1EE4A

Crystal structure of yeast karyopherin (importin) alpha in a complex with a c-myc nls peptide
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
423
structure length
423
Chain Sequence
QELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEDKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIETYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KARYOPHERIN ALPHA
publication title Crystallographic analysis of the specific yet versatile recognition of distinct nuclear localization signals by karyopherin alpha.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 172
structure length 423
sequence length 423
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00514 Arm Armadillo/beta-catenin-like repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 1ee4A00
4D49A 1GCJA 3L3FX 2QK1A 5D5KC 1V18A 1WA5C 3WOYA 4U3JC 1XM9A 4K92A 3VE6A 3LWWA 2X1GF 1B3UA 4CT6B 3WYFC 2NYMB 2PF4A 2Z5KA 3ZIQA 1OYZA 3RZ9A 3NMZA 5B56A 1IBRB 1UPLA 1M8ZA 4UQIB 4RV1A 3Q0PA 4JLQA 1QBKB 4B8JA 3KNDA 5KLAA 4CRUB 4V3RA 3ODSA 4B8PA 4HTVA 1T08A 1BK6A 3PSTA 3GRLA 3FGAA 4PLSA 3ZIPA 4HM9A 3BX3A 4DB8A 4JW2B 1EE5A 5SWFA 2FV2A 2IW3A 4HNMA 4HXTA 3BX2A 4V3OA 3TJ3A 4DB6A 3VWAA 1I7XA 3LTJA 4FDDA 2PKGA 1TH1A 4R10A 3UKWB 3K61A 3NOWA 3UVUA 3Q5UA 5KL1A 4TNMA 3NMXA 1M8YA 3FEXC 2WTKA 3Q0QA 4ADYA 3OBVA 3Q0MA 3TPOA 2BNXA 2NPPA 4EVAA 2IX3A 2RU4B 4BQKA 2VGLB 3TX7A 5FC8E 3Q0LA 3K5YA 1Q1SC 2JAKA 3TJZB 4FFBC 2P8QA 1O6PA 3C5WA 3O2TA 3W3UA 3EG5B 2IWHA 4QMHA 3EA5B 5H2WA 2GL7A 3O2QA 1EJYI 1W63A 3Q0RA 3ZINA 4E4VA 1M5NS 1UKLA 4UAEA 5BZ5A 2F31A 4YK6A 3DADA 4MFVA 4U5OA 2C1TA 1QGRA 1M1EA 5BYMA 4A0CA 3IBVA 1JPWA 3WOZA 3QMLC 4YGXA 4YJEA 3TT9A 3OUXA 4NEEA 3H3DX 4FZFA 2IE3A 1G3JA 4U5LA 4I2WA 5DN7A 3OUWA 4QMIA 1Z2CB 3ZKVA 3AU3A 3IFQA 4KZGA 1HO8A 2NYMA 4R0ZA 3K64A 5BZVA 4DZSA 3Q0SA 1QGKA 3BSXA 1EE4A 1UPKA 5KLTB 1UN0A 2OF3A 4OIHA 3K7VA 4UQIA 3O2SA 5E6QB 3L6YA 4H3HA 3UL1B 1JPPA 3ZHPA 3O4XA 4CBAA 2JKTB 2JKRB 5SVZA 3UKZB 4RXHB 4ZDUA 1WA5B 5EKFA 4B18A 4CT7B 2YJYA 3GB8A 3V71A 3K4EA 3K49A 4U54A 5BZUA 4H3KA 4GMOA 4YI0C 1U6GC 2QNAA 1JDHA 4GMNA 2IAEB 4EVPA 4DBAA 3V74A 2NYLB 3QG9A 1PJNB 3RZXA 3A6PA 4YJLA 3ZIOA 5AEIA 4EV9A 4L7MA 1IB2A 2Q5DA 3UL0B 3K7WA 4R11A 1QZ7A 4V3QA 2YNSA 2BKUB 2XA7B 2H4MA 3PSPA 4K6JA 4EV8A 3C2GA 4IMJA 5SW9A 3GS3A 1M8WA 4O27A 5H2XA 4BPLA 4P6ZB 5J3VA 1F59A 3BCTA 4U5SA 4LACA 4DB9A 5HUYC 3K5ZA 2YNRA 1O6OA 4FZAA 3ODRA 4U58A 4PLRA 2VGLA 2OT8A 3EBBA 4UWXA 2BCTA 1Q1TC 4OO6A 3TPMA 5LSWA 3BTRC 1Y2AC 5JJAA 3BSBA 5KLRB 3Q0OA 4U5NA 3GVTA 3QGBA 1PJMB 3OPBA 