3ZILA

Structure of the wpl1 protein
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
362
structure length
362
Chain Sequence
TLKYSEDLDFILSDNSMTTPEHRRNNMLRLCLDMMNNEDLCQYIVKYRHREVWEWCFQGTDPKQKVTSLLQCFIADKIPLLRHDKRWAMLSLENFILPLATDEVFPKKIAGSRLVKLNYQDLLRKLKFTNTCEYALYIWATYLLYTEAVYGAVPALARLISRGQLKDWDTACSLLENNIVAAPSGSDIEEYAQAFQTLAGLSREKLTNEGVLKCLIKLTNHTTVLELSADLLPSLVRSLAMSVQLHQNNIVSSISEIKTNLLILQLGLLLNIVSEATTAASTEELTNFGAVFRSVFVKKPTEMSFVLQLFLLVYAYSAGAAGVQLPPAEADFLKSELEAFATDVSSYNHNIHTRITRVLETL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords AAR187CP
publication title Structural Insights Into Regulation of Cohesion Establishment by Wpl1
pubmed doi rcsb
source organism Eremothecium gossypii
total genus 140
structure length 362
sequence length 362
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16997 Wap1 Wap1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.60 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 3zilA00
3ZILA 3ZIKA
chains in the Genus database with same CATH superfamily
1IALA 1HO8A 1M8YA 2QK1A 5KL1A 4DJSA 1LSHA 3TX7A 1JPPA 1XQRA 3FGAA 5K6SA 3O2TA 5K9SA 1M8XA 3L3QA 2VGLB 4U2XD 3OPBA 3ZIRA 5CL7A 4UAEA 4YK6A 3Q0OA 3Q5UA 2JAKA 4R10A 4U58A 4U5NA 3TJ3A 2JKRA 2XA7B 3GB8A 3KNDA 1EE4A 2C1MA 3PSTA 3EG5B 4JW2A 3FEXC 3Q0LA 3K4EA 3UL0B 4B8OA 3K7VA 4I2SA 4R11A 1PJNB 2RU4B 3H3DX 4FDDA 3K61A 4UADA 2BAPA 4EVTA 4I6IA 4QMIA 4I37A 4YJEA 3Q0SA 4EV9A 3WOYA 3T8SA 3ZIPA 2W3CA 2Z5JA 3BTRC 4FZAA 4U5UA 3C2GA 1B3UA 4IMIA 1QGKA 2IE4A 2NYMA 1W63A 4D49A 2X19B 1UKLA 3OUXA 4XZRB 2Z5MA 1IBRB 2QMRA 4JLQA 1BK5A 4TNMA 3WPTA 4QMJA 4GMNA 4PLRA 1UN0A 4I0YA 3C5WA 2XOAA 4OIHA 4CT7B 3DADA 5HHGE 5D5KC 4U5VA 4UQIA 4A3VA 3PSPA 4V3OA 5LSWA 4UWXA 5CL4A 4DBAA 2YJYA 3NOWA 4QMHA 4CRUB 5EWPA 1M8WA 3UVUA 1PJMB 4BQKA 4B18A 1JDHA 3UKXB 3BSXA 2YNSA 1QGRA 1Z2CB 5HUWC 4FP7A 3C2HA 2VGLA 3UJ4A 3L6YA 3JXZA 1QZ7A 2BNXA 3ODRA 3VLFA 3VLDA 3VLEA 2XA7A 3OQSA 4GMOA 