3ZILA

Structure of the wpl1 protein
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
362
structure length
362
Chain Sequence
TLKYSEDLDFILSDNSMTTPEHRRNNMLRLCLDMMNNEDLCQYIVKYRHREVWEWCFQGTDPKQKVTSLLQCFIADKIPLLRHDKRWAMLSLENFILPLATDEVFPKKIAGSRLVKLNYQDLLRKLKFTNTCEYALYIWATYLLYTEAVYGAVPALARLISRGQLKDWDTACSLLENNIVAAPSGSDIEEYAQAFQTLAGLSREKLTNEGVLKCLIKLTNHTTVLELSADLLPSLVRSLAMSVQLHQNNIVSSISEIKTNLLILQLGLLLNIVSEATTAASTEELTNFGAVFRSVFVKKPTEMSFVLQLFLLVYAYSAGAAGVQLPPAEADFLKSELEAFATDVSSYNHNIHTRITRVLETL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AAR187CP
publication title Structural Insights Into Regulation of Cohesion Establishment by Wpl1
pubmed doi rcsb
source organism Eremothecium gossypii
molecule tags Cell cycle
total genus 140
structure length 362
sequence length 362
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16997 Wap1 Wap1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.60 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 3zilA00
3ZIKA 3ZILA
chains in the Genus database with same CATH superfamily
2NYMA 2IE3A 3OQSA 4FZFA 3VLDA 1QGRA 3FGAA 4XZRB 5H2WA 4QMJA 1W9CA 4DB9A 2Z5KA 4V3OA 4U5LA 4YJEA 1JPPA 1EJYI 1B3UA 4U5UA 4U5NA 4PVZA 3TJ3A 4U2XD 5CLAA 1Z2CB 4UQIA 2FV2A 4EVAA 5CL9A 1QZ7A 4I8MA 1XQSA 3LTJA 3ODSA 4I2SA 4JW2A 4DZSA 3ND2A 4B18A 2JKTA 4R11A 4RV1A 3GVTA 4U58A 4MFVA 5CL5A 1QGKA 2PF4A 4OO6A 1TE4A 1XM9A 5JJAA 1IALA 3BSBA 4YI0C 1N4KA 3AU3A 3L6YA 4BQKA 3QGCA 3LWWA 4I6IA 3UKZB 4UWXA 3OUWA 4HTVA 3V71A 3Q0SA 1EJLI 4RXHB 3K5YA 3UJ0A 4B8OA 2QNAA 1WA5B 3FEYC 3C2GA 3ZIPA 2QK1A 5H2XA 5SW9A 2XA7A 3ZILA 3KNDA 3QG9A 1PJMB 2Z5NA 1Q1TC 2F31A 3TPMA 3BX2A 4FP7A 3QGBA 3IBVA 4I7IA 3BCTA 5FC8E 3K61A 4H3HA 3WYFC 4G3AA 5KLTB 3TPOA 4EV9A 3NMZA 5CTTA 2DB0A 2W3CA 3UL0B 1W63A 2QK2A 3K62A 3VWAA 2JKRA 4I2ZA 2YNSA 5BZ5A 2Z5MA 2NYMB 1LRVA 1BK5A 2JDQA 4I5NA 4CRUB 1I7WA 3QHEA 4PLSA 3BVSA 2XOAA 3ZHPA 5AEIA 5KL1A 2X1GF 1V18A 3L6XA 1O6OA 3NOWA 4V3QA 2Z6GA 4L4IA 5CLDA 5BYMA 4HNMA 4HXTA 5BZVA 2GL7A 5EKGA 5CLCA 3BSXA 1M1EA 4I37A 2IWHA 2X19B 4GMNA 1QBKB 3ZIRA 4CB8A 1U6GC 4U5VA 4UQIB 3WPTA 