3FGAB 4CB9A 2DB0A 2QMRA 5HHGE 2Z6HA 4MFUA 2IE4A 2QK2A 4U5VA 4WV6A 5BZ1A 4D4EA 3ZIRA 5KL8A 4FQ3A 4P6ZG 1W9CA 5CTTA 1M8XA 2X19B 2Z5NA 3NMWA 4I5NA 4I2ZA 4DVGB 3GAEA 3GQ2A 4IMIA 4CB8A 5EKGA 2C1MA 3UKXB 2Z6GA 3K62A 4QMJA 1BK5A 4XZRB 1I7WA 1XQSA 4CRVB 4NZWA 4PVZA 2NPPB 4Y5JA 4EVTA 3FEYC 2JDQA 4PLQA 5HUWC 1IQ1C 2Z5JA 4I5LA 1LRVA 3K5QA 3WPTA 1EJLI 3GNIA 3BWTA 4UAFB 2JKTA 2JKRA 1XQRA 3C2HA 3V6YA 3L6XA 5EWPA 3T7UA 3Q0NA 4BA3A 3DW8A 1IALA 1LUJA 4U5UA 3QHEA 2W3CA 3L3QA 4UADA 3ND2A 4RZPA 1W63B 5K9SA 2IAEA 4MZ6E 2NYLA 2Z5OA 3QGCA 4B8OA 4FZDA 3OQSA 2Z5MA 2BAPA 3GVOA 3LTMA 2RU4A 4CV5B 4MZ5E 4DJSA 4G3AA 2XA7A 5K6SA 3UKYB
chains in the Genus database with same CATH superfamily
4D49A 1GCJA 3L3FX 2QK1A 5D5KC 1V18A 3SLAA 1WA5C 3WOYA 4U3JC 1XM9A 4K92A 4I3NA 4A3VA 3VE6A 3LWWA 2X1GF 1B3UA 4CT6B 3WYFC 5CLCA 2NYMB 2PF4A 2Z5KA 3ZIQA 1OYZA 3JX7A 3RZ9A 3NMZA 5B56A 5CLBA 1IBRB 1UPLA 1M8ZA 4UQIB 4RV1A 5CLEA 3Q0PA 3VLEA 4JLQA 1QBKB 4B8JA 3KNDA 5KLAA 4CRUB 4V3RA 3ODSA 4B8PA 3SL9A 4HTVA 1T08A 1BK6A 3PSTA 3GRLA 3FGAA 4PLSA 4JW3C 3ZIPA 4HM9A 3BX3A 4DB8A 4JW2B 1EE5A 5SWFA 2FV2A 2IW3A 4HNMA 4HXTA 3ZIKA 3BX2A 4V3OA 4FP7A 3TJ3A 4DB6A 4I2SA 3VWAA 1I7XA 3LTJA 4FDDA 2PKGA 1TH1A 4R10A 4I7IA 1TE4A 3UKWB 3K61A 3NOWA 1LSHA 3UVUA 3Q5UA 5KL1A 4TNMA 3NMXA 1M8YA 5CL8A 3FEXC 2WTKA 3Q0QA 4ADYA 3OBVA 3Q0MA 3TPOA 2BNXA 2NPPA 4EVAA 2IX3A 2RU4B 4BQKA 2VGLB 3TX7A 5KUBA 5FC8E 3Q0LA 3K5YA 1Q1SC 2JAKA 3TJZB 4FFBC 5CL3A 2P8QA 1O6PA 3C5WA 3O2TA 3W3UA 3EG5B 3UJ0A 2IWHA 4QMHA 3EA5B 5H2WA 2GL7A 3O2QA 1EJYI 1W63A 3Q0RA 3ZINA 4E4VA 1M5NS 1UKLA 3JXYA 4UAEA 5BZ5A 2F31A 4I0YA 4YK6A 3DADA 4MFVA 4U5OA 2C1TA 1QGRA 1M1EA 5BYMA 4A0CA 3IBVA 1JPWA 3WOZA 3QMLC 4YGXA 4YJEA 3TT9A 2XOAA 3OUXA 4NEEA 3H3DX 4I1EA 4FZFA 2IE3A 3JY1A 3T8SA 1G3JA 4U5LA 4I2WA 5DN7A 3OUWA 4QMIA 1Z2CB 3ZKVA 3AU3A 3IFQA 4KZGA 1HO8A 2NYMA 4R0ZA 3K64A 5BZVA 4DZSA 3Q0SA 1QGKA 3BSXA 1EE4A 1UPKA 5KLTB 1UN0A 2OF3A 4OIHA 3K7VA 4UQIA 3O2SA 5E6QB 3L6YA 4H3HA 3UL1B 1JPPA 3ZHPA 3O4XA 4CBAA 2JKTB 2JKRB 5SVZA 3UKZB 4RXHB 4ZDUA 1WA5B 5EKFA 4B18A 4CT7B 2YJYA 3GB8A 3V71A 3K4EA 4JW2A 4I37A 4U2XD 3K49A 4U54A 5BZUA 4H3KA 4GMOA 4YI0C 1U6GC 2QNAA 1JDHA 4GMNA 2IAEB 4EVPA 4DBAA 3V74A 2NYLB 3QG9A 1PJNB 3RZXA 3A6PA 4YJLA 3ZIOA 4I6IA 5AEIA 4EV9A 4L7MA 1IB2A 2Q5DA 3UL0B 3K7WA 4R11A 1QZ7A 4V3QA 2YNSA 2BKUB 2XA7B 2H4MA 3PSPA 4K6JA 4EV8A 3C2GA 4I8MA 4IMJA 4I96A 5SW9A 3GS3A 1M8WA 4O27A 4L4HA 5H2XA 4P6ZB 4BPLA 1F59A 5J3VA 5CL9A 3BCTA 4U5SA 4LACA 4DB9A 5HUYC 3K5ZA 2YNRA 1O6OA 4FZAA 3ODRA 4U58A 4PLRA 2VGLA 2OT8A 3EBBA 5CL5A 4UWXA 2BCTA 