EB 4BQKA 1M8ZA 4I6GA 5M72A 5H7PA 3MEKA 2NYMA 3RO3A 4J6IA 3T5VA 4YDOA 5BT1A 4U5OA 1WG0A 4GMOA 4BESA 3FUNA 2VSNA 3FU3A 2X6KA 1Z3XA 3JX7A 3Q7AA 2OCCE 2JDQA 1HXIA 2PF4A 3OXFA 4HRMB 3T7UA 3EDTB 2GRMA 4CB9A 3UKRG 1M8YA 4UQYA 4I37A 1D8DA 1BK6A 5EKGA 1O1TA 3LY9A 5EYLA 4BPLA 2DYSE 4FHJA 5A6CA 3DWLG 3ENEA 4U5VA 3SFXA 3SLAA 2DIWA 2WXKA 2VGLB 2P9SG 4H7YA 4DX5D 2GRLA 3PZ1A 5BV0A 2M63A 2LXMA 2IX3A 4X8QA 5JJ7A 4ATGA 1X81A 2WXIA 2L9BA 1TEZA 4A1SA 1RZ4A 4HOTA 3R9AB 4JW2A 5ENSD 2ILRA 2BEDA 3LVQE 3Q0NA 1N4QA 3S7JA 4ABNA 5AIJA 1EE5A 2RU4B 2XS8A 4EVPA 3GS3A 4GZCA 1IALA 4GMJA 2KZTB 4FULA 4PS3A 3CK7A 2EILE 3I5PA 3AAAC 2IE3A 4BSXA 3AG4E 4B8JA 1FPPA 3EJNA 5JHAA 4L4HA 2DVWA 4DX2A 4G11A 3VLDA 3FU6A 2X38A 2Y4TA 1KT1A 2H6HA 3BSXA 2LXLA 3AU3A 3EHQA 2DZOA 5LCWJ 3ZIRA 4AIFA 4I6EA 3VTXA 1TN6A 3GAEA 2ZU6B 2C2LA 5G2NA 4YVQC 5FT9A 5C1DA 3R9MA 2NXPA 4MKTA 1H2VC 1Q2ZA 1EPUA 3Q0OA 4UI9K 4HXIA 1NL4A 4BY6A 3FEXC 1FVHA 2EIJE 3LVRE 3UL0B 4G3AA 5HHGE 4JVSA 1D9SA 3ZIQA 3LEWA 3IEGA 2V8SE 2I6HA 3IBVA 1LF8A 1WY6A 2V5QC 4J7WA 3FEYC 4MZ5E 4U04A 3AG1E 4K6JA 4YJLA 2VTBA 5KLTB 1OCCE 3PE4A 1NI1A 4APOA 2IOLA 3Q7FA 4RG9A 4BETA 2GRQB 3PEUB 3BG1B 4XZ4A 4DPRA 4U5NA 5ARFA 2P9IG 5EDSA 5ANRA 4KBQA 1JPLA 5LCWC 4G8LA 2ONDA 3RRMB 3DSXA 4AEZC 3ZKVA 2R05A 2YNSA 1OCOE 2DZNA 2VSOE 5HQ8A 3ZIKA 3DXMG 3NBNB 3GYZA 3IFQA 5CLEA 3CEQA 1N4RA 3UT8A 1IB2A 1QGKA 1N9AA 1QZ7A 4YDYA 4DVGB 2PQRA 3WOZA 4NZWA 3TWSA 2NC9A 5CL7A 2P9UG 3ISMC 4XI9A 4BT8A 5FTPA 4UWLA 3JXIA 3GNIA 3OBVA 1SA5A 1ELRA 4OYSA 2NPPB 3D9JA 5LP0A 3CIAA 3LJNA 2Z5MA 2BF0X 2OVFA 3RZXA 3CV0A 3KS2A 2QK1A 3PRZA 3L22A 3APCA 1LTXA 3FGAB 2CG3A 5CLCA 4Q96A 4I2SA 1IYGA 3APFA 2XS1A 3DEPA 4Y6WA 3RRUA 3LJ3A 1RW2A 3SO8A 4UQXA 1QGRA 4K5AB 3BX2A 4AOFA 3H3DX 1TJCA 4GPMA 3V2XA 2BKKB 4MZ6E 4PUCA 2WMOA 5G04C 4DLOA 2JAKA 2JEKA 3PZ3A 3ZNGA 3QJZA 4ILIA 4G1TA 2EQXA 3BG0B 5AN8A 5HUWC 3JQ0A 2QFCA 2KM4A 2V0PA 1TNBA 5D2MC 3C2GA 3B7RL 4AM9A 1JCRA 4I8MA 2XA7B 3FTSA 1NP7A 3W3UA 4KZGA 3LPZA 3LS8A 2MYOA 3QKYA 3K7VA 5ARGA 3BUAA 4BT9A 4I9CA 3KD7A 3PSTA 4U5LA 4HRLA 5D66A 3ZIMA 3QNKA 5EX3A 5K9SA 2QZAA 4U0UA 3SHFA 5KNHD 4B8CB 1HE8A 5AQ9A 2J49A 1JDHA 3D9KA 2Y0BG 4D4EA 3LCAA 4DB9A 1TNZA 3NZSA 3OTNA 2P9NG 3TWTA 3D9PA 3BX3A 2LUHA 2J9QA 1E8WA 4B89A 2PNNA 3HVEA 4I2WA 5FQ4A 3D9LA 3IKOB 2H6GA 3ZIOA 5BYMA 4EZJA 3APDA 4DX7D 4R10A 5G55A 5AAOA 1XQRA 5LSWA 1PY1A 5T4YA 4XX5A
chains in the Genus database with same CATH topology
4WNDA 4ANWA 2CFZA 1M8XA 4UAFB 2E0IA 4FZFA 3PSPA 2J09A 2YJYA 2XGMA 5FQ8A 2Z6GA 2JKTA 2XQ0A 4YJEA 1UN0A 3S2AA 3JXYA 1P5QA 3PREA 3UX4A 5KJLA 3Q0MA 3IHVA 3NQPA 4UADA 4V3QA 2IFUA 3TX7A 3UKYB 1HG5A 3EBBA 2AXUA 4H7XA 4JL0A 1EJLI 2R59A 5KL8A 2X6IA 2FEZA 4YVOA 1E7UA 4GCOA 4APFA 4I1EA 1EJYI 5SVZA 2P58C 3CHQA 4I5NA 5DN7A 1OWMA 4UQIA 3FP3A 3O4ZA 4ILHB 4YNDA 3QDNA 5T8IA 4BWRA 4CRWA 3BTRC 4L2LA 2BAPA 2LNIA 3K4EA 1OWOA 4GZ3A 5CL9A 3L3QA 3GRLA 3L16A 1UKLA 3L13A 3MV2B 5CCMA 2WTKA 3CR3A 1E8ZA 3MA5A 1Z3YA 4D10C 4GA1A 3CVPA 5G05C 3CVYA 2WQHA 2F31A 4I3NA 5E6QB 4FADA 4E85A 5BPPA 3MZLB 2X6JA 2WXJA 4U8HA 1QBKB 4HNMA 3Q5MA 2NYLA 4CB8A 2VSYA 3PVLA 1UN9A 3RZ9A 4K0RA 4XI0A 4M3OA 4I1OB 1INZA 5LFAA 1FVFA 3I3NA 4U54A 4FJZA 2VJ8A 2NPPA 3AS8A 2HR2A 2BNXA 3ZINA 4RG6A 5CL6A 4I17A 1U3CA 2L6JA 5E75A 2IJGX 2LSVA 3MKRA 3CVWA 3AS4A 4YI0C 4AJWA 4HLEA 3BVSA 5AJLA 4A55A 3I4RB 3TJPA 3P2BA 3OQSA 3FUHA 4PDXA 3K5QA 3UMVA 3UT4A 4CDNA 3QWWA 3TXMA 4JHRA 1V18A 2Z6HA 4XKBA 3SNXA 4FFBC 4GCNA 4JLQA 1BPOA 1HZ4A 5EKFA 1UW4B 3GW4A 2KC7A 2HO1A 3ASGA 3FY4A 3OUXA 4EV9A 2BUGA 3JQ1A 1BK5A 1E8YA 4G11A 4J8DA 5C2YA 4DI4A 3UVUA 3Q47B 3LY8A 1W9CA 1DVPA 2CHWA 3GZ2A 5SW9A 3HIZA 4NEEA 4U5UA 2PZIA 4KXKB 3R7RA 5BZ5A 3PNTB 4I6JA 4KMOA 4P6ZG 1FCHA 4JPSA 2WXPA 4I6IA 1Y8MA 2WPVA 1LUJA 3QWVA 4WUYA 2A5UA 4D49A 2FF4A 3OPBA 3GQ2A 2YNQA 2VYIA 3S7BA 1EE4A 4HVBA 5AJDA 2Z5JA 4AV7A 3LYAA 5B56A 5BNWA 4UWFA 3WPTA 3UL1B 4I9EA 4JW3C 5CMYA 5A23A 1UPLA 5BZ1A 2Y4UA 4FU3A 2C1TA 2XGSA 4UWXA 2YQ8A 4GZ6A 4Q94A 5KCMA 2NYLB 4BQKA 3MJWA 3U64A 1JPPA 1M8ZA 4JW1A 4I6GA 2VGXB 3QOUA 5T3RA 5M72A 2YHEA 4MS6A 5K6SA 2H4MA 2LSUA 3MEKA 4CGVA 4I43A 4HOSA 3U9WA 2NYMA 3G2SA 4J6IA 3RO3A 3T5VA 4KVOA 2J4DA 3HYMB 4U0ZA 4WNEA 3K49A 5BT1A 4U5OA 1O6OA 1ZBPA 1Z2CB 4GMOA 3UKWB 1Z6TA 2VSNA 2E2EA 2X6KA 3FU0A 3FUNA 1X5BA 1Z3XA 2QY7A 3FU3A 4A0CA 3JX7A 3SL9A 3K5ZA 1GCJA 4FLHA 5J3VA 2JDQA 1EYHA 3FH7A 3LTMA 4GU5A 3T8MA 4CEMA 4O27A 3VE6A 1HXIA 1QQEA 2UY1B 2PF4A 4PLSA 5CL8A 3OXFA 3ZYQA 3DBSA 3T7UA 3EDTB 4GPKA 4AY6A 2GRMA 1Q1SC 3LDZA 5DBKA 2KCKA 4EZKA 2XOAA 4CB9A 4FJYA 4P6ZB 2RG8A 1M8YA 3HDXA 4N39A 4I37A 1ZU2A 4UQYA 1IHGA 5FQ7A 1BK6A 5EKGA 2Z5NA 2IU1A 5DIZA 4N3AA 3LY9A 5KL1A 1KT0A 4B8OA 4CT6B 4EBAA 4LERA 5AEIA 1IQRA 2X6FA 4BPLA 3C2HA 3CVQA 4FHJA 4ILGA 4L7MA 1M1EA 5A6CA 2HYZA 4TRQA 2X6HA 3NMWA 2WXQA 5D0OD 4AXHA 2BCTA 4UAEA 3ENEA 4K92A 2UY1A 4U5VA 1WA5C 5CLDA 5CLAA 3SLAA 2CFUA 2DIWA 4UI9J 5G05J 5J08A 4N3BA 2WXKA 4KZCA 2VGLB 4NACA 5BZVA 2CHZA 2R5SA 3QG9A 4UQZA 5A7DB 1H19A 2J08A 1MHQA 3PUKA 5BV1A 3OAWA 4N2SA 1OYZA 3WOYA 4H7YA 4PH4B 2GRLA 2XRZA 4JEUA 5J90A 5BV0A 4ME2A 2IWHA 2XGOA 2XPYA 3FDHA 4QMIA 2M63A 4GA2A 2IX3A 3ZN3A 1VDYA 5JJ7A 3CQGB 4ATGA 1TH1A 4XZRB 2WXIA 2AXVA 