3K4EA 3K7VA 3VLFA 3WOZA 3O2QA 5HUYC 4L7MA 4IMIA 3GS3A 1GCJA 4P6ZB 3UKWB 5HUWC 5BZ1A 4JW2B 2BAPA 2BKUB 3ODRA 4H3KA 4TNMA 4ADYA 5HHGE 3OPBA 4CT7B 2NYLA 4I0YA 1Y2AC 4E4VA 3JXYA 1M8ZA 3EA5B 3GQ2A 5BZUA 3T8SA 5EWPA 4I3NA 4DBAA 1EE4A 3UVUA 3LTMA 3O2SA 3IFQA 2P8QA 3Q0MA 1XQRA 4YGXA 2BNXA 4B8PA 4U3JC 3EBBA 5KL8A 1M8XA 2VGLA 1I7XA 4FFBC 2NPPA 1BK6A 2XA7B 3ZINA 5KLRB 1UN0A 4L4HA 4YK6A 4CB9A 2IX3A 5CL6A 3V6YA 4V3RA 4U5SA 2IW3A 2RU4A 2C1TA 2PKGA 3FEXC 4DB8A 1UPKA 2WTKA 1M5NS 4O27A 3JX7A 3JXZA 3O4XA 4Y5JA 3T7UA 1LSHA 4CV5B 3O2TA 4I2WA 4P6ZG 4A3TA 1W63B 3L3FX 5D5KC 2JAKA 2Z5OA 3ZIQA 2JKRB 3K5ZA 2Q5DA 3TX7A 4WV6A 5LSWA 4MZ5E 4EVTA 3GVOA 2OT8A 1LUJA 4HM9A 3DW8A 4K6JA 3FGAB 3WOYA 4JKQA 3L3QA 1EE5A 4JW3C 4R0ZA 4LACA 1UPLA 3TJZB 4CT6B 1IB2A 4JLQA 3V74A 3BWTA 2IAEA 4B8JA 3VE6A 4UAEA 3RZ9A 4EVPA 1HO8A 3K49A 4D49A 3Q0LA 5J3VA 4A0CA 4KZGA 1OYZA 4R10A 4CRVB 1UKLA 5SWFA 4I5LA 2JKTB 1WA5C 5K9SA 4PLQA 3Q5UA 1PJNB 5E6QB 2NYLB 4DB6A 1Q1SC 3GAEA 4FZAA 4BPLA 4IMJA 3GB8A 5KUBA 5SVZA 3ZIOA 3ZIKA 1JPWA 3BTRC 4NEEA 3PSTA 4UADA 4MFUA 1O6PA 4MZ6E 4A3VA 4FDDA 4NZWA 4QMHA 3UKXB 4ZDUA 3JY1A 1IBRB 5CLEA 4K92A 3OBVA 3W3UA 5CLBA 5DN7A 2VGLB 5K6SA 3SLAA 3UKYB 2NPPB 4RZPA 4PLRA 3GNIA 4OIHA 4DVGB 3K5QA 3K64A 3Q0RA 5EKFA 3BX3A 1IQ1C 4BA3A 2BCTA 2YNRA 3PSPA 2Z5JA 3C2HA 3RZXA 1TH1A 2RU4B 2H4MA 3Q0NA 3OUXA 4U5OA 5KLAA 3GRLA 4I1EA 1G3JA 1F59A 3Q0QA 3SL9A 3ZKVA 3H3DX 4EV8A 3A6PA 4UAFB 3Q0PA 5B56A 3K7WA 5CL8A 1JDHA 3UL1B 1T08A 4FZDA 3QMLC 5CL3A 3UJ4A 2QMRA 2C1MA 4GMOA 3EG5B 3DADA 5CL4A 3Q0OA 3VLEA 4CBAA 2YJYA 4FQ3A 3NMWA 3NMXA 4D4EA 1M8WA 3C5WA 4I96A 4U54A 5CL7A 2IE4A 2Z6HA 1M8YA 2IAEB 4QMIA 4DJSA 2OF3A 3TT9A 4YJLA
chains in the Genus database with same CATH topology
2NYMA 2IE3A 3OQSA 4FZFA 3VLDA 1QGRA 3FGAA 4XZRB 5H2WA 4QMJA 1W9CA 4DB9A 2Z5KA 4V3OA 4U5LA 4YJEA 1JPPA 1EJYI 1B3UA 4U5UA 4U5NA 4PVZA 3TJ3A 4U2XD 5CLAA 1Z2CB 4UQIA 2FV2A 4EVAA 5CL9A 1QZ7A 4I8MA 1XQSA 3LTJA 3ODSA 4I2SA 4JW2A 4DZSA 3ND2A 4B18A 2JKTA 4R11A 4RV1A 3GVTA 4U58A 4MFVA 5CL5A 1QGKA 2PF4A 4OO6A 1TE4A 1XM9A 5JJAA 1IALA 3BSBA 4YI0C 3AU3A 3L6YA 4BQKA 3QGCA 3LWWA 