1Q1TC 4OO6A 3TPMA 5LSWA 3BTRC 1Y2AC 5JJAA 3BSBA 5KLRB 3Q0OA 4U5NA 4A3TA 3GVTA 3VLDA 3QGBA 1PJMB 3OPBA 3FGAB 4CB9A 2DB0A 2QMRA 5HHGE 2Z6HA 4MFUA 2IE4A 2QK2A 4U5VA 4WV6A 5BZ1A 4D4EA 3ZIRA 5KL8A 4FQ3A 4P6ZG 1W9CA 5CTTA 1M8XA 2X19B 2Z5NA 3NMWA 4I5NA 4I2ZA 3BVSA 4DVGB 3JXZA 3GAEA 4L4IA 3GQ2A 4IMIA 3VLFA 4CB8A 5CL6A 5EKGA 2C1MA 5CL4A 3UKXB 2Z6GA 3K62A 4QMJA 1BK5A 4XZRB 1I7WA 1XQSA 4CRVB 4NZWA 4PVZA 2NPPB 4Y5JA 4EVTA 1N4KA 3FEYC 2JDQA 4PLQA 5HUWC 1IQ1C 2Z5JA 4I5LA 1LRVA 3K5QA 3WPTA 1EJLI 3GNIA 3BWTA 4UAFB 2JKTA 2JKRA 1XQRA 3C2HA 4JKQA 3V6YA 3L6XA 5EWPA 3T7UA 5CLDA 3Q0NA 4BA3A 3DW8A 1IALA 1LUJA 4U5UA 3QHEA 2W3CA 3L3QA 4UADA 5CL7A 3ND2A 4RZPA 1W63B 5K9SA 2IAEA 4MZ6E 2NYLA 5CLAA 3UJ4A 2Z5OA 3QGCA 4B8OA 4FZDA 3OQSA 2Z5MA 2BAPA 3GVOA 3LTMA 2RU4A 4CV5B 4MZ5E 4DJSA 3ZILA 4G3AA 2XA7A 5K6SA 3UKYB
chains in the Genus database with same CATH topology
4D49A 1GCJA 3L3FX 2QK1A 5D5KC 1V18A 3SLAA 1WA5C 3WOYA 4U3JC 1XM9A 4K92A 4I3NA 4A3VA 3VE6A 3LWWA 2X1GF 1B3UA 4CT6B 3WYFC 5CLCA 2NYMB 2PF4A 2Z5KA 3ZIQA 1OYZA 3JX7A 3RZ9A 3NMZA 5B56A 5CLBA 1IBRB 1UPLA 1M8ZA 4UQIB 4RV1A 5CLEA 3Q0PA 3VLEA 4JLQA 1QBKB 4B8JA 3KNDA 5KLAA 4CRUB 4V3RA 3ODSA 4B8PA 3SL9A 4HTVA 1T08A 1BK6A 3PSTA 3GRLA 3FGAA 4PLSA 4JW3C 3ZIPA 4HM9A 3BX3A 4DB8A 4JW2B 1EE5A 5SWFA 2FV2A 2IW3A 4HNMA 4HXTA 3ZIKA 3BX2A 4V3OA 4FP7A 3TJ3A 4DB6A 4I2SA 3VWAA 1I7XA 3LTJA 4FDDA 2PKGA 1TH1A 4R10A 4I7IA 1TE4A 3UKWB 3K61A 3NOWA 3UVUA 3Q5UA 5KL1A 4TNMA 3NMXA 1M8YA 5CL8A 3FEXC 2WTKA 3Q0QA 4ADYA 3OBVA 3Q0MA 3TPOA 2BNXA 2NPPA 4EVAA 2IX3A 2RU4B 4BQKA 2VGLB 3TX7A 5KUBA 5FC8E 3Q0LA 3K5YA 1Q1SC 2JAKA 3TJZB 4FFBC 5CL3A 2P8QA 1O6PA 3C5WA 3O2TA 3W3UA 3EG5B 2IWHA 4QMHA 3EA5B 5H2WA 2GL7A 3O2QA 1EJYI 1W63A 3Q0RA 3ZINA 4E4VA 1M5NS 1UKLA 3JXYA 4UAEA 5BZ5A 2F31A 4I0YA 4YK6A 3DADA 4MFVA 4U5OA 2C1TA 1QGRA 1M1EA 5BYMA 4A0CA 3IBVA 1JPWA 3WOZA 3QMLC 4YGXA 4YJEA 3TT9A 2XOAA 3OUXA 4NEEA 3H3DX 4I1EA 4FZFA 2IE3A 3JY1A 1G3JA 4U5LA 4I2WA 5DN7A 3OUWA 4QMIA 1Z2CB 3ZKVA 3AU3A 3IFQA 4KZGA 1HO8A 2NYMA 4R0ZA 3K64A 5BZVA 4DZSA 3Q0SA 1QGKA 3BSXA 1EE4A 1UPKA 5KLTB 1UN0A 2OF3A 4OIHA 3K7VA 4UQIA 3O2SA 5E6QB 3L6YA 4H3HA 3UL1B 1JPPA 3ZHPA 3O4XA 4CBAA 2JKTB 2JKRB 5SVZA 3UKZB 4RXHB 4ZDUA 1WA5B 5EKFA 4B18A 4CT7B 2YJYA 3GB8A 3V71A 3K4EA 4JW2A 4I37A 4U2XD 3K49A 4U54A 5BZUA 4H3KA 4GMOA 4YI0C 1U6GC 2QNAA 1JDHA 4GMNA 2IAEB 4EVPA 4DBAA 3V74A 2NYLB 3QG9A 1PJNB 3RZXA 3A6PA 4YJLA 3ZIOA 4I6IA 5AEIA 4EV9A 4L7MA 1IB2A 2Q5DA 3UL0B 3K7WA 4R11A 1QZ7A 4V3QA 2YNSA 2BKUB 2XA7B 2H4MA 3PSPA 4K6JA 4EV8A 3C2GA 4I8MA 4IMJA 4I96A 5SW9A 3GS3A 