2L9BA 5ENNA 3K7WA 1W3BA 3OUWA 2WVIA 3SFZA 4CCAA 4CT4A 5FJYA 1E96B 3ZGQA 1TEZA 4A1SA 3ZHPA 3O2SA 3B7TA 4WNGA 4AY5A 4DBAA 2WXRA 3ML9A 3MGBA 1MQSA 1QZ2A 4TUUA 2GW1A 2CHXA 5JHBA 4HOTA 4GMLA 4L4IA 3URZA 1EDUA 3A6PA 3K61A 2RD0A 3MKQB 3SBTB 4BX9A 4J0UA 4CDMA 3TGOA 3HHMA 3R9AB 3ESLA 4JW2A 2I1JA 5CLBA 4XIFA 2ILRA 3LVQE 2OF3A 1HFAA 5FZSA 4EQFA 3O48A 4URKA 3Q0NA 1SZAA 4IULA 1N54A 3S7JA 4ABNA 4GYWA 3FWVA 5CHEE 1H2TC 1EE5A 2RU4B 5KLRB 5EX0A 5LOZA 2WQ7A 3MCXA 4EVPA 3GS3A 4GZCA 4GA0A 4WWOA 1IALA 3G2VA 2L0TB 2KZTB 2XPZA 4FULA 4GMJA 3EIJA 4PS3A 3LTJA 5EWPA 3CK7A 3FUMA 3I5PA 3FTXA 4HS2A 4J8FA 2IE3A 2FBNA 1SZ9A 5SWFA 2AVPA 4DJSA 3PUJA 4BSXA 3Q0RA 4B8JA 3ODRA 3Q0PA 3FH5A 2Z5KA 3RJVA 3EJNA 4HM9A 4BFRA 3GVTA 1PJNB 4CV5B 1QNFA 2DB0A 2WXOA 3AS5A 5JHAA 3CHOA 1JWFA 4GYYA 3BCTA 4L4HA 4FLBA 1XQSA 1OUVA 3NZUA 4FP7A 4MFUA 3CLJA 3GVOA 1M5NS 3VLDA 3FULA 3FU6A 3I4GA 2X38A 1LRVA 2Y4TA 1KT1A 2XHEA 3KAEA 3MV3B 3ZW3A 4F7AA 3L6YA 3BSXA 2XCBA 3AU3A 2YNRA 4MLPA 2IAEA 4JZYA 3CSFA 2FI7A 2QMRA 3ZIRA 3CHPA 3TL5A 4JEHA 4AIFA 3L3FX 5LCWJ 4I6EA 5EKQD 3VTXA 3Q5UA 3FTUA 3GAEA 1UN8A 3Q15A 2ZU6B 2WXLA 3B7SA 2IAEB 4BTAA 4CGWA 3D9NA 4ADYA 3KEZA 1H0AA 2C2LA 3LY7A 2AXZA 3DW8A 5G2NA 5CTTA 4YVQC 5BW8C 2WQ6A 4B18A 5FT9A 2KCVA 2WXHA 4EVAA 4GAAA 4MRUA 1NA3A 3ZYLA 5C1DA 4PS8A 2WB2A 3NMZA 4U58A 2NXPA 4I1MA 1H2VC 2VGXA 1H2UA 4MKTA 4F1SA 3K5YA 1EPUA 5JJTA 3Q0OA 3VWAA 4K03A 4WWPA 4UI9K 2MOWA 2V4LA 4GZ5A 4XE0A 3CVNA 4P29A 4HXIA 3C5WA 1WA5B 2YINA 3L6AA 4PLRA 4E4VA 4BY6A 4YK6A 3FEXC 1FVHA 1UJKA 3FH8A 3LVRE 4RVBA 3LXUX 4ACKA 3UL0B 2KCLA 4G3AA 5KJMA 5HHGE 4JVSA 2PQNA 5HI7A 3ZIQA 3ZRHA 4DK5A 3LEWA 3IEGA 2V8SE 2DBAA 3QHEA 2I6HA 4PLQA 1L5JA 4YGXA 3QGCA 3IBVA 3IV0A 1LF8A 4KZ0A 5G04J 1E7VA 2DCPA 1WY6A 4LUNU 4N2QA 3FEYC 4R11A 4XKCA 3V6YA 4MZ5E 4RSYA 4U04A 2J07A 1PAQA 3EHMA 4HOQA 2Q7FA 5FWQA 4G24A 3B7UX 4CRVB 2J4BA 3TXNA 4G26A 5JJAA 4O6FA 2W3CA 3MKQA 4K6JA 3TPOA 4TV3A 3QWPA 3UPVA 3ND2A 4YJLA 2VTBA 3MYVA 3DPDA 3CHMA 2NYMB 5KLTB 4ANUA 4EECA 2Z5OA 1WM5A 2C0MA 4Y6CA 3PE4A 2OT8A 1EF1C 2AWIA 4U0SA 4LACA 2MHKA 1ELWA 3FTYA 3V74A 2JKRA 3RK6A 4UWHA 3SBSA 3UT7A 3LWWA 4APOA 3PS6A 3TG5A 2CG2A 2IOLA 4J8EA 4IN3B 4RG9A 2IOSA 3OXLA 1YA0A 3TPMA 2C1MA 4N3CA 5FZQA 3G2WA 2NSZA 1HU3A 3K64A 3BG1B 3PEUB 4XZ4A 4DPRA 3CVXA 4U5NA 4OO6A 4RXHB 3PZDA 4L2YA 5ARFA 3UQ3A 3FFLA 4A3TA 1XM9A 3MX3A 5EDSA 3SGHA 4GYOA 3ZPJA 1IQ1C 5ANRA 3AU4A 4B8PA 4WV6A 2GGFA 1JPLA 3FUJA 4KBQA 5LCWC 5ANLA 2ONDA 5HUYC 3RRMB 4FHKA 4AEZC 4DJAA 3ZKVA 2I9CA 2YNSA 3ODSA 4V3OA 3FTWA 1E90A 2PM6A 3EA5B 3ONKA 2JLBA 4JXTA 2VSOE 3ZIPA 4HTVA 4I0YA 3TJZB 4FQ3A 3GZ1A 3L54A 3U4TA 5HQ8A 3ZIKA 3GYZA 3VLFA 4FC8A 4NRHB 3IFQA 5CLEA 1Y6IA 3CEQA 3CVLA 1H6KA 2IQCA 4DZSA 3UT8A 1IB2A 1NA0A 4ACLA 2FO7A 1QGKA 2A4ZA 3CGHA 1QZ7A 4BTBA 4UWKA 3VTYA 3NMXA 4H3HA 4ANVA 3D9MA 4DVGB 1N52A 2PQRA 3WOZA 4ANXA 2RU4A 1DNPA 4NZWA 1UPKA 4I1AA 3K62A 3Q0LA 4JHKA 3CSTA 4FZAA 2NC9A 5KJKA 5CL7A 2WM9A 3D9IA 3FUFA 5BZUA 4JC8A 4JHJA 2OOEA 4QMHA 4XI9A 5FTPA 4BT8A 1G3JA 4BA3A 1TJFA 4WWNA 4UWLA 3UKZB 3AU5A 3JCKC 4EZLA 3QC1A 3GNIA 4U63A 4LEUA 3OBVA 3Q0SA 1W63B 4V3IA 5CCLA 3FUIA 1JPWA 1ELRA 5H2WA 2WXGA 3EHNA 4OYSA 2NPPB 3D9JA 4HFGA 4G2VA 4IMJA 4QMJA 5LP0A 4HOUA 4V3RA 3CIAA 3PH0C 4B0ZA 2JKRB 2WXMA 3T5XA 1F59A 2Z5MA 3JY1A 2BF0X 3RZXA 2OVFA 2MRIA 3CV0A 2QK1A 2HM8A 3FEYA 1S0PA 3KS2A 4NQ0A 3PRZA 2I1KA 3L22A 3APCA 5CMWA 2VGYA 2VSXE 3QGBA 3L6XA 3TT9A 1I7WA 3ZFWA 3FGAB 2CG3A 2X19B 4F3VA 5CLCA 1Q1TC 1W63A 3FU5A 3L08A 4Q96A 4I2SA 1IYGA 3CK9A 3QARA 5E76A 1KLXA 2C0LA 3B13A 1U3DA 4KVMA 3N71A 4I5LA 1ELKA 1OWLA 3APFA 3GZSA 4Y6WA 1OWNA 3RRUA 3LJ3A 1HO8A 4ZDUA 1U6GC 2WXFA 4GMNA 3U3WA 4L1BA 1HF8A 2V5FA 1XGWA 4EVTA 1QGRA 3PNLB 4Y5JA 5H2XA 4UQXA 3BX2A 2UWJG 3JXZA 4AOFA 3ZYKA 3H3DX 1TJCA 3PDNA 5AYWD 3HVEB 1GW6A 4LRZA 4W9RA 4MZ6E 4AP2A 3FTZA 4PUCA 2WMOA 5G04C 5FQ6A 4A1GA 2JAKA 3WYFC 2JEKA 3TAXA 4DLOA 1I7XA 4HORA 3S7FA 1UG3A 2YHCA 3QJZA 4ILIA 4AVXA 4G1TA 4L7TA 4DLQA 2EQXA 3BG0B 4CBAA 2I2OA 2IONA 1TE4A 3ASHA 4CDRA 5HUWC 2WXNA 3NF1A 4IYPA 2AW6A 3PEVB 3QAQA 4JA9A 1B89A 4R7LA 2LO6A 5KJNA 3JQ0A 2QFCA 4GZDA 2X1GF 3EG5B 3BSBA 2KM4A 4B8AA 2V0PA 2XRYA 3L17A 2BKUB 1HS6A 3O2TA 3CHRA 2XA7A 3C2GA 4PVZA 2FV2A 4UQIB 3RRNB 3B7RL 2VTBB 3ZILA 4OVUA 3SD5A 1T08A 3CQCB 3FEXA 3UUXA 4AM9A 1XNFA 4OVVA 3JYSA 3PE3A 4I8MA 3FTVA 2XA7B 3ZVVA 1UJJA 1NP7A 3W3UA 3FTSA 3FUDA 3LKUA 4HXTA 4Q69A 3ZEFA 4KZGA 3RIBA 4FZDA 1B3UA 4QFVA 3LPZA 3Q0QA 3OXGA 2L0IA 3LS8A 4N5CA 4C9BB 4FA6A 3ULQA 3ZHEB 3P1UA 4U3JC 3QKYA 3O2QA 3K7VA 4DB6A 1IBRB 3QMLC 3TG4A 3RO2A 5ARGA 3SI5A 5AIJA 1HX8A 4EV8A 2PM7A 4OIHA 3V71A 1E8XA 4BT9A 4RV1A 4I9CA 4DB8A 3DADA 3BWTA 2Y3AA 3KD7A 4A3VA 3PSTA 3VLEA 3FUEA 2JKTB 5LX8A 4C0EA 4U5LA 2IW3A 4I7IA 5CL5A 2FULA 4H3KA 1OWPA 3G2UA 2QNAA 3ZIMA 1IQUA 4CT0A 3Q4AB 3UKXB 3ZYMA 4E6HA 4I96A 2PKGA 4DI3A 5D5KC 4B94A 3QNKA 2R17C 5EX3A 2OV8A 5K9SA 4JKQA 2KZTA 3ZHEA 1JUQA 4UWGA 4U0UA 4MFVA 5FZRA 3SHFA 1PJMB 4U2XD 4B8CB 3U66A 4C0MA 1HE8A 1SQMA 1WAO1 1Y2AC 2WMNA 4JA7A 1O6PA 3KNDA 4BX8A 1NZNA 3CKCA 2QK2A 2J49A 1JDHA 3G2TA 2XCCA 4I2ZA 4KT6B 5D0QD 5BUZA 2VQ2A 3D9KA 4WAFA 4D4EA 2LAIA 4DB9A 3IBEA 3LCAA 2IF4A 3K9IA 3NZSA 4KYOB 4JW2B 4TNMA 4IMIA 5CL4A 3Q49B 2BTDA 5CL3A 3CK8A 2P8QA 4CT7B 4PS7A 3OTNA 3GB8A 4U5SA 2XPIA 3O4XA 2LAHA 3ASFA 4GB9A 3D3MA 4R0ZA 3E4BA 3EIQC 4CRUB 3RKVA 4F53A 3D9OA 3ESKA 2GL7A 3D9PA 3IHYA 3BX3A 3TJ3A 3ASDA 1HG2A 2X3MA 2J9QA 3S7DA 4G25A 5AENA 1E8WA 3QK0A 3WXXA 3FUKA 3RU0A 4B89A 4EPZA 3HVEA 4FDDA 3QB2A 4I2WA 4G23A 4LCTA 2KATA 4L23A 4U07A 5FQ4A 3R7QA 3D9LA 3CVVA 1M8WA 4RZPA 3IKOB 1A17A 4J8SA 1JWGA 2PL2A 3ZIOA 5BYMA 3CKBA 1PC2A 3BEEA 3CHSA 3JUIA 3ONLA 4WNFA 3APDA 4EZJA 2VGLA 2IE4A 3CVUA 4R10A 5G55A 3SZ7A 5FC8E 4NURA 3SF4A 4EBAG 5KUBA 3FHEA 1XQRA 2Q5DA 5KLAA 3ML8A 3C98A 4IRUA 3NOWA 2XEVA 5LSWA 1PY1A 5T4YA 3ZXSA 2OVBA 4XX5A 4UI9C 5JJ6A 3FGAA 1HH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VLF A;  4FP7 A;  4A3V A;  3VLE A;  3VLD A;  4A3T A; 