4I6IA 3UKZB 4UWXA 3OUWA 4HTVA 3V71A 3Q0SA 1EJLI 4RXHB 3K5YA 4B8OA 2QNAA 1WA5B 3FEYC 3C2GA 3ZIPA 2QK1A 5H2XA 5SW9A 2XA7A 3ZILA 3KNDA 3QG9A 1PJMB 2Z5NA 1Q1TC 2F31A 3TPMA 3BX2A 4FP7A 3QGBA 3IBVA 4I7IA 3BCTA 5FC8E 3K61A 4H3HA 3WYFC 4G3AA 5KLTB 3TPOA 4EV9A 3NMZA 5CTTA 2DB0A 2W3CA 3UL0B 1W63A 2QK2A 3K62A 3VWAA 2JKRA 4I2ZA 2YNSA 5BZ5A 2Z5MA 2NYMB 1LRVA 1BK5A 2JDQA 4I5NA 4CRUB 1I7WA 3QHEA 4PLSA 3BVSA 2XOAA 3ZHPA 5AEIA 5KL1A 2X1GF 1V18A 3L6XA 1O6OA 3NOWA 4V3QA 2Z6GA 4L4IA 5CLDA 5BYMA 4HNMA 4HXTA 5BZVA 2GL7A 5EKGA 5CLCA 3BSXA 1M1EA 4I37A 2IWHA 2X19B 4GMNA 1QBKB 3ZIRA 4CB8A 1U6GC 4U5VA 4UQIB 3WPTA 3K4EA 3K7VA 3VLFA 3WOZA 3O2QA 5HUYC 4L7MA 4IMIA 3GS3A 1GCJA 4P6ZB 3UKWB 5HUWC 5BZ1A 4JW2B 2BAPA 2BKUB 3ODRA 4H3KA 4TNMA 4ADYA 5HHGE 3OPBA 4CT7B 2NYLA 4I0YA 1Y2AC 4E4VA 3JXYA 1M8ZA 3EA5B 3GQ2A 5BZUA 5EWPA 4I3NA 4DBAA 1EE4A 3UVUA 3LTMA 3O2SA 3IFQA 2P8QA 3Q0MA 1XQRA 4YGXA 2BNXA 4B8PA 4U3JC 3EBBA 5KL8A 1M8XA 2VGLA 1I7XA 4FFBC 2NPPA 1BK6A 2XA7B 3ZINA 5KLRB 1UN0A 4L4HA 4YK6A 4CB9A 2IX3A 5CL6A 3V6YA 4V3RA 4U5SA 2IW3A 2RU4A 2C1TA 2PKGA 3FEXC 4DB8A 1UPKA 2WTKA 1M5NS 4O27A 3JX7A 3JXZA 3O4XA 4Y5JA 3T7UA 4CV5B 3O2TA 4I2WA 4P6ZG 4A3TA 1W63B 3L3FX 5D5KC 2JAKA 2Z5OA 3ZIQA 2JKRB 3K5ZA 2Q5DA 3TX7A 4WV6A 5LSWA 4MZ5E 4EVTA 3GVOA 2OT8A 1LUJA 4HM9A 3DW8A 4K6JA 3FGAB 3WOYA 4JKQA 3L3QA 1EE5A 4JW3C 4R0ZA 4LACA 1UPLA 3TJZB 4CT6B 1IB2A 4JLQA 3V74A 3BWTA 2IAEA 4B8JA 3VE6A 4UAEA 3RZ9A 4EVPA 1HO8A 3K49A 4D49A 3Q0LA 5J3VA 4A0CA 4KZGA 1OYZA 4R10A 4CRVB 1UKLA 5SWFA 4I5LA 2JKTB 1WA5C 5K9SA 4PLQA 3Q5UA 1PJNB 5E6QB 2NYLB 4DB6A 1Q1SC 3GAEA 4FZAA 4BPLA 4IMJA 3GB8A 5KUBA 5SVZA 3ZIOA 3ZIKA 1JPWA 3BTRC 4NEEA 3PSTA 4UADA 4MFUA 1O6PA 4MZ6E 4A3VA 4FDDA 4NZWA 4QMHA 3UKXB 4ZDUA 3JY1A 1IBRB 5CLEA 4K92A 3OBVA 3W3UA 5CLBA 5DN7A 2VGLB 5K6SA 3SLAA 3UKYB 2NPPB 4RZPA 4PLRA 3GNIA 4OIHA 4DVGB 3K5QA 3K64A 3Q0RA 5EKFA 3BX3A 1IQ1C 4BA3A 2BCTA 2YNRA 3PSPA 2Z5JA 3C2HA 3RZXA 1TH1A 2RU4B 2H4MA 3Q0NA 3OUXA 4U5OA 5KLAA 3GRLA 4I1EA 1G3JA 1F59A 3Q0QA 3SL9A 3ZKVA 3H3DX 4EV8A 3A6PA 4UAFB 3Q0PA 5B56A 3K7WA 5CL8A 1JDHA 3UL1B 1T08A 4FZDA 3QMLC 5CL3A 2QMRA 2C1MA 4GMOA 3EG5B 3DADA 5CL4A 3Q0OA 3VLEA 4CBAA 2YJYA 4FQ3A 3NMWA 3NMXA 4D4EA 1M8WA 3C5WA 4I96A 4U54A 5CL7A 2IE4A 2Z6HA 1M8YA 2IAEB 4QMIA 4DJSA 2OF3A 3TT9A 4YJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZIK A;  3ZIL A; 