1M8WA 4O27A 4L4HA 5H2XA 4P6ZB 4BPLA 1F59A 5J3VA 5CL9A 3BCTA 4U5SA 4LACA 4DB9A 5HUYC 3K5ZA 2YNRA 1O6OA 4FZAA 3ODRA 4U58A 4PLRA 2VGLA 2OT8A 3EBBA 5CL5A 4UWXA 2BCTA 1Q1TC 4OO6A 3TPMA 5LSWA 3BTRC 1Y2AC 5JJAA 3BSBA 5KLRB 3Q0OA 4U5NA 4A3TA 3GVTA 3VLDA 3QGBA 1PJMB 3OPBA 3FGAB 4CB9A 2DB0A 2QMRA 5HHGE 2Z6HA 4MFUA 2IE4A 2QK2A 4U5VA 4WV6A 5BZ1A 4D4EA 3ZIRA 5KL8A 4FQ3A 4P6ZG 1W9CA 5CTTA 1M8XA 2X19B 2Z5NA 3NMWA 4I5NA 4I2ZA 3BVSA 4DVGB 3JXZA 3GAEA 4L4IA 3GQ2A 4IMIA 3VLFA 4CB8A 5CL6A 5EKGA 2C1MA 5CL4A 3UKXB 2Z6GA 3K62A 4QMJA 1BK5A 4XZRB 1I7WA 1XQSA 4CRVB 4NZWA 4PVZA 2NPPB 4Y5JA 4EVTA 3FEYC 2JDQA 4PLQA 5HUWC 1IQ1C 2Z5JA 4I5LA 1LRVA 3K5QA 3WPTA 1EJLI 3GNIA 3BWTA 4UAFB 2JKTA 2JKRA 1XQRA 3C2HA 4JKQA 3V6YA 3L6XA 5EWPA 3T7UA 5CLDA 3Q0NA 4BA3A 3DW8A 1IALA 1LUJA 4U5UA 3QHEA 2W3CA 3L3QA 4UADA 5CL7A 3ND2A 4RZPA 1W63B 5K9SA 2IAEA 4MZ6E 2NYLA 5CLAA 2Z5OA 3QGCA 4B8OA 4FZDA 3OQSA 2Z5MA 2BAPA 3GVOA 3LTMA 2RU4A 4CV5B 4MZ5E 4DJSA 3ZILA 4G3AA 2XA7A 5K6SA 3UKYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D49 A;  1GCJ A;  3L3F X;  2QK1 A;  5D5K C;  1V18 A;  1WA5 C;  3WOY A;  4U3J C;  1XM9 A;  4K92 A;  3VE6 A;  3LWW A;  2X1G F;  1B3U A;  4CT6 B;  3WYF C;  2NYM B;  2PF4 A;  2Z5K A;  3ZIQ A;  1OYZ A;  3RZ9 A;  3NMZ A;  5B56 A;  1IBR B;  1UPL A;  1M8Z A;  4UQI B;  4RV1 A;  3Q0P A;  4JLQ A;  1QBK B;  4B8J A;  3KND A;  5KLA A;  4CRU B;  4V3R A;  3ODS A;  4B8P A;  4HTV A;  1T08 A;  1BK6 A;  3PST A;  3GRL A;  3FGA A;  4PLS A;  3ZIP A;  4HM9 A;  3BX3 A;  4DB8 A;  4JW2 B;  1EE5 A;  5SWF A;  2FV2 A;  2IW3 A;  4HNM A;  4HXT A;  3BX2 A;  4V3O A;  3TJ3 A;  4DB6 A;  3VWA A;  1I7X A;  3LTJ A;  4FDD A;  2PKG A;  1TH1 A;  4R10 A;  3UKW B;  3K61 A;  3NOW A;  3UVU A;  3Q5U A;  5KL1 A;  4TNM A;  3NMX A;  1M8Y A;  3FEX C;  2WTK A;  3Q0Q A;  4ADY A;  3OBV A;  3Q0M A;  3TPO A;  2BNX A;  2NPP A;  4EVA A;  2IX3 A;  2RU4 B;  4BQK A;  2VGL B;  3TX7 A;  5FC8 E;  3Q0L A;  3K5Y A;  1Q1S C;  2JAK A;  3TJZ B;  4FFB C;  2P8Q A;  1O6P A;  3C5W A;  3O2T A;  3W3U A;  3EG5 B;  2IWH A;  4QMH A;  3EA5 B;  5H2W A;  2GL7 A;  3O2Q A;  1EJY I;  1W63 A;  3Q0R A;  3ZIN A;  4E4V A;  1M5N S;  1UKL A;  4UAE A;  5BZ5 A;  2F31 A;  4YK6 A;  3DAD A;  4MFV A;  4U5O A;  2C1T A;  1QGR A;  1M1E A;  5BYM A;  4A0C A;  3IBV A;  1JPW A;  3WOZ A;  3QML C;  4YGX A;  4YJE A;  3TT9 A;  3OUX A;  4NEE A;  3H3D X;  4FZF A;  2IE3 A;  1G3J A;  4U5L A;  4I2W A;  5DN7 A;  3OUW A;  4QMI A;  1Z2C B;  3ZKV A;  3AU3 A;  3IFQ A;  4KZG A;  1HO8 A;  2NYM A;  4R0Z A;  3K64 A;  5BZV A;  4DZS A;  3Q0S A;  