2Q5DA 3SLAA 3LTMA 3IFQA 3NMXA 3Q0PA 5BZUA 4CB9A 5B56A 3GRLA 1TH1A 5SVZA 4HTVA 5CLDA 4FZFA 1GCJA 3Q0NA 4CT6B 3LWWA 1LUJA 3BWTA 4YGXA 4Y5JA 3QG9A 1WA5B 5H2WA 3T7UA 2F31A 2RU4A 4I2WA 5KLAA 4CB8A 2BCTA 4IMJA 4BA3A 4V3QA 2IE3A 1QBKB 3Q0MA 4YI0C 3OUWA 1EE5A 3RZ9A 4U54A 3GVTA 5CL3A 2Z6HA 2OF3A 4DZSA 1O6PA 5CLEA 4NEEA 4I96A 1I7WA 5SW9A 2QNAA 1M5NS 2Z6GA 1TE4A 5CTTA 1V18A 3ZINA 4I3NA 2IWHA 3JX7A 5FC8E 4WV6A 4V3RA 1T08A 2NYLB 2H4MA 4DB8A 3WOZA 3QMLC 5EKFA 3ZIOA 2JDQA 1OYZA 3ZIKA 1G3JA 4DB6A 4L7MA 3GNIA 4G3AA 3DW8A 3GS3A 5E6QB 3EBBA 4H3KA 4MFVA 3O2SA 5SWFA 3V74A 1O6OA 4PLSA 1EJYI 3GAEA 3NMZA 2BKUB 3K62A 4CBAA 5BZVA 4RZPA 3Q0RA 4JW3C 1Y2AC 3K7WA 4UAFB 5CLAA 4L4HA 4RV1A 4EVAA 1M8ZA 3JXYA 1Q1TC 3L3FX 5BZ5A 2Z5NA 3ZHPA 3UKWB 4OO6A 5KLRB 3TT9A 4JKQA 2FV2A 4I1EA 1XQSA 1IQ1C 1XM9A 4I2ZA 3L6XA 2YNRA 4P6ZG 1BK6A 2IAEB 3GQ2A 2JKTB 3RZXA 4I8MA 1F59A 5CL5A 3ZKVA 3QGBA 1UPKA 2Z5OA 5KUBA 5H2XA 4YJLA 3NMWA 3A6PA 3ZILA 4A0CA 5BZ1A 5JJAA 3GVOA 3UJ0A 3ND2A 3OBVA 5BYMA 2P8QA 3IBVA 4R0ZA 3FEYC 1LRVA 2NPPB 4ADYA 5CL6A 4FZDA 3TPMA 3BVSA 4D4EA 2NYLA 3VWAA 3TJZB 3WYFC 4I7IA 3VE6A 4ZDUA 3QGCA 4MFUA 1JPWA 2OT8A 5J3VA 3SL9A 4PVZA 5EKGA 4MZ5E 3BX2A 4CRVB 3K64A 1EJLI 1M1EA 3FGAB 4EVPA 3K5ZA 3K5QA 2X1GF 2C1TA 4A3TA 1I7XA 4HNMA 5CL9A 4FFBC 4MZ6E 3W3UA 4BPLA 5AEIA 2JKRB 2Z5KA 3UKZB 3K5YA 3UKYB 3ODSA 4H3HA 4B8PA 2IX3A 3K49A 4O27A 4U5LA 4JW2B 4P6ZB 5KLTB 2GL7A 2IW3A 2PKGA 4PLQA 3JY1A 3BX3A 4I5LA 3O4XA 4K92A 3LTJA 4DB9A 2IAEA 4L4IA 4U5OA 2PF4A 3BCTA 1W9CA 2JKTA 3BSBA 3Q0QA 1Q1SC 4DVGB 4I5NA 4K6JA 5CLBA 3V71A 4U3JC 5DN7A 4EV8A 4RXHB 5KL8A 1U6GC 2NYMB 2DB0A 4U5SA 5CL8A 1W63B 4KZGA 4HM9A 2QK2A 4NZWA 1N4KA 2NPPA 3UL1B 4LACA 4E4VA 3ZIQA 3V6YA 2WTKA 1WA5C 3EA5B 4UQIB 5HUYC 3TPOA 1UPLA 4B8JA 5CLCA 4FQ3A 1IB2A 3O2QA 4CV5B 3AU3A 3QHEA 4HXTA
chains in the Genus database with same CATH topology