#chains in the Genus database with same CATH topology
 4WND A;  5ENR D;  4UAF B;  3PSP A;  4GTO A;  3Q0M A;  3Q78 A;  3NQP A;  4H7X A;  5KL8 A;  4YVO A;  1E7U A;  3V31 A;  1EJY I;  1MZC A;  2P58 C;  1OWM A;  4CRW A;  4BWR A;  4GZ3 A;  3MV2 B;  3MA5 A;  1LD8 A;  3CVY A;  4I3N A;  5E6Q B;  4FAD A;  2X6J A;  4U8H A;  4CB8 A;  2VSY A;  4K0R A;  4M3O A;  1FVF A;  4U54 A;  3T8S A;  3J5P A;  2NPP A;  2HR2 A;  2IJG X;  1N94 A;  5KWD A;  3BVS A;  3I4R B;  5HS0 A;  3OQS A;  4PDX A;  4CDN A;  3SNX A;  3KEZ A;  3GW4 A;  2KC7 A;  3FY4 A;  2BUG A;  5C2Y A;  1YMP A;  3W9F A;  4DI4 A;  3UVU A;  4K5C A;  1DVP A;  4KXK B;  1KZO A;  4NEE A;  2PZI A;  3R7R A;  1O1S A;  4I6I A;  3QWV A;  2FF4 A;  2YNQ A;  3S7B A;  5EID A;  5AJD A;  5FIO A;  4UWF A;  5A23 A;  4Q94 A;  2NYL B;  3MJW A;  3U64 A;  4JW1 A;  3QOU A;  4MS6 A;  2OEW A;  3G2S A;  4U0Z A;  4WNE A;  1ZBP A;  1Z6T A;  4EBA G;  4N3A A;  3C3O A;  1X5B A;  1V54 E;  3C3Q A;  3IXE A;  3FH7 A;  3LTM A;  4CEM A;  4O27 A;  2UY1 B;  4PLS A;  5CL8 A;  1N95 A;  5DBK A;  4EZK A;  2XOA A;  4BSZ B;  3EU9 A;  4FJY A;  2RG8 A;  1ZU2 A;  4GTP A;  1IHG A;  4NIK A;  4HLL A;  1KT0 A;  4CT6 B;  4EBA A;  5AEI A;  1IQR A;  2X6F A;  5CEA A;  3C2H A;  4ILG A;  4L7M A;  2X6H A;  2R03 A;  3KSL A;  1KZP A;  5CLD A;  5CLA A;  5G05 J;  4UI9 J;  5J08 A;  4N3B A;  2ZIR A;  4NAC A;  4UQZ A;  5BZV A;  2CHZ A;  1H19 A;  3WOY A;  4PH4 B;  4ME2 A;  2IWH A;  4QMI A;  4GTV A;  2J8S D;  3CQG B;  4RQI A;  3SFY A;  1O1R A;  2AXV A;  5ENN A;  4CT4 A;  4OAU C;  4CCA A;  5FJY A;  3ZHP A;  3O2S A;  3UIN C;  2WXR A;  3ML9 A;  4TUU A;  2CHX A;  4GML A;  3SBT B;  3K61 A;  4J0U A;  4XIF A;  1HFA A;  4ZHB A;  4IUL A;  2Y1L E;  5EX0 A;  4G8K A;  2WQ7 A;  3Q75 A;  4WWO A;  3FUM A;  4HS2 A;  4J8F A;  2FBN A;  1SZ9 A;  2AVP A;  4DJS A;  3ODR A;  3FH5 A;  2Z5K A;  3JUE A;  3GVT A;  4CV5 B;  2WXO A;  3AS5 A;  4GPK A;  4GYY A;  3BCT A;  4FLB A;  1TR4 A;  3NZU A;  4FP7 A;  4MFU A;  3ZKJ A;  3KAE A;  4F7A A;  3L6Y A;  2XCB A;  3J5Q B;  4MLP A;  4JZY A;  3CSF A;  3CHP A;  3TL5 A;  4JEH A;  3FTU A;  3Q15 A;  3L9T A;  3B7S A;  4BTA A;  1YCS B;  2IO2 C;  3D9N A;  1H0A A;  2AXZ A;  4MBG A;  4L9P A;  3NMZ A;  4F1S A;  3VWA A;  4WWP A;  3C5W A;  2YIN A;  4PLR A;  1UJK A;  4J8Y A;  3LXU X;  2KCL A;  3UIP C;  4PLQ A;  4N2Q A;  3V6Y A;  1MX4 A;  5CBN A;  2J07 A;  1V55 E;  3EHM A;  4XEI G;  4G24 A;  3B7U X;  4G26 A;  4O6F A;  4TV3 A;  4EHM A;  2Z5O A;  2IO3 C;  2DYR E;  2JKR A;  3UT7 A;  3PS6 A;  1N11 A;  3E33 A;  3OXL A;  2XEH A;  2C1M A;  4N3C A;  2VGE A;  2NSZ A;  1A5E A;  3K64 A;  4RXH B;  4A3T A;  3ZPJ A;  3AU4 A;  2GGF A;  4A63 B;  4BEP A;  4K5B A;  3V79 K;  4V3O A;  3ONK A;  2JLB A;  2P9K G;  3U4T A;  5EYP F;  5BXU A;  1K3Z D;  1WDY A;  3AG3 E;  4DZS A;  1NA0 A;  5JA4 D;  3VTY A;  4H3H A;  3HXE A;  2RU4 A;  1UPK A;  3K62 A;  3Q0L A;  3D9I A;  4LNG A;  4JHJ A;  2P9P G;  4WWN A;  3BU8 A;  3QC1 A;  1W63 B;  5H2W A;  4HFG A;  5EIB E;  4G2V A;  2ZGG A;  4IMJ A;  4QMJ A;  1SW6 A;  4V3R A;  1BD8 A;  3T5X A;  1F59 A;  2MRI A;  3FEY A;  2HM8 A;  3DPY A;  5CMW A;  3V2O A;  1I7W A;  2X19 B;  1Q1T C;  1NFI E;  3FU5 A;  3TWX A;  1LSH A;  3CK9 A;  3PZ2 A;  1KLX A;  2C0L A;  3UM3 A;  3N71 A;  1OWL A;  4M7C A;  4ZDU A;  3U3W A;  2WXF A;  4GMN A;  1SVX A;  4L1B A;  3AJI A;  1XGW A;  5H2X A;  3JXZ A;  3ZYK A;  3HVE B;  1GW6 A;  4LRZ A;  4AP2 A;  3FTZ A;  4A1G A;  5CED B;  3WYF C;  3TAX A;  4TXP A;  3S7F A;  2B6C A;  4AVX A;  1MX2 A;  1FT2 A;  4L7T A;  2QYU A;  4CBA A;  2I2O A;  3ABM E;  3Q9U C;  2Y69 E;  4TXQ A;  1B89 A;  2LO6 A;  1YYH A;  3BSB A;  3PZ4 A;  1HS6 A;  3CHR A;  2XA7 A;  3SQV A;  4OVU A;  1IHB A;  1T08 A;  3UUX A;  3PE3 A;  3RSE G;  3ZVV A;  1UJJ A;  3LKU A;  4HXT A;  2EIN E;  3ZEF A;  4FZD A;  3ASN E;  5EIL A;  4FA6 A;  4N5C A;  3ULQ A;  3ZHE B;  4U3J C;  3TG4 A;  4DB6 A;  1IBR B;  4A3V A;  5LX8 A;  3FUE A;  2F0Y A;  4O1P A;  2IW3 A;  4I7I A;  5CL5 A;  1BI7 B;  2QNA A;  2BKG A;  4CT0 A;  3T8K A;  3UKX B;  2QYJ A;  5D5K C;  5B1B E;  2R17 C;  2OV8 A;  5AQA A;  4UWG A;  4MFV A;  1PJM B;  2KXP C;  1SQM A;  1WAO 1;  1Y2A C;  3KND A;  5D0Q D;  5BUZ A;  4WAF A;  3IBE A;  2IF4 A;  3K9I A;  5CL4 A;  3Q49 B;  2BTD A;  5CL3 A;  4PS7 A;  3DSS A;  3GB8 A;  4U5S A;  3ASF A;  3D3M A;  4R0Z A;  3EIQ C;  4CRU B;  3IHY A;  4G25 