1QGK A;  3BSX A;  1EE4 A;  1UPK A;  5KLT B;  1UN0 A;  2OF3 A;  4OIH A;  3K7V A;  4UQI A;  3O2S A;  5E6Q B;  3L6Y A;  4H3H A;  3UL1 B;  1JPP A;  3ZHP A;  3O4X A;  4CBA A;  2JKT B;  2JKR B;  5SVZ A;  3UKZ B;  4RXH B;  4ZDU A;  1WA5 B;  5EKF A;  4B18 A;  4CT7 B;  2YJY A;  3GB8 A;  3V71 A;  3K4E A;  3K49 A;  4U54 A;  5BZU A;  4H3K A;  4GMO A;  4YI0 C;  1U6G C;  2QNA A;  1JDH A;  4GMN A;  2IAE B;  4EVP A;  4DBA A;  3V74 A;  2NYL B;  3QG9 A;  1PJN B;  3RZX A;  3A6P A;  4YJL A;  3ZIO A;  5AEI A;  4EV9 A;  4L7M A;  1IB2 A;  2Q5D A;  3UL0 B;  3K7W A;  4R11 A;  1QZ7 A;  4V3Q A;  2YNS A;  2BKU B;  2XA7 B;  2H4M A;  3PSP A;  4K6J A;  4EV8 A;  3C2G A;  4IMJ A;  5SW9 A;  3GS3 A;  1M8W A;  4O27 A;  5H2X A;  4BPL A;  4P6Z B;  5J3V A;  1F59 A;  3BCT A;  4U5S A;  4LAC A;  4DB9 A;  5HUY C;  3K5Z A;  2YNR A;  1O6O A;  4FZA A;  3ODR A;  4U58 A;  4PLR A;  2VGL A;  2OT8 A;  3EBB A;  4UWX A;  2BCT A;  1Q1T C;  4OO6 A;  3TPM A;  5LSW A;  3BTR C;  1Y2A C;  5JJA A;  3BSB A;  5KLR B;  3Q0O A;  4U5N A;  3GVT A;  3QGB A;  1PJM B;  3OPB A;  3FGA B;  4CB9 A;  2DB0 A;  2QMR A;  5HHG E;  2Z6H A;  4MFU A;  2IE4 A;  2QK2 A;  4U5V A;  4WV6 A;  5BZ1 A;  4D4E A;  3ZIR A;  5KL8 A;  4FQ3 A;  4P6Z G;  1W9C A;  5CTT A;  1M8X A;  2X19 B;  2Z5N A;  3NMW A;  4I5N A;  4I2Z A;  4DVG B;  3GAE A;  3GQ2 A;  4IMI A;  4CB8 A;  5EKG A;  2C1M A;  3UKX B;  2Z6G A;  3K62 A;  4QMJ A;  1BK5 A;  4XZR B;  1I7W A;  1XQS A;  4CRV B;  4NZW A;  4PVZ A;  2NPP B;  4Y5J A;  4EVT A;  3FEY C;  2JDQ A;  4PLQ A;  5HUW C;  1IQ1 C;  2Z5J A;  4I5L A;  1LRV A;  3K5Q A;  3WPT A;  1EJL I;  3GNI A;  3BWT A;  4UAF B;  2JKT A;  2JKR A;  1XQR A;  3C2H A;  3V6Y A;  3L6X A;  5EWP A;  3T7U A;  3Q0N A;  4BA3 A;  3DW8 A;  1IAL A;  1LUJ A;  4U5U A;  3QHE A;  2W3C A;  3L3Q A;  4UAD A;  3ND2 A;  4RZP A;  1W63 B;  5K9S A;  2IAE A;  4MZ6 E;  2NYL A;  2Z5O A;  3QGC A;  4B8O A;  4FZD A;  3OQS A;  2Z5M A;  2BAP A;  3GVO A;  3LTM A;  2RU4 A;  4CV5 B;  4MZ5 E;  4DJS A;  4G3A A;  2XA7 A;  5K6S A;  3UKY B; 
#chains in the Genus database with same CATH topology
 4D49 A;  1GCJ A;  3L3F X;  2QK1 A;  5D5K C;  1V18 A;  3SLA A;  1WA5 C;  3WOY A;  4U3J C;  1XM9 A;  4K92 A;  4I3N A;  4A3V A;  3VE6 A;  3LWW A;  2X1G F;  1B3U A;  4CT6 B;  3WYF C;  5CLC A;  2NYM B;  2PF4 A;  2Z5K A;  3ZIQ A;  1OYZ A;  3JX7 A;  3RZ9 A;  3NMZ A;  5B56 A;  5CLB A;  1IBR B;  1UPL A;  1M8Z A;  4UQI B;  4RV1 A;  5CLE A;  3Q0P A;  3VLE A;  4JLQ A;  1QBK B;  4B8J A;  3KND A;  5KLA A;  4CRU B;  4V3R A;  3ODS A;  4B8P A;  3SL9 