#chains in the Genus database with same CATH topology
 2NYM A;  2IE3 A;  3OQS A;  4FZF A;  3VLD A;  1QGR A;  3FGA A;  4XZR B;  5H2W A;  4QMJ A;  1W9C A;  4DB9 A;  2Z5K A;  4V3O A;  4U5L A;  4YJE A;  1JPP A;  1EJY I;  1B3U A;  4U5U A;  4U5N A;  4PVZ A;  3TJ3 A;  4U2X D;  5CLA A;  1Z2C B;  4UQI A;  2FV2 A;  4EVA A;  5CL9 A;  1QZ7 A;  4I8M A;  1XQS A;  3LTJ A;  3ODS A;  4I2S A;  4JW2 A;  4DZS A;  3ND2 A;  4B18 A;  2JKT A;  4R11 A;  4RV1 A;  3GVT A;  4U58 A;  4MFV A;  5CL5 A;  1QGK A;  2PF4 A;  4OO6 A;  1TE4 A;  1XM9 A;  5JJA A;  1IAL A;  3BSB A;  4YI0 C;  1N4K A;  3AU3 A;  3L6Y A;  4BQK A;  3QGC A;  3LWW A;  4I6I A;  3UKZ B;  4UWX A;  3OUW A;  4HTV A;  3V71 A;  3Q0S A;  1EJL I;  4RXH B;  3K5Y A;  3UJ0 A;  4B8O A;  2QNA A;  1WA5 B;  3FEY C;  3C2G A;  3ZIP A;  2QK1 A;  5H2X A;  5SW9 A;  2XA7 A;  3ZIL A;  3KND A;  3QG9 A;  1PJM B;  2Z5N A;  1Q1T C;  2F31 A;  3TPM A;  3BX2 A;  4FP7 A;  3QGB A;  3IBV A;  4I7I A;  3BCT A;  5FC8 E;  3K61 A;  4H3H A;  3WYF C;  4G3A A;  5KLT B;  3TPO A;  4EV9 A;  3NMZ A;  5CTT A;  2DB0 A;  2W3C A;  3UL0 B;  1W63 A;  2QK2 A;  3K62 A;  3VWA A;  2JKR A;  4I2Z A;  2YNS A;  5BZ5 A;  2Z5M A;  2NYM B;  1LRV A;  1BK5 A;  2JDQ A;  4I5N A;  4CRU B;  1I7W A;  3QHE A;  4PLS A;  3BVS A;  2XOA A;  3ZHP A;  5AEI A;  5KL1 A;  2X1G F;  1V18 A;  3L6X A;  1O6O A;  3NOW A;  4V3Q A;  2Z6G A;  4L4I A;  5CLD A;  5BYM A;  4HNM A;  4HXT A;  5BZV A;  2GL7 A;  5EKG A;  5CLC A;  3BSX A;  1M1E A;  4I37 A;  2IWH A;  2X19 B;  4GMN A;  1QBK B;  3ZIR A;  4CB8 A;  1U6G C;  4U5V A;  4UQI B;  3WPT A;  3K4E A;  3K7V A;  3VLF A;  3WOZ A;  3O2Q A;  5HUY C;  4L7M A;  4IMI A;  3GS3 A;  1GCJ A;  4P6Z B;  3UKW B;  5HUW C;  5BZ1 A;  4JW2 B;  2BAP A;  2BKU B;  3ODR A;  4H3K A;  4TNM A;  4ADY A;  5HHG E;  3OPB A;  4CT7 B;  2NYL A;  4I0Y A;  1Y2A C;  4E4V A;  3JXY A;  1M8Z