1IALA 1HO8A 1M8YA 2QK1A 5KL1A 4DJSA 3TX7A 1JPPA 1XQRA 3FGAA 5K6SA 3O2TA 5K9SA 1M8XA 3L3QA 2VGLB 4U2XD 3OPBA 3ZIRA 5CL7A 4UAEA 4YK6A 3Q0OA 3Q5UA 2JAKA 4R10A 4U58A 4U5NA 3TJ3A 2JKRA 2XA7B 3GB8A 3KNDA 1EE4A 2C1MA 3PSTA 3EG5B 4JW2A 3FEXC 3Q0LA 3K4EA 3UL0B 4B8OA 3K7VA 4I2SA 4R11A 1PJNB 2RU4B 3H3DX 4FDDA 3K61A 4UADA 2BAPA 4EVTA 4I6IA 4QMIA 4I37A 4YJEA 3Q0SA 4EV9A 3WOYA 3ZIPA 2W3CA 2Z5JA 3BTRC 4FZAA 4U5UA 3C2GA 1B3UA 4IMIA 1QGKA 2IE4A 2NYMA 1W63A 4D49A 2X19B 1UKLA 3OUXA 4XZRB 2Z5MA 1IBRB 2QMRA 4JLQA 1BK5A 4TNMA 3WPTA 4QMJA 4GMNA 4PLRA 1UN0A 4I0YA 3C5WA 2XOAA 4OIHA 4CT7B 3DADA 5HHGE 5D5KC 4U5VA 4UQIA 4A3VA 3PSPA 4V3OA 5LSWA 4UWXA 5CL4A 4DBAA 2YJYA 3NOWA 4QMHA 4CRUB 5EWPA 1M8WA 3UVUA 1PJMB 4BQKA 4B18A 1JDHA 3UKXB 3BSXA 2YNSA 1QGRA 1Z2CB 5HUWC 4FP7A 3C2HA 2VGLA 3L6YA 3JXZA 1QZ7A 2BNXA 3ODRA 3VLFA 3VLDA 3VLEA 2XA7A 3OQSA 4GMOA 2Q5DA 3SLAA 3LTMA 3IFQA 3NMXA 3Q0PA 5BZUA 4CB9A 5B56A 3GRLA 1TH1A 5SVZA 4HTVA 5CLDA 4FZFA 1GCJA 3Q0NA 4CT6B 3LWWA 1LUJA 3BWTA 4YGXA 4Y5JA 3QG9A 1WA5B 5H2WA 3T7UA 2F31A 2RU4A 4I2WA 5KLAA 4CB8A 2BCTA 4IMJA 4BA3A 4V3QA 2IE3A 1QBKB 3Q0MA 4YI0C 3OUWA 1EE5A 3RZ9A 4U54A 3GVTA 5CL3A 2Z6HA 2OF3A 4DZSA 1O6PA 5CLEA 4NEEA 4I96A 1I7WA 5SW9A 2QNAA 1M5NS 2Z6GA 1TE4A 5CTTA 1V18A 3ZINA 4I3NA 2IWHA 3JX7A 5FC8E 4WV6A 4V3RA 1T08A 2NYLB 2H4MA 4DB8A 3WOZA 3QMLC 5EKFA 3ZIOA 2JDQA 1OYZA 3ZIKA 1G3JA 4DB6A 4L7MA 3GNIA 4G3AA 3DW8A 3GS3A 5E6QB 3EBBA 4H3KA 4MFVA 3O2SA 5SWFA 3V74A 1O6OA 4PLSA 1EJYI 3GAEA 3NMZA 2BKUB 3K62A 4CBAA 5BZVA 4RZPA 3Q0RA 4JW3C 1Y2AC 3K7WA 4UAFB 5CLAA 4L4HA 4RV1A 4EVAA 1M8ZA 3JXYA 1Q1TC 3L3FX 5BZ5A 2Z5NA 3ZHPA 3UKWB 4OO6A 5KLRB 3TT9A 4JKQA 2FV2A 4I1EA 1XQSA 1IQ1C 1XM9A 4I2ZA 3L6XA 2YNRA 4P6ZG 1BK6A 2IAEB 3GQ2A 2JKTB 3RZXA 4I8MA 1F59A 5CL5A 3ZKVA 3QGBA 1UPKA 2Z5OA 5KUBA 5H2XA 4YJLA 3NMWA 3A6PA 3ZILA 4A0CA 5BZ1A 5JJAA 3GVOA 3ND2A 3OBVA 5BYMA 2P8QA 3IBVA 4R0ZA 3FEYC 1LRVA 2NPPB 4ADYA 5CL6A 4FZDA 3TPMA 3BVSA 4D4EA 2NYLA 3VWAA 3TJZB 3WYFC 4I7IA 3VE6A 4ZDUA 3QGCA 4MFUA 1JPWA 2OT8A 5J3VA 3SL9A 4PVZA 5EKGA 4MZ5E 3BX2A 