A;  5AEN A;  3FUK A;  3QB2 A;  4LCT A;  3CVV A;  4RZP A;  4J8S A;  2PL2 A;  3CHS A;  3ONL A;  4GTQ A;  4WNF A;  3CVU A;  3TWU A;  3ML8 A;  3ZXS A;  2OVB A;  4ANW A;  2CFZ A;  2YJY A;  2JKT A;  1UN0 A;  1TNY A;  3PRE A;  2KBX A;  4UAD A;  2IFU A;  1EJL I;  2HE0 A;  3UI2 A;  2X6I A;  4APF A;  5SVZ A;  5DN7 A;  4ILH B;  3X2Q E;  3HXF A;  2LNI A;  3GRL A;  3L16 A;  5CCM A;  1Z3Y A;  5G05 C;  4E85 A;  1QBK B;  4HNM A;  3Q5M A;  3NOG D;  4I1O B;  5LFA A;  4FJZ A;  5FIN A;  5CEC B;  1SA4 A;  4RG6 A;  5E75 A;  3MKR A;  3CVW A;  4UUC A;  1IXV A;  4YI0 C;  4LG6 A;  4AJW A;  5AJL A;  4HLE A;  3P2B A;  3FUH A;  3UT4 A;  3QWW A;  3TXM A;  1V18 A;  5HKP A;  4GCN A;  1BPO A;  4AY6 A;  3ASG A;  3UQ3 A;  3Q47 B;  1N4K A;  2CHW A;  5SW9 A;  4U5U A;  5BZ5 A;  4O60 A;  1FCH A;  2XEN A;  4WUY A;  1LUJ A;  1K1B A;  4D49 A;  3OPB A;  1EE4 A;  1D8E A;  4RLY A;  3WPT A;  3UL1 B;  4I9E A;  5CMY A;  2Y4U A;  4FU3 A;  2YQ8 A;  3HRA A;  5KCM A;  4N5Q A;  5T3R A;  2AJA A;  2H4M A;  5IY5 E;  4I43 A;  4KVO A;  3AG2 E;  3K49 A;  1Z2C B;  3UKW B;  3FU0 A;  2P2C P;  1O5M A;  2QY7 A;  3K5Z A;  3SL9 A;  4FLH A;  1EYH A;  3ZYQ A;  3DBS A;  2F37 A;  1Q1S C;  3HDX A;  5DIZ A;  3CVQ A;  2HYZ A;  4TRQ A;  3NMW A;  5D0O D;  4AXH A;  4UAE A;  4K92 A;  1OT8 A;  5JJT A;  4KZC A;  5A7D B;  3QG9 A;  2J08 A;  1MHQ A;  3B95 A;  4N2S A;  5J90 A;  2IEJ A;  3ZN3 A;  1TN8 A;  1VDY A;  1TH1 A;  4XZR B;  3K7W A;  2WVI A;  3OUW A;  1AWC B;  4AY5 A;  3B7T A;  4CZ2 D;  1K1A A;  4DBA A;  3MGB A;  1MQS A;  4HI8 A;  2GW1 A;  5JHB A;  4CDM A;  1EDU A;  3TGO A;  3HHM A;  3ESL A;  5KBA A;  5CLB A;  3EHR A;  2OF3 A;  5FZS A;  4EQF A;  3O48 A;  1SZA A;  4DRX E;  1N54 A;  3FWV A;  5CHE E;  1H2T C;  3RAU A;  5KLR B;  3MCX A;  4GA0 A;  3G2V A;  2GRN B;  2XPZ A;  3EIJ A;  3LTJ A;  5EWP A;  3HXC A;  3ABK E;  3PUJ A;  3Q0R A;  3RJV A;  4GTR A;  2F8Y A;  4HM9 A;  1QNF A;  1JWF A;  1DC2 A;  1XQS A;  3FUL A;  1M5N S;  3I4G A;  1LRV A;  2XHE A;  3B7B A;  2YNR A;  2IY0 C;  2FI7 A;  3ZUV B;  2QMR A;  2RFA A;  3L3F X;  5EKQ D;  4CGW A;  2IAE B;  2RKK A;  3LY7 A;  5CTT A;  4B18 A;  2KCV A;  2WXH A;  4GAA A;  3ZYL A;  2EIM E;  3Q9N C;  2WB2 A;  4U58 A;  5B3S E;  1H2U A;  2MOW A;  4GZ5 A;  4XE0 A;  3CVN A;  4P29 A;  1TYQ G;  3L6A A;  4E4V A;  4YK6 A;  4ACK A;  3FH8 A;  4RVB A;  2PQN A;  3L82 A;  5HI7 A;  4DK5 A;  2DBA A;  3QHE A;  2XZD G;  3QGC A;  1BU9 A;  4KZ0 A;  3DSV A;  4LUN U;  4R11 A;  4RSY A;  4JD2 G;  1PAQ A;  4HOQ A;  2Q7F A;  2QC9 A;  4CRV B;  2JAB A;  3TXN A;  5JJA A;  2W3C A;  3MKQ A;  3TPO A;  3ND2 A;  3CHM A;  4ANU A;  4EEC A;  1WM5 A;  2C0M A;  1EF1 C;  2AWI A;  4LAC A;  2MHK A;  1ELW A;  5ENQ D;  3V74 A;  3LWW A;  3TG5 A;  2CG2 A;  4IN3 B;  1YA0 A;  3TPM A;  3DEO A;  5FZQ A;  1BI8 B;  1HU3 A;  4OO6 A;  3PZD A;  5ENT D;  3SGH A;  4GYO A;  4O1O A;  4WV6 A;  3FUJ A;  5ANL A;  5HUY C;  1MYO A;  4DJA A;  3ODS A;  3FTW A;  1E90 A;  2PM6 A;  4JXT A;  5CRU A;  2V4H C;  4HTV A;  4I0Y A;  3DXK G;  3GZ1 A;  3L54 A;  3VLF A;  3CVL A;  1H6K A;  2IQC A;  4BTB A;  4UWK A;  4HB5 A;  3NMX A;  4ANX A;  1N52 A;  2RFM A;  5KJK A;  3DRA A;  4JC8 A;  4BA3 A;  4EZL A;  3UKZ B;  4LEU A;  5CCL A;  4V3I A;  2ZGD A;  3FUI A;  1JPW A;  2WXG A;  4LNB A;  2H6I A;  3DSW A;  4B0Z A;  2JKR B;  2WXM A;  4NQ0 A;  2VSX E;  3QGB A;  3KSQ A;  4TXR A;  1W63 A;  3L08 A;  1MX6 A;  5E76 A;  3B13 A;  3GZS A;  1OWN A;  1HO8 A;  3PNL B;  5AYW D;  1S64 A;  3JXJ A;  5FQ6 A;  1I7X A;  4HOR A;  1UG3 A;  3DSU A;  1AP7 A;  3UKU G;  4DLQ A;  4CDR A;  1TE4 A;  2WXN A;  4IYP A;  4JA9 A;  3QAQ A;  3Q79 A;  4B8A A;  3EG5 B;  3L17 A;  2XRY A;  4ZFH A;  2BKU B;  3O2T A;  4PVZ A;  4UQI B;  2FV2 A;  3RRN B;  2VTB B;  5ENO D;  3SD5 A;  2OEV A;  3FEX A;  1XNF A;  3JYS A;  2GRR B;  3FUD A;  4Q69 A;  3RIB A;  4QFV A;  4YDW A;  3OXG A;  2L0I A;  4C9B B;  3P1U A;  3QML C;  3RO2 A;  3SI5 A;  1HX8 A;  3V71 A;  1S63 A;  4U8V D;  5CRV A;  4DB8 A;  2Y3A A;  3VLE A;  2JKT B;  4H3K A;  1IQU A;  3Q4A B;  4E6H A;  4I96 A;  2B0O E;  4B94 A;  3ULY A;  4JKQ A;  2KZT A;  3ZHE A;  1JUQ A;  5FZR A;  4U2X D;  3KEA A;  4HBD A;  2WMN A;  1O6P A;  4BX8 A;  1NZN A;  3HG0 D;  4KT6 B;  4LSZ E;  1ZB1 A;  4JW2 B;  4TNM A;  4IMI A;  3CK8 A;  2P8Q A;  4CT7 B;  2XPI A;  4GB9 A;  3E4B A;  3ESK A;  2GL7 A;  3TJ3 A;  4CYM D;  5ITZ F;  4FDD A;  4U07 A;  4DUI A;  2KAT A;  1H6O A;  3JUI A;  2VGL A;  3SZ7 A;  3E32 A;  3FHE A;  3UJ4 A;  5KLA A;  3C98 A;  4IRU A;  3NOW A;  1Z5S C;  3UM1 A;  4U8Y D;  4UI9 C;  3FGA A;  1HH8 A;  4YDE A;  5AQ7 A;  2J09 A;  2XGM A;  2Z6G A;  5KJL A;  3BQO A;  4V3Q A;  3EBB A;  2AXU A;  4JL0 A;  4HQD A;  4DX1 A;  5BXO A;  4I1E A;  3FP3 A;  4UQI A;  3QDN A;  3BTR C;  2BAP A;  1TN7 A;  3L3Q A;  3L13 A;  2WTK A;  3CR3 A;  1E8Z A;  4GA1 A;  3CVP A;  3E37 A;  2F31 A;  5BPP A;  2WXJ A;  3C5R A;  5AQB A;  2NYL A;  1UN9 A;  1INZ A;  3AS8 A;  1U3C A;  2LSV A;  4A55 A;  2GRP B;  3TWQ A;  3K5Q A;  1TNO A;  2Z6H A;  1HZ4 A;  3GZ2 A;  3PDN A;  3PNT B;  3OUX A;  1E8Y A;  2A5E A;  3HIZ A;  5AAR A;  4I6J A;  4P6Z G;  2A5U A;  4HVB A;  2VYI A;  