A;  3EA5 B;  3GQ2 A;  5BZU A;  3T8S A;  5EWP A;  4I3N A;  4DBA A;  1EE4 A;  3UVU A;  3LTM A;  3O2S A;  3IFQ A;  2P8Q A;  3Q0M A;  1XQR A;  4YGX A;  2BNX A;  4B8P A;  4U3J C;  3EBB A;  5KL8 A;  1M8X A;  2VGL A;  1I7X A;  4FFB C;  2NPP A;  1BK6 A;  2XA7 B;  3ZIN A;  5KLR B;  1UN0 A;  4L4H A;  4YK6 A;  4CB9 A;  2IX3 A;  5CL6 A;  3V6Y A;  4V3R A;  4U5S A;  2IW3 A;  2RU4 A;  2C1T A;  2PKG A;  3FEX C;  4DB8 A;  1UPK A;  2WTK A;  1M5N S;  4O27 A;  3JX7 A;  3JXZ A;  3O4X A;  4Y5J A;  3T7U A;  1LSH A;  4CV5 B;  3O2T A;  4I2W A;  4P6Z G;  4A3T A;  1W63 B;  3L3F X;  5D5K C;  2JAK A;  2Z5O A;  3ZIQ A;  2JKR B;  3K5Z A;  2Q5D A;  3TX7 A;  4WV6 A;  5LSW A;  4MZ5 E;  4EVT A;  3GVO A;  2OT8 A;  1LUJ A;  4HM9 A;  3DW8 A;  4K6J A;  3FGA B;  3WOY A;  4JKQ A;  3L3Q A;  1EE5 A;  4JW3 C;  4R0Z A;  4LAC A;  1UPL A;  3TJZ B;  4CT6 B;  1IB2 A;  4JLQ A;  3V74 A;  3BWT A;  2IAE A;  4B8J A;  3VE6 A;  4UAE A;  3RZ9 A;  4EVP A;  1HO8 A;  3K49 A;  4D49 A;  3Q0L A;  5J3V A;  4A0C A;  4KZG A;  1OYZ A;  4R10 A;  4CRV B;  1UKL A;  5SWF A;  4I5L A;  2JKT B;  1WA5 C;  5K9S A;  4PLQ A;  3Q5U A;  1PJN B;  5E6Q B;  2NYL B;  4DB6 A;  1Q1S C;  3GAE A;  4FZA A;  4BPL A;  4IMJ A;  3GB8 A;  5KUB A;  5SVZ A;  3ZIO A;  3ZIK A;  1JPW A;  3BTR C;  4NEE A;  3PST A;  4UAD A;  4MFU A;  1O6P A;  4MZ6 E;  4A3V A;  4FDD A;  4NZW A;  4QMH A;  3UKX B;  4ZDU A;  3JY1 A;  1IBR B;  5CLE A;  4K92 A;  3OBV A;  3W3U A;  5CLB A;  5DN7 A;  2VGL B;  5K6S A;  3SLA A;  3UKY B;  2NPP B;  4RZP A;  4PLR A;  3GNI A;  4OIH A;  4DVG B;  3K5Q A;  3K64 A;  3Q0R A;  5EKF A;  3BX3 A;  1IQ1 C;  4BA3 A;  2BCT A;  2YNR A;  3PSP A;  2Z5J A;  3C2H A;  3RZX A;  1TH1 A;  2RU4 B;  2H4M A;  3Q0N A;  3OUX A;  4U5O A;  5KLA A;  3GRL A;  4I1E A;  1G3J A;  1F59 A;  3Q0Q A;  3SL9 A;  3ZKV A;  3H3D X;  4EV8 A;  3A6P A;  4UAF B;  3Q0P A;  5B56 A;  3K7W A;  5CL8 A;  1JDH A;  3UL1 B;  1T08 A;  4FZD A;  3QML C;  5CL3 A;  3UJ4 A;  2QMR A;  2C1M A;  4GMO A;  3EG5 B;  3DAD A;  5CL4 A;  3Q0O A;  3VLE A;  4CBA A;  2YJY A;  4FQ3 A;  3NMW A;  3NMX A;  4D4E A;  1M8W A;  3C5W A;  4I96 A;  4U54 A;  5CL7 A;  2IE4 A;  2Z6H A;  1M8Y A;  2IAE B;  4QMI A;  4DJS A;  2OF3 A;  3TT9 A;  4YJL A; 