4CRVB 3K64A 1EJLI 1M1EA 3FGAB 4EVPA 3K5ZA 3K5QA 2X1GF 2C1TA 4A3TA 1I7XA 4HNMA 5CL9A 4FFBC 4MZ6E 3W3UA 4BPLA 5AEIA 2JKRB 2Z5KA 3UKZB 3K5YA 3UKYB 3ODSA 4H3HA 4B8PA 2IX3A 3K49A 4O27A 4U5LA 4JW2B 4P6ZB 5KLTB 2GL7A 2IW3A 2PKGA 4PLQA 3JY1A 3BX3A 4I5LA 3O4XA 4K92A 3LTJA 4DB9A 2IAEA 4L4IA 4U5OA 2PF4A 3BCTA 1W9CA 2JKTA 3BSBA 3Q0QA 1Q1SC 4DVGB 4I5NA 4K6JA 5CLBA 3V71A 4U3JC 5DN7A 4EV8A 4RXHB 5KL8A 1U6GC 2NYMB 2DB0A 4U5SA 5CL8A 1W63B 4KZGA 4HM9A 2QK2A 4NZWA 2NPPA 3UL1B 4LACA 4E4VA 3ZIQA 3V6YA 2WTKA 1WA5C 3EA5B 4UQIB 5HUYC 3TPOA 1UPLA 4B8JA 5CLCA 4FQ3A 1IB2A 3O2QA 4CV5B 3AU3A 3QHEA 4HXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZIL A;  3ZIK A; 
#chains in the Genus database with same CATH topology
 1IAL A;  1HO8 A;  1M8Y A;  2QK1 A;  5KL1 A;  4DJS A;  1LSH A;  3TX7 A;  1JPP A;  1XQR A;  3FGA A;  5K6S A;  3O2T A;  5K9S A;  1M8X A;  3L3Q A;  2VGL B;  4U2X D;  3OPB A;  3ZIR A;  5CL7 A;  4UAE A;  4YK6 A;  3Q0O A;  3Q5U A;  2JAK A;  4R10 A;  4U58 A;  4U5N A;  3TJ3 A;  2JKR A;  2XA7 B;  3GB8 A;  3KND A;  1EE4 A;  2C1M A;  3PST A;  3EG5 B;  4JW2 A;  3FEX C;  3Q0L A;  3K4E A;  3UL0 B;  4B8O A;  3K7V A;  4I2S A;  4R11 A;  1PJN B;  2RU4 B;  3H3D X;  4FDD A;  3K61 A;  4UAD A;  2BAP A;  4EVT A;  4I6I A;  4QMI A;  4I37 A;  4YJE A;  3Q0S A;  4EV9 A;  3WOY A;  3T8S A;  3ZIP A;  2W3C A;  2Z5J A;  3BTR C;  4FZA A;  4U5U A;  3C2G A;  1B3U A;  4IMI A;  1QGK A;  2IE4 A;  2NYM A;  1W63 A;  4D49 A;  2X19 B;  1UKL A;  3OUX A;  4XZR B;  2Z5M A;  1IBR B;  2QMR A;  4JLQ A;  1BK5 A;  4TNM A;  3WPT A;  4QMJ A;  4GMN A;  4PLR A;  1UN0 A;  4I0Y A;  3C5W A;  2XOA A;  4OIH A;  4CT7 B;  3DAD A;  5HHG E;  5D5K C;  4U5V A;  4UQI A;  4A3V A;  3PSP A;  4V3O A;  5LSW A;  4UWX A;  5CL4 A;  4DBA A;  2YJY A;  3NOW A;  4QMH A;  4CRU B;  5EWP A;  1M8W A;  3UVU A;  1PJM B;  4BQK A;  4B18 A;  1JDH A;  3UKX B;  3BSX A;  2YNS A;  1QGR A;  1Z2C B;  5HUW C;  4FP7 A;  3C2H A;  2VGL