A;  4HTV A;  1T08 A;  1BK6 A;  3PST A;  3GRL A;  3FGA A;  4PLS A;  4JW3 C;  3ZIP A;  4HM9 A;  3BX3 A;  4DB8 A;  4JW2 B;  1EE5 A;  5SWF A;  2FV2 A;  2IW3 A;  4HNM A;  4HXT A;  3ZIK A;  3BX2 A;  4V3O A;  4FP7 A;  3TJ3 A;  4DB6 A;  4I2S A;  3VWA A;  1I7X A;  3LTJ A;  4FDD A;  2PKG A;  1TH1 A;  4R10 A;  4I7I A;  1TE4 A;  3UKW B;  3K61 A;  3NOW A;  1LSH A;  3UVU A;  3Q5U A;  5KL1 A;  4TNM A;  3NMX A;  1M8Y A;  5CL8 A;  3FEX C;  2WTK A;  3Q0Q A;  4ADY A;  3OBV A;  3Q0M A;  3TPO A;  2BNX A;  2NPP A;  4EVA A;  2IX3 A;  2RU4 B;  4BQK A;  2VGL B;  3TX7 A;  5KUB A;  5FC8 E;  3Q0L A;  3K5Y A;  1Q1S C;  2JAK A;  3TJZ B;  4FFB C;  5CL3 A;  2P8Q A;  1O6P A;  3C5W A;  3O2T A;  3W3U A;  3EG5 B;  3UJ0 A;  2IWH A;  4QMH A;  3EA5 B;  5H2W A;  2GL7 A;  3O2Q A;  1EJY I;  1W63 A;  3Q0R A;  3ZIN A;  4E4V A;  1M5N S;  1UKL A;  3JXY A;  4UAE A;  5BZ5 A;  2F31 A;  4I0Y A;  4YK6 A;  3DAD A;  4MFV A;  4U5O A;  2C1T A;  1QGR A;  1M1E A;  5BYM A;  4A0C A;  3IBV A;  1JPW A;  3WOZ A;  3QML C;  4YGX A;  4YJE A;  3TT9 A;  2XOA A;  3OUX A;  4NEE A;  3H3D X;  4I1E A;  4FZF A;  2IE3 A;  3JY1 A;  3T8S A;  1G3J A;  4U5L A;  4I2W A;  5DN7 A;  3OUW A;  4QMI A;  1Z2C B;  3ZKV A;  3AU3 A;  3IFQ A;  4KZG A;  1HO8 A;  2NYM A;  4R0Z A;  3K64 A;  5BZV A;  4DZS A;  3Q0S A;  1QGK A;  3BSX A;  1EE4 A;  1UPK A;  5KLT B;  1UN0 A;  2OF3 A;  4OIH A;  3K7V A;  4UQI A;  3O2S A;  5E6Q B;  3L6Y A;  4H3H A;  3UL1 B;  1JPP A;  3ZHP A;  3O4X A;  4CBA A;  2JKT B;  2JKR B;  5SVZ A;  3UKZ B;  4RXH B;  4ZDU A;  1WA5 B;  5EKF A;  4B18 A;  4CT7 B;  2YJY A;  3GB8 A;  3V71 A;  3K4E A;  4JW2 A;  4I37 A;  4U2X D;  3K49 A;  4U54 A;  5BZU A;  4H3K A;  4GMO A;  4YI0 C;  1U6G C;  2QNA A;  1JDH A;  4GMN A;  2IAE B;  4EVP A;  4DBA A;  3V74 A;  2NYL B;  3QG9 A;  1PJN B;  3RZX A;  3A6P A;  4YJL A;  3ZIO A;  4I6I A;  5AEI A;  4EV9 A;  4L7M A;  1IB2 A;  2Q5D A;  3UL0 B;  3K7W A;  4R11 A;  1QZ7 A;  4V3Q A;  2YNS A;  2BKU B;  2XA7 B;  2H4M A;  3PSP A;  4K6J A;  4EV8 A;  3C2G A;  4I8M A;  4IMJ A;  4I96 A;  5SW9 A;  3GS3 A;  1M8W A;  4O27 A;  4L4H A;  5H2X A;  4P6Z B;  4BPL A;  1F59 A;  5J3V A;  5CL9 A;  3BCT A;  4U5S A;  4LAC A;  4DB9 A;  5HUY C;  3K5Z A;  2YNR A;  1O6O A;  4FZA A;  3ODR A;  4U58 A;  4PLR A;  2VGL A;  2OT8 A;  3EBB A;  5CL5 A;  4UWX A;  2BCT A;  1Q1T C;  4OO6 A;  3TPM A;  5LSW A;  3BTR C;  1Y2A C;  5JJA A;  3BSB A;  5KLR B;  3Q0O A;  4U5N A;  4A3T A;  3GVT A;  3VLD A;  3QGB A;  1PJM B;  3OPB A;  3FGA B;  4CB9 A;  2DB0 A;  2QMR A;  5HHG E;  2Z6H A;  4MFU A;  