2Z5J A;  3LYA A;  1N4P A;  4JW3 C;  1UPL A;  2C1T A;  4GZ6 A;  3C72 A;  1JPP A;  2VGX B;  2YHE A;  5K6S A;  2LSU A;  4CGV A;  4HOS A;  3U9W A;  2J4D A;  3HYM B;  5JMN D;  1O6O A;  4Y6C A;  1DCQ A;  2E2E A;  4A0C A;  1GCJ A;  5J3V A;  4GU5 A;  3T8M A;  3VE6 A;  1QQE A;  3LDZ A;  2KCK A;  5CBO A;  3ASO E;  4P6Z B;  5FQ7 A;  4N39 A;  5B1A E;  2Z5N A;  2IU1 A;  3E34 A;  5KL1 A;  4B8O A;  4LER A;  1M1E A;  2WXQ A;  4U96 D;  2BCT A;  2UY1 A;  1WA5 C;  2CFU A;  2R5S A;  5BV1 A;  3PUK A;  3OAW A;  1OYZ A;  3TWR A;  2XRZ A;  4JEU A;  2XGO A;  2XPY A;  3FDH A;  4GA2 A;  3SFZ A;  1W3B A;  1E96 B;  3ZGQ A;  1OXJ A;  4WNG A;  1QZ2 A;  3ABL E;  3URZ A;  4L4I A;  3A6P A;  2RD0 A;  3MKQ B;  4BX9 A;  2I1J A;  1QBQ A;  4GTT A;  4URK A;  4GYW A;  5LOZ A;  3UIO C;  1MJ0 A;  2L0T B;  1G3N B;  1UOH A;  3FTX A;  5SWF A;  3Q0P A;  4BFR A;  1PJN B;  2DB0 A;  3CHO A;  1S70 B;  1OUV A;  3CLJ A;  4L23 A;  3GVO A;  3MV3 B;  3ZW3 A;  2R02 A;  2IAE A;  2F8X K;  3Q5U A;  2ETB A;  1UN8 A;  2WXL A;  4ADY A;  2ZXW E;  3DW8 A;  5BW8 C;  2WQ6 A;  4EVA A;  4MRU A;  1NA3 A;  5CER B;  4PS8 A;  4I1M A;  2VGX A;  4ATZ D;  3K5Y A;  4K03 A;  2V4L A;  1N0R A;  1DCE A;  1WA5 B;  5KJM A;  3ZRH A;  1TNU A;  1L5J A;  4YGX A;  4BER A;  3IV0 A;  5G04 J;  1E7V A;  2DCP A;  4XKC A;  4DX6 D;  2EIK E;  5FWQ A;  2J4B A;  4HRN A;  3QWP A;  3UPV A;  3MYV A;  3DPD A;  2NYM B;  2R2L A;  2OT8 A;  4U0S A;  3FTY A;  5ENP D;  3T9K A;  3RK6 A;  4UWH A;  3SBS A;  4J8E A;  2IOS A;  3G2W A;  3CVX A;  4L2Y A;  3FFL A;  1XM9 A;  3MX3 A;  1IQ1 C;  4B8P A;  4FHK A;  1KPS B;  2I9C A;  2GRO B;  3EA5 B;  3V30 A;  3ZIP A;  3TJZ B;  4FQ3 A;  1QYM A;  4QQI A;  3Q73 A;  3TWW A;  4FC8 A;  4NRH B;  1Y6I A;  4Z68 A;  3ZXP A;  2XEE A;  4ACL A;  2FO7 A;  2A4Z A;  3CGH A;  4ANV A;  3D9M A;  3WG7 E;  1DNP A;  1N0Q A;  4GTM A;  4I1A A;  4JHK A;  3CST A;  4FZA A;  1LD7 A;  2WM9 A;  3FUF A;  5BZU A;  3UTM A;  2ZIS A;  2OOE A;  4QMH A;  1G3J A;  4HI9 A;  1TJF A;  3EUV A;  1H6P A;  3JCK C;  3AU5 A;  1K8K G;  4U63 A;  2H6F A;  3Q0S A;  3C3R A;  3EHN A;  5HRY A;  2L6B A;  4HOU A;  3PH0 C;  3DST A;  3JY1 A;  2FO1 E;  1S0P A;  2I1K A;  2VGY A;  3L6X A;  3TT9 A;  3ZFW A;  4F3V A;  3QAR A;  4KVM A;  1U3D A;  4I5L A;  1ELK A;  3TWV A;  1U6G C;  4JB8 P;  1HF8 A;  2V5F A;  4EVT A;  4Y5J A;  2UWJ G;  4TUM A;  4W9R A;  3NB2 A;  2YHC A;  1OCR E;  2ION A;  3ASH A;  3NF1 A;  4R7L A;  5KJN A;  2AW6 A;  3PEV B;  3HXB A;  2X1G F;  1N4S A;  3ZIL A;  3CQC B;  4F6R D;  4OVV A;  4B93 B;  3FTV A;  3E30 A;  1B3U A;  3Q0Q A;  1FT1 A;  1JCQ A;  3O2Q A;  2DWZ A;  4EV8 A;  2PM7 A;  4OIH A;  1E8X A;  4RV1 A;  3DAD A;  3BWT A;  3W9G A;  4C0E A;  1IKN D;  2FUL A;  1OWP A;  4F1P A;  3G2U A;  3ZYM A;  2PKG A;  4DI3 A;  3U66 A;  4C0M A;  4JA7 A;  3CKC A;  2QK2 A;  3G2T A;  2XCC A;  4I2Z A;  2VQ2 A;  2LAI A;  2ETC A;  4U95 D;  4KYO B;  2ETA A;  4HNA D;  3ZU7 B;  3O4X A;  2LAH A;  4F53 A;  3RKV A;  3D9O A;  3UM2 A;  3ASD A;  1HG2 A;  2X3M A;  3S7D A;  3QK0 A;  3WXX A;  3RU0 A;  4EPZ A;  4G23 A;  3R7Q A;  1M8W A;  3NOC D;  1A17 A;  1JWG A;  3CKB A;  1PC2 A;  3BEE A;  2IE4 A;  3NAW A;  5FC8 E;  4NUR A;  5EN5 D;  3SF4 A;  5KUB A;  1U2V G;  2Q5D A;  2XEV A;  5KNG A;  5JJ6 A;  1M8X A;  2E0I A;  4FZF A;  3S2A A;  5FQ8 A;  3UX4 A;  2XQ0 A;  4YJE A;  3JXY A;  1P5Q A;  3IHV A;  1OCZ E;  3TX7 A;  3UKY B;  1HG5 A;  2P9L G;  3UJ0 A;  2R59 A;  3UM0 A;  2FEZ A;  4GCO A;  3F6Q A;  3CHQ A;  4I5N A;  5T8I A;  4YND A;  3O4Z A;  4L2L A;  1JCS A;  3K4E A;  1OWO A;  5CL9 A;  1UKL A;  4D10 C;  3SY2 A;  1BLX B;  4OAV B;  3EU5 A;  2WQH A;  3MZL B;  1OY3 D;  4XI0 A;  3PVL A;  3RZ9 A;  3ULE G;  3UXG A;  3I3N A;  2VJ8 A;  2BNX A;  3ZIN A;  5CL6 A;  4I17 A;  2L6J A;  4GMR A;  3AS4 A;  3TJP A;  3UMV A;  4JHR A;  4XKB A;  4FFB C;  2NYJ A;  4JLQ A;  1UW4 B;  5EKF A;  4GZD A;  2HO1 A;  4J8D A;  4EV9 A;  3JQ1 A;  4LNU D;  1BK5 A;  3LY8 A;  1W9C A;  4GTS A;  4KMO A;  2XZT G;  4JPS A;  2WXP A;  1Y8M A;  2WPV A;  3GQ2 A;  3D9H A;  4AV7 A;  5BNW A;  5B56 A;  3HXD A;  5BZ1 A;  4C48 B;  2XGS A;  4UWX A;  4U7E B;  4BQK A;  1M8Z A;  4I6G A;  5M72 A;  5H7P A;  3MEK A;  2NYM A;  3RO3 A;  4J6I A;  3T5V A;  4YDO A;  5BT1 A;  4U5O A;  1WG0 A;  4GMO A;  4BES A;  3FUN A;  2VSN A;  3FU3 A;  2X6K A;  1Z3X A;  3JX7 A;  3Q7A A;  2OCC E;  2JDQ A;  1HXI A;  2PF4 A;  3OXF A;  4HRM B;  3T7U A;  3EDT B;  2GRM A;  4CB9 A;  3UKR G;  1M8Y A;  4UQY A;  4I37 A;  1D8D A;  1BK6 A;  5EKG A;  1O1T A;  3LY9 A;  5EYL A;  4BPL A;  2DYS E;  4FHJ A;  5A6C A;  3DWL G;  3ENE A;  4U5V A;  3SFX A;  3SLA A;  2DIW A;  2WXK A;  2VGL B;  2P9S G;  4H7Y A;  4DX5 D;  2GRL A;  3PZ1 A;  5BV0 A;  2M63 A;  2LXM A;  2IX3 A;  4X8Q A;  5JJ7 A;  4ATG A;  1X81 A;  2WXI A;  2L9B A;  1TEZ A;  4A1S A;  1RZ4 A;  4HOT A;  3R9A B;  4JW2 A;  5ENS D;  2ILR A;  2BED A;  3LVQ E;  3Q0N A;  1N4Q A;  3S7J A;  4ABN A;  5AIJ A;  1EE5 A;  2RU4 B;  2XS8 A;  4EVP A;  3GS3 A;  4GZC A;  1IAL A;  4GMJ A;  2KZT B;  4FUL A;  4PS3 A;  3CK7 A;  2EIL E;  3I5P A;  3AAA C;  2IE3 A;  4BSX A;  3AG4 E;  4B8J A;  1FPP A;  3EJN A;  5JHA