#chains in the Genus database with same CATH homology
 2NYM A;  2IE3 A;  3OQS A;  4FZF A;  3VLD A;  1QGR A;  3FGA A;  4XZR B;  5H2W A;  4QMJ A;  1W9C A;  4DB9 A;  2Z5K A;  4V3O A;  4U5L A;  4YJE A;  1JPP A;  1EJY I;  1B3U A;  4U5U A;  4U5N A;  4PVZ A;  3TJ3 A;  4U2X D;  5CLA A;  1Z2C B;  4UQI A;  2FV2 A;  4EVA A;  5CL9 A;  1QZ7 A;  4I8M A;  1XQS A;  3LTJ A;  3ODS A;  4I2S A;  4JW2 A;  4DZS A;  3ND2 A;  4B18 A;  2JKT A;  4R11 A;  4RV1 A;  3GVT A;  4U58 A;  4MFV A;  5CL5 A;  1QGK A;  2PF4 A;  4OO6 A;  1TE4 A;  1XM9 A;  5JJA A;  1IAL A;  3BSB A;  4YI0 C;  3AU3 A;  3L6Y A;  4BQK A;  3QGC A;  3LWW A;  4I6I A;  3UKZ B;  4UWX A;  3OUW A;  4HTV A;  3V71 A;  3Q0S A;  1EJL I;  4RXH B;  3K5Y A;  4B8O A;  2QNA A;  1WA5 B;  3FEY C;  3C2G A;  3ZIP A;  2QK1 A;  5H2X A;  5SW9 A;  2XA7 A;  3ZIL A;  3KND A;  3QG9 A;  1PJM B;  2Z5N A;  1Q1T C;  2F31 A;  3TPM A;  3BX2 A;  4FP7 A;  3QGB A;  3IBV A;  4I7I A;  3BCT A;  5FC8 E;  3K61 A;  4H3H A;  3WYF C;  4G3A A;  5KLT B;  3TPO A;  4EV9 A;  3NMZ A;  5CTT A;  2DB0 A;  2W3C A;  3UL0 B;  1W63 A;  2QK2 A;  3K62 A;  3VWA A;  2JKR A;  4I2Z A;  2YNS A;  5BZ5 A;  2Z5M A;  2NYM B;  1LRV A;  1BK5 A;  2JDQ A;  4I5N A;  4CRU B;  1I7W A;  3QHE A;  4PLS A;  3BVS A;  2XOA A;  3ZHP A;  5AEI A;  5KL1 A;  2X1G F;  1V18 A;  3L6X A;  1O6O A;  3NOW A;  4V3Q A;  2Z6G A;  4L4I A;  5CLD A;  5BYM A;  4HNM A;  4HXT A;  5BZV A;  2GL7 A;  5EKG A;  5CLC A;  3BSX A;  1M1E A;  4I37 A;  2IWH A;  2X19 B;  4GMN A;  1QBK B;  3ZIR A;  4CB8 A;  1U6G C;  4U5V A;  4UQI B;  3WPT A;  3K4E A;  3K7V A;  3VLF A;  3WOZ A;  3O2Q A;  5HUY C;  4L7M A;  4IMI A;  3GS3 A;  1GCJ A;  4P6Z B;  3UKW B;  5HUW C;  5BZ1 A;  4JW2 B;  2BAP A;  2BKU B;  3ODR A;  4H3K A;  4TNM A;  4ADY A;  5HHG E;  3OPB A;  4CT7 B;  2NYL A;  4I0Y A;  1Y2A C;  4E4V A;  3JXY A;  1M8Z A;  3EA5 B;  3GQ2 A;  5BZU A;  5EWP A;  4I3N A;  4DBA A;  1EE4 A;  3UVU A;  3LTM A;  3O2S A;  3IFQ A;  2P8Q A;  3Q0M A;  1XQR A;  4YGX