2IE4 A;  2QK2 A;  4U5V A;  4WV6 A;  5BZ1 A;  4D4E A;  3ZIR A;  5KL8 A;  4FQ3 A;  4P6Z G;  1W9C A;  5CTT A;  1M8X A;  2X19 B;  2Z5N A;  3NMW A;  4I5N A;  4I2Z A;  3BVS A;  4DVG B;  3JXZ A;  3GAE A;  4L4I A;  3GQ2 A;  4IMI A;  3VLF A;  4CB8 A;  5CL6 A;  5EKG A;  2C1M A;  5CL4 A;  3UKX B;  2Z6G A;  3K62 A;  4QMJ A;  1BK5 A;  4XZR B;  1I7W A;  1XQS A;  4CRV B;  4NZW A;  4PVZ A;  2NPP B;  4Y5J A;  4EVT A;  1N4K A;  3FEY C;  2JDQ A;  4PLQ A;  5HUW C;  1IQ1 C;  2Z5J A;  4I5L A;  1LRV A;  3K5Q A;  3WPT A;  1EJL I;  3GNI A;  3BWT A;  4UAF B;  2JKT A;  2JKR A;  1XQR A;  3C2H A;  4JKQ A;  3V6Y A;  3L6X A;  5EWP A;  3T7U A;  5CLD A;  3Q0N A;  4BA3 A;  3DW8 A;  1IAL A;  1LUJ A;  4U5U A;  3QHE A;  2W3C A;  3L3Q A;  4UAD A;  5CL7 A;  3ND2 A;  4RZP A;  1W63 B;  5K9S A;  2IAE A;  4MZ6 E;  2NYL A;  5CLA A;  3UJ4 A;  2Z5O A;  3QGC A;  4B8O A;  4FZD A;  3OQS A;  2Z5M A;  2BAP A;  3GVO A;  3LTM A;  2RU4 A;  4CV5 B;  4MZ5 E;  4DJS A;  3ZIL A;  4G3A A;  2XA7 A;  5K6S A;  3UKY B; 
#chains in the Genus database with same CATH homology
 4D49 A;  1GCJ A;  3L3F X;  2QK1 A;  5D5K C;  1V18 A;  3SLA A;  1WA5 C;  3WOY A;  4U3J C;  1XM9 A;  4K92 A;  4I3N A;  4A3V A;  3VE6 A;  3LWW A;  2X1G F;  1B3U A;  4CT6 B;  3WYF C;  5CLC A;  2NYM B;  2PF4 A;  2Z5K A;  3ZIQ A;  1OYZ A;  3JX7 A;  3RZ9 A;  3NMZ A;  5B56 A;  5CLB A;  1IBR B;  1UPL A;  1M8Z A;  4UQI B;  4RV1 A;  5CLE A;  3Q0P A;  3VLE A;  4JLQ A;  1QBK B;  4B8J A;  3KND A;  5KLA A;  4CRU B;  4V3R A;  3ODS A;  4B8P A;  3SL9 A;  4HTV A;  1T08 A;  1BK6 A;  3PST A;  3GRL A;  3FGA A;  4PLS A;  4JW3 C;  3ZIP A;  4HM9 A;  3BX3 A;  4DB8 A;  4JW2 B;  1EE5 A;  5SWF A;  2FV2 A;  2IW3 A;  4HNM A;  4HXT A;  3ZIK A;  3BX2 A;  4V3O A;  4FP7 A;  3TJ3 A;  4DB6 A;  4I2S A;  3VWA A;  1I7X A;  3LTJ A;  4FDD A;  2PKG A;  1TH1 A;  4R10 A;  4I7I A;  1TE4 A;  3UKW B;  3K61 A;  3NOW A;  3UVU A;  3Q5U A;  5KL1 A;  4TNM A;  3NMX A;  1M8Y A;  5CL8 A;  3FEX C;  2WTK A;  3Q0Q A;  4ADY A;  3OBV A;  3Q0M A;  3TPO A;  2BNX A;  2NPP A;  4EVA A;  2IX3 A;  2RU4 B;  4BQK A;  2VGL B;  3TX7 A;  5KUB A;  5FC8 E;  3Q0L A;  3K5Y A;  1Q1S C;  2JAK A;  3TJZ B;  4FFB C;  5CL3 A;  2P8Q A;  1O6P A;  3C5W A;  3O2T A;  3W3U A;  3EG5 B;  2IWH A;  4QMH A;  3EA5 B;  5H2W A;  2GL7 A;  3O2Q A;  1EJY I;  1W63 A;  3Q0R A;  3ZIN A;  4E4V A;  1M5N S;  1UKL A;  3JXY A;  4UAE A;  5BZ5 A;  2F31 A;  4I0Y A;  4YK6 A;  3DAD A;  4MFV A;  4U5O A;  2C1T A;  1QGR A;  1M1E A;  5BYM A;  4A0C A;  3IBV A;  1JPW A;  3WOZ A;  3QML C;  4YGX A;  4YJE A;  