A;  4L4H A;  2DVW A;  4DX2 A;  4G11 A;  3VLD A;  3FU6 A;  2X38 A;  2Y4T A;  1KT1 A;  2H6H A;  3BSX A;  2LXL A;  3AU3 A;  3EHQ A;  2DZO A;  5LCW J;  3ZIR A;  4AIF A;  4I6E A;  3VTX A;  1TN6 A;  3GAE A;  2ZU6 B;  2C2L A;  5G2N A;  4YVQ C;  5FT9 A;  5C1D A;  3R9M A;  2NXP A;  4MKT A;  1H2V C;  1Q2Z A;  1EPU A;  3Q0O A;  4UI9 K;  4HXI A;  1NL4 A;  4BY6 A;  3FEX C;  1FVH A;  2EIJ E;  3LVR E;  3UL0 B;  4G3A A;  5HHG E;  4JVS A;  1D9S A;  3ZIQ A;  3LEW A;  3IEG A;  2V8S E;  2I6H A;  3IBV A;  1LF8 A;  1WY6 A;  2V5Q C;  4J7W A;  3FEY C;  4MZ5 E;  4U04 A;  3AG1 E;  4K6J A;  4YJL A;  2VTB A;  5KLT B;  1OCC E;  3PE4 A;  1NI1 A;  4APO A;  2IOL A;  3Q7F A;  4RG9 A;  4BET A;  2GRQ B;  3PEU B;  3BG1 B;  4XZ4 A;  4DPR A;  4U5N A;  5ARF A;  2P9I G;  5EDS A;  5ANR A;  4KBQ A;  1JPL A;  5LCW C;  4G8L A;  2OND A;  3RRM B;  3DSX A;  4AEZ C;  3ZKV A;  2R05 A;  2YNS A;  1OCO E;  2DZN A;  2VSO E;  5HQ8 A;  3ZIK A;  3DXM G;  3NBN B;  3GYZ A;  3IFQ A;  5CLE A;  3CEQ A;  1N4R A;  3UT8 A;  1IB2 A;  1QGK A;  1N9A A;  1QZ7 A;  4YDY A;  4DVG B;  2PQR A;  3WOZ A;  4NZW A;  3TWS A;  2NC9 A;  5CL7 A;  2P9U G;  3ISM C;  4XI9 A;  4BT8 A;  5FTP A;  4UWL A;  3JXI A;  3GNI A;  3OBV A;  1SA5 A;  1ELR A;  4OYS A;  2NPP B;  3D9J A;  5LP0 A;  3CIA A;  3LJN A;  2Z5M A;  2BF0 X;  2OVF A;  3RZX A;  3CV0 A;  3KS2 A;  2QK1 A;  3PRZ A;  3L22 A;  3APC A;  1LTX A;  3FGA B;  2CG3 A;  5CLC A;  4Q96 A;  4I2S A;  1IYG A;  3APF A;  2XS1 A;  3DEP A;  4Y6W A;  3RRU A;  3LJ3 A;  1RW2 A;  3SO8 A;  4UQX A;  1QGR A;  4K5A B;  3BX2 A;  4AOF A;  3H3D X;  1TJC A;  4GPM A;  3V2X A;  2BKK B;  4MZ6 E;  4PUC A;  2WMO A;  5G04 C;  4DLO A;  2JAK A;  2JEK A;  3PZ3 A;  3ZNG A;  3QJZ A;  4ILI A;  4G1T A;  2EQX A;  3BG0 B;  5AN8 A;  5HUW C;  3JQ0 A;  2QFC A;  2KM4 A;  2V0P A;  1TNB A;  5D2M C;  3C2G A;  3B7R L;  4AM9 A;  1JCR A;  4I8M A;  2XA7 B;  3FTS A;  1NP7 A;  3W3U A;  4KZG A;  3LPZ A;  3LS8 A;  2MYO A;  3QKY A;  3K7V A;  5ARG A;  3BUA A;  4BT9 A;  4I9C A;  3KD7 A;  3PST A;  4U5L A;  4HRL A;  5D66 A;  3ZIM A;  3QNK A;  5EX3 A;  5K9S A;  2QZA A;  4U0U A;  3SHF A;  5KNH D;  4B8C B;  1HE8 A;  5AQ9 A;  2J49 A;  1JDH A;  3D9K A;  2Y0B G;  4D4E A;  3LCA A;  4DB9 A;  1TNZ A;  3NZS A;  3OTN A;  2P9N G;  3TWT A;  3D9P A;  3BX3 A;  2LUH A;  2J9Q A;  1E8W A;  4B89 A;  2PNN A;  3HVE A;  4I2W A;  5FQ4 A;  3D9L A;  3IKO B;  2H6G A;  3ZIO A;  5BYM A;  4EZJ A;  3APD A;  4DX7 D;  4R10 A;  5G55 A;  5AAO A;  1XQR A;  5LSW A;  1PY1 A;  5T4Y A;  4XX5 A; 
#chains in the Genus database with same CATH homology
 4WND A;  4ANW A;  2CFZ A;  1M8X A;  4UAF B;  2E0I A;  4FZF A;  3PSP A;  2J09 A;  2YJY A;  2XGM A;  5FQ8 A;  2Z6G A;  2JKT A;  2XQ0 A;  4YJE A;  1UN0 A;  3S2A A;  3JXY A;  1P5Q A;  3PRE A;  3UX4 A;  5KJL A;  3Q0M A;  3IHV A;  3NQP A;  4UAD A;  4V3Q A;  2IFU A;  3TX7 A;  3UKY B;  1HG5 A;  3EBB A;  2AXU A;  4H7X A;  4JL0 A;  1EJL I;  2R59 A;  5KL8 A;  2X6I A;  2FEZ A;  4YVO A;  1E7U A;  4GCO A;  4APF A;  4I1E A;  1EJY I;  5SVZ A;  2P58 C;  3CHQ A;  4I5N A;  5DN7 A;  1OWM A;  4UQI A;  3FP3 A;  3O4Z A;  4ILH B;  4YND A;  3QDN A;  5T8I A;  4BWR A;  4CRW A;  3BTR C;  4L2L A;  2BAP A;  2LNI A;  3K4E A;  1OWO A;  4GZ3 A;  5CL9 A;  3L3Q A;  3GRL A;  3L16 A;  1UKL A;  3L13 A;  3MV2 B;  5CCM A;  2WTK A;  3CR3 A;  1E8Z A;  3MA5 A;  1Z3Y A;  4D10 C;  4GA1 A;  3CVP A;  5G05 C;  3CVY A;  2WQH A;  2F31 A;  4I3N A;  5E6Q B;  4FAD A;  4E85 A;  5BPP A;  3MZL B;  2X6J A;  2WXJ A;  4U8H A;  1QBK B;  4HNM A;  3Q5M A;  2NYL A;  4CB8 A;  2VSY A;  3PVL A;  1UN9 A;  3RZ9 A;  4K0R A;  4XI0 A;  4M3O A;  4I1O B;  1INZ A;  5LFA A;  1FVF A;  3I3N A;  4U54 A;  4FJZ A;  2VJ8 A;  2NPP A;  3AS8 A;  2HR2 A;  2BNX A;  3ZIN A;  4RG6 A;  5CL6 A;  4I17 A;  1U3C A;  2L6J A;  5E75 A;  2IJG X;  2LSV A;  3MKR A;  3CVW A;  3AS4 A;  4YI0 C;  4AJW A;  4HLE A;  3BVS A;  5AJL A;  4A55 A;  3I4R B;  3TJP A;  3P2B A;  3OQS A;  3FUH A;  4PDX A;  3K5Q A;  3UMV A;  3UT4 A;  4CDN A;  3QWW A;  3TXM A;  4JHR A;  1V18 A;  2Z6H A;  4XKB A;  3SNX A;  4FFB C;  4GCN A;  4JLQ A;  1BPO A;  1HZ4 A;  5EKF A;  1UW4 B;  3GW4 A;  2KC7 A;  2HO1 A;  3ASG A;  3FY4 A;  3OUX A;  4EV9 A;  2BUG A;  3JQ1 A;  1BK5 A;  1E8Y A;  4G11 A;  4J8D A;  5C2Y A;  4DI4 A;  3UVU A;  3Q47 B;  3LY8 A;  1W9C A;  1DVP A;  2CHW A;  3GZ2 A;  5SW9 A;  3HIZ A;  4NEE A;  4U5U A;  2PZI A;  4KXK B;  3R7R A;  5BZ5 A;  3PNT B;  4I6J A;  4KMO A;  4P6Z G;  1FCH A;  4JPS A;  2WXP A;  4I6I A;  1Y8M A;  2WPV A;  1LUJ A;  3QWV A;  4WUY A;  2A5U A;  4D49 A;  2FF4 A;  3OPB A;  3GQ2 A;  2YNQ A;  2VYI A;  3S7B A;  1EE4 A;  4HVB A;  5AJD A;  2Z5J A;  4AV7 A;  3LYA A;  5B56 A;  5BNW A;  4UWF A;  3WPT A;  3UL1 B;  4I9E A;  4JW3 C;  5CMY A;  5A23 A;  1UPL A;  5BZ1 A;  2Y4U A;  4FU3 A;  2C1T A;  2XGS A;  4UWX A;  2YQ8 A;  4GZ6 A;  4Q94 A;  5KCM A;  2NYL B;  4BQK A;  3MJW A;  3U64 A;  1JPP A;  1M8Z A;  4JW1 A;  4I6G A;  2VGX B;  3QOU A;  5T3R A;  5M72 A;  2YHE A;  4MS6 A;  5K6S A;  2H4M A;  2LSU A;  3MEK A;  4CGV A;  4I43 A;  4HOS A;  3U9W A;  2NYM A;  3G2S A;  4J6I A;  3RO3 A;  3T5V A;  4KVO