A;  2BNX A;  4B8P A;  4U3J C;  3EBB A;  5KL8 A;  1M8X A;  2VGL A;  1I7X A;  4FFB C;  2NPP A;  1BK6 A;  2XA7 B;  3ZIN A;  5KLR B;  1UN0 A;  4L4H A;  4YK6 A;  4CB9 A;  2IX3 A;  5CL6 A;  3V6Y A;  4V3R A;  4U5S A;  2IW3 A;  2RU4 A;  2C1T A;  2PKG A;  3FEX C;  4DB8 A;  1UPK A;  2WTK A;  1M5N S;  4O27 A;  3JX7 A;  3JXZ A;  3O4X A;  4Y5J A;  3T7U A;  4CV5 B;  3O2T A;  4I2W A;  4P6Z G;  4A3T A;  1W63 B;  3L3F X;  5D5K C;  2JAK A;  2Z5O A;  3ZIQ A;  2JKR B;  3K5Z A;  2Q5D A;  3TX7 A;  4WV6 A;  5LSW A;  4MZ5 E;  4EVT A;  3GVO A;  2OT8 A;  1LUJ A;  4HM9 A;  3DW8 A;  4K6J A;  3FGA B;  3WOY A;  4JKQ A;  3L3Q A;  1EE5 A;  4JW3 C;  4R0Z A;  4LAC A;  1UPL A;  3TJZ B;  4CT6 B;  1IB2 A;  4JLQ A;  3V74 A;  3BWT A;  2IAE A;  4B8J A;  3VE6 A;  4UAE A;  3RZ9 A;  4EVP A;  1HO8 A;  3K49 A;  4D49 A;  3Q0L A;  5J3V A;  4A0C A;  4KZG A;  1OYZ A;  4R10 A;  4CRV B;  1UKL A;  5SWF A;  4I5L A;  2JKT B;  1WA5 C;  5K9S A;  4PLQ A;  3Q5U A;  1PJN B;  5E6Q B;  2NYL B;  4DB6 A;  1Q1S C;  3GAE A;  4FZA A;  4BPL A;  4IMJ A;  3GB8 A;  5KUB A;  5SVZ A;  3ZIO A;  3ZIK A;  1JPW A;  3BTR C;  4NEE A;  3PST A;  4UAD A;  4MFU A;  1O6P A;  4MZ6 E;  4A3V A;  4FDD A;  4NZW A;  4QMH A;  3UKX B;  4ZDU A;  3JY1 A;  1IBR B;  5CLE A;  4K92 A;  3OBV A;  3W3U A;  5CLB A;  5DN7 A;  2VGL B;  5K6S A;  3SLA A;  3UKY B;  2NPP B;  4RZP A;  4PLR A;  3GNI A;  4OIH A;  4DVG B;  3K5Q A;  3K64 A;  3Q0R A;  5EKF A;  3BX3 A;  1IQ1 C;  4BA3 A;  2BCT A;  2YNR A;  3PSP A;  2Z5J A;  3C2H A;  3RZX A;  1TH1 A;  2RU4 B;  2H4M A;  3Q0N A;  3OUX A;  4U5O A;  5KLA A;  3GRL A;  4I1E A;  1G3J A;  1F59 A;  3Q0Q A;  3SL9 A;  3ZKV A;  3H3D X;  4EV8 A;  3A6P A;  4UAF B;  3Q0P A;  5B56 A;  3K7W A;  5CL8 A;  1JDH A;  3UL1 B;  1T08 A;  4FZD A;  3QML C;  5CL3 A;  2QMR A;  2C1M A;  4GMO A;  3EG5 B;  3DAD A;  5CL4 A;  3Q0O A;  3VLE A;  4CBA A;  2YJY A;  4FQ3 A;  3NMW A;  3NMX A;  4D4E A;  1M8W A;  3C5W A;  4I96 A;  4U54 A;  5CL7 A;  2IE4 A;  2Z6H A;  1M8Y A;  2IAE B;  4QMI A;  4DJS A;  2OF3 A;  3TT9 A;  4YJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...