3TT9 A;  2XOA A;  3OUX A;  4NEE A;  3H3D X;  4I1E A;  4FZF A;  2IE3 A;  3JY1 A;  1G3J A;  4U5L A;  4I2W A;  5DN7 A;  3OUW A;  4QMI A;  1Z2C B;  3ZKV A;  3AU3 A;  3IFQ A;  4KZG A;  1HO8 A;  2NYM A;  4R0Z A;  3K64 A;  5BZV A;  4DZS A;  3Q0S A;  1QGK A;  3BSX A;  1EE4 A;  1UPK A;  5KLT B;  1UN0 A;  2OF3 A;  4OIH A;  3K7V A;  4UQI A;  3O2S A;  5E6Q B;  3L6Y A;  4H3H A;  3UL1 B;  1JPP A;  3ZHP A;  3O4X A;  4CBA A;  2JKT B;  2JKR B;  5SVZ A;  3UKZ B;  4RXH B;  4ZDU A;  1WA5 B;  5EKF A;  4B18 A;  4CT7 B;  2YJY A;  3GB8 A;  3V71 A;  3K4E A;  4JW2 A;  4I37 A;  4U2X D;  3K49 A;  4U54 A;  5BZU A;  4H3K A;  4GMO A;  4YI0 C;  1U6G C;  2QNA A;  1JDH A;  4GMN A;  2IAE B;  4EVP A;  4DBA A;  3V74 A;  2NYL B;  3QG9 A;  1PJN B;  3RZX A;  3A6P A;  4YJL A;  3ZIO A;  4I6I A;  5AEI A;  4EV9 A;  4L7M A;  1IB2 A;  2Q5D A;  3UL0 B;  3K7W A;  4R11 A;  1QZ7 A;  4V3Q A;  2YNS A;  2BKU B;  2XA7 B;  2H4M A;  3PSP A;  4K6J A;  4EV8 A;  3C2G A;  4I8M A;  4IMJ A;  4I96 A;  5SW9 A;  3GS3 A;  1M8W A;  4O27 A;  4L4H A;  5H2X A;  4P6Z B;  4BPL A;  1F59 A;  5J3V A;  5CL9 A;  3BCT A;  4U5S A;  4LAC A;  4DB9 A;  5HUY C;  3K5Z A;  2YNR A;  1O6O A;  4FZA A;  3ODR A;  4U58 A;  4PLR A;  2VGL A;  2OT8 A;  3EBB A;  5CL5 A;  4UWX A;  2BCT A;  1Q1T C;  4OO6 A;  3TPM A;  5LSW A;  3BTR C;  1Y2A C;  5JJA A;  3BSB A;  5KLR B;  3Q0O A;  4U5N A;  4A3T A;  3GVT A;  3VLD A;  3QGB A;  1PJM B;  3OPB A;  3FGA B;  4CB9 A;  2DB0 A;  2QMR A;  5HHG E;  2Z6H A;  4MFU A;  2IE4 A;  2QK2 A;  4U5V A;  4WV6 A;  5BZ1 A;  4D4E A;  3ZIR A;  5KL8 A;  4FQ3 A;  4P6Z G;  1W9C A;  5CTT A;  1M8X A;  2X19 B;  2Z5N A;  3NMW A;  4I5N A;  4I2Z A;  3BVS A;  4DVG B;  3JXZ A;  3GAE A;  4L4I A;  3GQ2 A;  4IMI A;  3VLF A;  4CB8 A;  5CL6 A;  5EKG A;  2C1M A;  5CL4 A;  3UKX B;  2Z6G A;  3K62 A;  4QMJ A;  1BK5 A;  4XZR B;  1I7W A;  1XQS A;  4CRV B;  4NZW A;  4PVZ A;  2NPP B;  4Y5J A;  4EVT A;  3FEY C;  2JDQ A;  4PLQ A;  5HUW C;  1IQ1 C;  2Z5J A;  4I5L A;  1LRV A;  3K5Q A;  3WPT A;  1EJL I;  3GNI A;  3BWT A;  4UAF B;  2JKT A;  2JKR A;  1XQR A;  3C2H A;  4JKQ A;  3V6Y A;  3L6X A;  5EWP A;  3T7U A;  5CLD A;  3Q0N A;  4BA3 A;  3DW8 A;  1IAL A;  1LUJ A;  4U5U A;  3QHE A;  2W3C A;  3L3Q A;  4UAD A;  5CL7 A;  3ND2 A;  4RZP A;  1W63 B;  5K9S A;  2IAE A;  4MZ6 E;  2NYL A;  5CLA A;  2Z5O A;  3QGC A;  4B8O A;  4FZD A;  3OQS A;  2Z5M A;  2BAP A;  3GVO A;  3LTM A;  2RU4 A;  4CV5 B;  4MZ5 E;  4DJS A;  3ZIL A;  4G3A A;  2XA7 A;  5K6S A;  3UKY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...