A;  2J4D A;  3HYM B;  4U0Z A;  4WNE A;  3K49 A;  5BT1 A;  4U5O A;  1O6O A;  1ZBP A;  1Z2C B;  4GMO A;  3UKW B;  1Z6T A;  2VSN A;  2E2E A;  2X6K A;  3FU0 A;  3FUN A;  1X5B A;  1Z3X A;  2QY7 A;  3FU3 A;  4A0C A;  3JX7 A;  3SL9 A;  3K5Z A;  1GCJ A;  4FLH A;  5J3V A;  2JDQ A;  1EYH A;  3FH7 A;  3LTM A;  4GU5 A;  3T8M A;  4CEM A;  4O27 A;  3VE6 A;  1HXI A;  1QQE A;  2UY1 B;  2PF4 A;  4PLS A;  5CL8 A;  3OXF A;  3ZYQ A;  3DBS A;  3T7U A;  3EDT B;  4GPK A;  4AY6 A;  2GRM A;  1Q1S C;  3LDZ A;  5DBK A;  2KCK A;  4EZK A;  2XOA A;  4CB9 A;  4FJY A;  4P6Z B;  2RG8 A;  1M8Y A;  3HDX A;  4N39 A;  4I37 A;  1ZU2 A;  4UQY A;  1IHG A;  5FQ7 A;  1BK6 A;  5EKG A;  2Z5N A;  2IU1 A;  5DIZ A;  4N3A A;  3LY9 A;  5KL1 A;  1KT0 A;  4B8O A;  4CT6 B;  4EBA A;  4LER A;  5AEI A;  1IQR A;  2X6F A;  4BPL A;  3C2H A;  3CVQ A;  4FHJ A;  4ILG A;  4L7M A;  1M1E A;  5A6C A;  2HYZ A;  4TRQ A;  2X6H A;  3NMW A;  2WXQ A;  5D0O D;  4AXH A;  2BCT A;  4UAE A;  3ENE A;  4K92 A;  2UY1 A;  4U5V A;  1WA5 C;  5CLD A;  5CLA A;  3SLA A;  2CFU A;  2DIW A;  4UI9 J;  5G05 J;  5J08 A;  4N3B A;  2WXK A;  4KZC A;  2VGL B;  4NAC A;  5BZV A;  2CHZ A;  2R5S A;  3QG9 A;  4UQZ A;  5A7D B;  1H19 A;  2J08 A;  1MHQ A;  3PUK A;  5BV1 A;  3OAW A;  4N2S A;  1OYZ A;  3WOY A;  4H7Y A;  4PH4 B;  2GRL A;  2XRZ A;  4JEU A;  5J90 A;  5BV0 A;  4ME2 A;  2IWH A;  2XGO A;  2XPY A;  3FDH A;  4QMI A;  2M63 A;  4GA2 A;  2IX3 A;  3ZN3 A;  1VDY A;  5JJ7 A;  3CQG B;  4ATG A;  1TH1 A;  4XZR B;  2WXI A;  2AXV A;  2L9B A;  5ENN A;  3K7W A;  1W3B A;  3OUW A;  2WVI A;  3SFZ A;  4CCA A;  4CT4 A;  5FJY A;  1E96 B;  3ZGQ A;  1TEZ A;  4A1S A;  3ZHP A;  3O2S A;  3B7T A;  4WNG A;  4AY5 A;  4DBA A;  2WXR A;  3ML9 A;  3MGB A;  1MQS A;  1QZ2 A;  4TUU A;  2GW1 A;  2CHX A;  5JHB A;  4HOT A;  4GML A;  4L4I A;  3URZ A;  1EDU A;  3A6P A;  3K61 A;  2RD0 A;  3MKQ B;  3SBT B;  4BX9 A;  4J0U A;  4CDM A;  3TGO A;  3HHM A;  3R9A B;  3ESL A;  4JW2 A;  2I1J A;  5CLB A;  4XIF A;  2ILR A;  3LVQ E;  2OF3 A;  1HFA A;  5FZS A;  4EQF A;  3O48 A;  4URK A;  3Q0N A;  1SZA A;  4IUL A;  1N54 A;  3S7J A;  4ABN A;  4GYW A;  3FWV A;  5CHE E;  1H2T C;  1EE5 A;  2RU4 B;  5KLR B;  5EX0 A;  5LOZ A;  2WQ7 A;  3MCX A;  4EVP A;  3GS3 A;  4GZC A;  4GA0 A;  4WWO A;  1IAL A;  3G2V A;  2L0T B;  2KZT B;  2XPZ A;  4FUL A;  4GMJ A;  3EIJ A;  4PS3 A;  3LTJ A;  5EWP A;  3CK7 A;  3FUM A;  3I5P A;  3FTX A;  4HS2 A;  4J8F A;  2IE3 A;  2FBN A;  1SZ9 A;  5SWF A;  2AVP A;  4DJS A;  3PUJ A;  4BSX A;  3Q0R A;  4B8J A;  3ODR A;  3Q0P A;  3FH5 A;  2Z5K A;  3RJV A;  3EJN A;  4HM9 A;  4BFR A;  3GVT A;  1PJN B;  4CV5 B;  1QNF A;  2DB0 A;  2WXO A;  3AS5 A;  5JHA A;  3CHO A;  1JWF A;  4GYY A;  3BCT A;  4L4H A;  4FLB A;  1XQS A;  1OUV A;  3NZU A;  4FP7 A;  4MFU A;  3CLJ A;  3GVO A;  1M5N S;  3VLD A;  3FUL A;  3FU6 A;  3I4G A;  2X38 A;  1LRV A;  2Y4T A;  1KT1 A;  2XHE A;  3KAE A;  3MV3 B;  3ZW3 A;  4F7A A;  3L6Y A;  3BSX A;  2XCB A;  3AU3 A;  2YNR A;  4MLP A;  2IAE A;  4JZY A;  3CSF A;  2FI7 A;  2QMR A;  3ZIR A;  3CHP A;  3TL5 A;  4JEH A;  4AIF A;  3L3F X;  5LCW J;  4I6E A;  5EKQ D;  3VTX A;  3Q5U A;  3FTU A;  3GAE A;  1UN8 A;  3Q15 A;  2ZU6 B;  2WXL A;  3B7S A;  2IAE B;  4BTA A;  4CGW A;  3D9N A;  4ADY A;  3KEZ A;  1H0A A;  2C2L A;  3LY7 A;  2AXZ A;  3DW8 A;  5G2N A;  5CTT A;  4YVQ C;  5BW8 C;  2WQ6 A;  4B18 A;  5FT9 A;  2KCV A;  2WXH A;  4EVA A;  4GAA A;  4MRU A;  1NA3 A;  3ZYL A;  5C1D A;  4PS8 A;  2WB2 A;  3NMZ A;  4U58 A;  2NXP A;  4I1M A;  1H2V C;  2VGX A;  1H2U A;  4MKT A;  4F1S A;  3K5Y A;  1EPU A;  5JJT A;  3Q0O A;  3VWA A;  4K03 A;  4WWP A;  4UI9 K;  2MOW A;  2V4L A;  4GZ5 A;  4XE0 A;  3CVN A;  4P29 A;  4HXI A;  3C5W A;  1WA5 B;  2YIN A;  3L6A A;  4PLR A;  4E4V A;  4BY6 A;  4YK6 A;  3FEX C;  1FVH A;  1UJK A;  3FH8 A;  3LVR E;  4RVB A;  3LXU X;  4ACK A;  3UL0 B;  2KCL A;  4G3A A;  5KJM A;  5HHG E;  4JVS A;  2PQN A;  5HI7 A;  3ZIQ A;  3ZRH A;  4DK5 A;  3LEW A;  3IEG A;  2V8S E;  2DBA A;  3QHE A;  2I6H A;  4PLQ A;  1L5J A;  4YGX A;  3QGC A;  3IBV A;  3IV0 A;  1LF8 A;  4KZ0 A;  5G04 J;  1E7V A;  2DCP A;  1WY6 A;  4LUN U;  4N2Q A;  3FEY C;  4R11 A;  4XKC A;  3V6Y A;  4MZ5 E;  4RSY A;  4U04 A;  2J07 A;  1PAQ A;  3EHM A;  4HOQ A;  2Q7F A;  5FWQ A;  4G24 A;  3B7U X;  4CRV B;  2J4B A;  3TXN A;  4G26 A;  5JJA A;  4O6F A;  2W3C A;  3MKQ A;  4K6J A;  3TPO A;  4TV3 A;  3QWP A;  3UPV A;  3ND2 A;  4YJL A;  2VTB A;  3MYV A;  3DPD A;  3CHM A;  2NYM B;  5KLT B;  4ANU A;  4EEC A;  2Z5O A;  1WM5 A;  2C0M A;  4Y6C A;  3PE4 A;  2OT8 A;  1EF1 C;  2AWI A;  4U0S A;  4LAC A;  2MHK A;  1ELW A;  3FTY A;  3V74 A;  2JKR A;  3RK6 A;  4UWH A;  3SBS A;  3UT7 A;  3LWW A;  4APO A;  3PS6 A;  3TG5 A;  2CG2 A;  2IOL A;  4J8E A;  4IN3 B;  4RG9 A;  2IOS A;  3OXL A;  1YA0 A;  3TPM A;  2C1M A;  4N3C A;  5FZQ A;  3G2W A;  2NSZ A;  1HU3 A;  3K64 A;  3BG1 B;  3PEU B;  4XZ4 A;  4DPR A;  3CVX A;  4U5N A;  4OO6 A;  4RXH B;  3PZD A;  4L2Y A;  5ARF A;  3UQ3 A;  3FFL A;  4A3T A;  1XM9 A;  3MX3 A;  5EDS A;  3SGH A;  4GYO A;  3ZPJ A;  1IQ1 C;  5ANR A;  3AU4 A;  4B8P A;  4WV6 A;  2GGF A;  1JPL A;  3FUJ A;  4KBQ A;  5LCW C;  5ANL A;  2OND A;  5HUY C;  3RRM B;  4FHK A;  4AEZ C;  4DJA A;  3ZKV A;  2I9C A;  2YNS A;  3ODS A;  4V3O A;  3FTW A;  1E90 A;  2PM6 A;  3EA5 B;  3ONK A;  2JLB A;  4JXT A;  2VSO E;  3ZIP A;  4HTV A;  4I0Y A;  3TJZ B;  4FQ3 A;  3GZ1 A;  3L54 A;  3U4T A;  5HQ8 A;  3ZIK A;  3GYZ A;  3VLF A;  4FC8 A;  4NRH B;  3IFQ A;  5CLE A;  1Y6I A;  3CEQ A;  3CVL A;  1H6K A;  2IQC A;  4DZS A;  3UT8 A;  1IB2 A;  1NA0 A;  4ACL A;  2FO7 A;  1QGK A;  2A4Z A;  3CGH A;  1QZ7 A;  4BTB A;  4UWK A;  3VTY A;  3NMX A;  4H3H A;  4ANV A;  3D9M A;  4DVG B;  1N52 A;  2PQR A;  3WOZ A;  4ANX A;  2RU4 A;  1DNP A;  4NZW A;  1UPK A;  4I1A A;  3K62 A;  3Q0L A;  4JHK A;  3CST A;  4FZA A;  2NC9 A;  5KJK A;  5CL7 A;  2WM9 A;  3D9I A;  3FUF A;  5BZU A;  4JC8 A;  4JHJ A;  2OOE A;  4QMH A;  4XI9 A;  5FTP A;  4BT8 A;  1G3J A;  4BA3 A;  1TJF A;  4WWN A;  4UWL A;  3UKZ B;  3AU5 A;  3JCK C;  4EZL A;  3QC1 A;  3GNI A;  4U63 A;  4LEU A;  3OBV A;  3Q0S A;  1W63 B;  4V3I A;  5CCL A;  3FUI A;  1JPW A;  1ELR A;  5H2W A;  2WXG A;  3EHN A;  4OYS A;  2NPP B;  3D9J A;  4HFG A;  4G2V A;  4IMJ A;  4QMJ A;  5LP0 A;  4HOU A;  4V3R A;  3CIA A;  3PH0 C;  4B0Z A;  2JKR B;  2WXM A;  3T5X A;  1F59 A;  2Z5M A;  3JY1 A;  2BF0 X;  3RZX A;  2OVF A;  2MRI A;  3CV0 A;  2QK1 A;  2HM8 A;  3FEY A;  1S0P A;  3KS2 A;  4NQ0 A;  3PRZ A;  2I1K A;  3L22 A;  3APC A;  5CMW A;  2VGY A;  2VSX E;  3QGB A;  3L6X A;  3TT9 A;  1I7W A;  3ZFW A;  3FGA B;  2CG3 A;  2X19 B;  4F3V A;  5CLC A;  1Q1T C;  1W63 A;  3FU5 A;  3L08 A;  4Q96 A;  4I2S A;  1IYG A;  3CK9 A;  3QAR A;  5E76 A;  1KLX A;  2C0L A;  3B13 A;  1U3D A;  4KVM A;  3N71 A;  4I5L A;  1ELK A;  1OWL A;  3APF A;  3GZS A;  4Y6W A;  1OWN A;  3RRU A;  3LJ3 A;  1HO8 A;  4ZDU A;  1U6G C;  2WXF A;  4GMN A;  3U3W A;  4L1B A;  1HF8 A;  2V5F A;  1XGW A;  4EVT A;  1QGR A;  3PNL B;  4Y5J A;  5H2X A;  4UQX A;  3BX2 A;  2UWJ G;  3JXZ A;  4AOF A;  3ZYK A;  3H3D X;  1TJC A;  3PDN A;  5AYW D;  3HVE B;  1GW6 A;  4LRZ A;  4W9R A;  4MZ6 E;  4AP2 A;  3FTZ A;  4PUC A;  2WMO A;  5G04 C;  5FQ6 A;  4A1G A;  2JAK A;  3WYF C;  2JEK A;  3TAX A;  4DLO A;  1I7X A;  4HOR A;  3S7F A;  1UG3 A;  2YHC A;  3QJZ A;  4ILI A;  4AVX A;  4G1T A;  4L7T A;  4DLQ A;  2EQX A;  3BG0 B;  4CBA A;  2I2O A;  2ION A;  1TE4 A;  3ASH A;  4CDR A;  5HUW C;  2WXN A;  3NF1 A;  4IYP A;  2AW6 A;  3PEV B;  3QAQ A;  4JA9 A;  1B89 A;  4R7L A;  2LO6 A;  5KJN A;  3JQ0 A;  2QFC A;  4GZD A;  2X1G F;  3EG5 B;  3BSB A;  2KM4 A;  4B8A A;  2V0P A;  2XRY A;  3L17 A;  2BKU B;  1HS6 A;  3O2T A;  3CHR A;  2XA7 A;  3C2G A;  4PVZ A;  2FV2 A;  4UQI B;  3RRN B;  3B7R L;  2VTB B;  3ZIL A;  4OVU A;  3SD5 A;  1T08 A;  3CQC B;  3FEX A;  3UUX A;  4AM9 A;  1XNF A;  4OVV A;  3JYS A;  3PE3 A;  4I8M A;  3FTV A;  2XA7 B;  3ZVV A;  1UJJ A;  1NP7 A;  3W3U A;  3FTS A;  3FUD A;  3LKU A;  4HXT A;  4Q69 A;  3ZEF A;  4KZG A;  3RIB A;  4FZD A;  1B3U A;  4QFV A;  3LPZ A;  3Q0Q A;  3OXG A;  2L0I A;  3LS8 A;  4N5C A;  4C9B B;  4FA6 A;  3ULQ A;  3ZHE B;  3P1U A;  4U3J C;  3QKY A;  3O2Q A;  3K7V A;  4DB6 A;  1IBR B;  3QML C;  3TG4 A;  3RO2 A;  5ARG A;  3SI5 A;  5AIJ A;  1HX8 A;  4EV8 A;  2PM7 A;  4OIH A;  3V71 A;  1E8X A;  4BT9 A;  4RV1 A;  4I9C A;  4DB8 A;  3DAD A;  3BWT A;  2Y3A A;  3KD7 A;  4A3V A;  3PST A;  3VLE A;  3FUE A;  2JKT B;  5LX8 A;  4C0E A;  4U5L A;  2IW3 A;  4I7I A;  5CL5 A;  2FUL A;  4H3K A;  1OWP A;  3G2U A;  2QNA A;  3ZIM A;  1IQU A;  4CT0 A;  3Q4A B;  3UKX B;  3ZYM A;  4E6H A;  4I96 A;  2PKG A;  4DI3 A;  5D5K C;  4B94 A;  3QNK A;  2R17 C;  5EX3 A;  2OV8 A;  5K9S A;  4JKQ A;  2KZT A;  3ZHE A;  1JUQ A;  4UWG A;  4U0U A;  4MFV A;  5FZR A;  3SHF A;  1PJM B;  4U2X D;  4B8C B;  3U66 A;  4C0M A;  1HE8 A;  1SQM A;  1WAO 1;  1Y2A C;  2WMN A;  4JA7 A;  1O6P A;  3KND A;  4BX8 A;  1NZN A;  3CKC A;  2QK2 A;  2J49 A;  1JDH A;  3G2T A;  2XCC A;  4I2Z A;  4KT6 B;  5D0Q D;  5BUZ A;  2VQ2 A;  3D9K A;  4WAF A;  4D4E A;  2LAI A;  4DB9 A;  3IBE A;  3LCA A;  2IF4 A;  3K9I A;  3NZS A;  4KYO B;  4JW2 B;  4TNM A;  4IMI A;  5CL4 A;  3Q49 B;  2BTD A;  5CL3 A;  3CK8 A;  2P8Q A;  4CT7 B;  4PS7 A;  3OTN A;  3GB8 A;  4U5S A;  2XPI A;  3O4X A;  2LAH A;  3ASF A;  4GB9 A;  3D3M A;  4R0Z A;  3E4B A;  3EIQ C;  4CRU B;  3RKV A;  4F53 A;  3D9O A;  3ESK A;  2GL7 A;  3D9P A;  3IHY A;  3BX3 A;  3TJ3 A;  3ASD A;  1HG2 A;  2X3M A;  2J9Q A;  3S7D A;  4G25 A;  5AEN A;  1E8W A;  3QK0 A;  3WXX A;  3FUK A;  3RU0 A;  4B89 A;  4EPZ A;  3HVE A;  4FDD A;  3QB2 A;  4I2W A;  4G23 A;  4LCT A;  2KAT A;  4L23 A;  4U07 A;  5FQ4 A;  3R7Q A;  3D9L A;  3CVV A;  1M8W A;  4RZP A;  3IKO B;  1A17 A;  4J8S A;  1JWG A;  2PL2 A;  3ZIO A;  5BYM A;  3CKB A;  1PC2 A;  3BEE A;  3CHS A;  3JUI A;  3ONL A;  4WNF A;  3APD A;  4EZJ A;  2VGL A;  2IE4 A;  3CVU A;  4R10 A;  5G55 A;  3SZ7 A;  5FC8 E;  4NUR A;  3SF4 A;  4EBA G;  5KUB A;  3FHE A;  1XQR A;  2Q5D A;  5KLA A;  3ML8 A;  3C98 A;  4IRU A;  3NOW A;  2XEV A;  5LSW A;  1PY1 A;  5T4Y A;  3ZXS A;  2OVB A;  4XX5 A;  4UI9 C;  5JJ6 A;  3FGA A;  1HH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...