A;  3UJ4 A;  3L6Y A;  3JXZ A;  1QZ7 A;  2BNX A;  3ODR A;  3VLF A;  3VLD A;  3VLE A;  2XA7 A;  3OQS A;  4GMO A;  2Q5D A;  3SLA A;  3LTM A;  3IFQ A;  3NMX A;  3Q0P A;  5BZU A;  4CB9 A;  5B56 A;  3GRL A;  1TH1 A;  5SVZ A;  4HTV A;  5CLD A;  4FZF A;  1GCJ A;  3Q0N A;  4CT6 B;  3LWW A;  1LUJ A;  3BWT A;  4YGX A;  4Y5J A;  3QG9 A;  1WA5 B;  5H2W A;  3T7U A;  2F31 A;  2RU4 A;  4I2W A;  5KLA A;  4CB8 A;  2BCT A;  4IMJ A;  4BA3 A;  4V3Q A;  2IE3 A;  1QBK B;  3Q0M A;  4YI0 C;  3OUW A;  1EE5 A;  3RZ9 A;  4U54 A;  3GVT A;  5CL3 A;  2Z6H A;  2OF3 A;  4DZS A;  1O6P A;  5CLE A;  4NEE A;  4I96 A;  1I7W A;  5SW9 A;  2QNA A;  1M5N S;  2Z6G A;  1TE4 A;  5CTT A;  1V18 A;  3ZIN A;  4I3N A;  2IWH A;  3JX7 A;  5FC8 E;  4WV6 A;  4V3R A;  1T08 A;  2NYL B;  2H4M A;  4DB8 A;  3WOZ A;  3QML C;  5EKF A;  3ZIO A;  2JDQ A;  1OYZ A;  3ZIK A;  1G3J A;  4DB6 A;  4L7M A;  3GNI A;  4G3A A;  3DW8 A;  3GS3 A;  5E6Q B;  3EBB A;  4H3K A;  4MFV A;  3O2S A;  5SWF A;  3V74 A;  1O6O A;  4PLS A;  1EJY I;  3GAE A;  3NMZ A;  2BKU B;  3K62 A;  4CBA A;  5BZV A;  4RZP A;  3Q0R A;  4JW3 C;  1Y2A C;  3K7W A;  4UAF B;  5CLA A;  4L4H A;  4RV1 A;  4EVA A;  1M8Z A;  3JXY A;  1Q1T C;  3L3F X;  5BZ5 A;  2Z5N A;  3ZHP A;  3UKW B;  4OO6 A;  5KLR B;  3TT9 A;  4JKQ A;  2FV2 A;  4I1E A;  1XQS A;  1IQ1 C;  1XM9 A;  4I2Z A;  3L6X A;  2YNR A;  4P6Z G;  1BK6 A;  2IAE B;  3GQ2 A;  2JKT B;  3RZX A;  4I8M A;  1F59 A;  5CL5 A;  3ZKV A;  3QGB A;  1UPK A;  2Z5O A;  5KUB A;  5H2X A;  4YJL A;  3NMW A;  3A6P A;  3ZIL A;  4A0C A;  5BZ1 A;  5JJA A;  3GVO A;  3UJ0 A;  3ND2 A;  3OBV A;  5BYM A;  2P8Q A;  3IBV A;  4R0Z A;  3FEY C;  1LRV A;  2NPP B;  4ADY A;  5CL6 A;  4FZD A;  3TPM A;  3BVS A;  4D4E A;  2NYL A;  3VWA A;  3TJZ B;  3WYF C;  4I7I A;  3VE6 A;  4ZDU A;  3QGC A;  4MFU A;  1JPW A;  2OT8 A;  5J3V A;  3SL9 A;  4PVZ A;  5EKG A;  4MZ5 E;  3BX2 A;  4CRV B;  3K64 A;  1EJL I;  1M1E A;  3FGA B;  4EVP A;  3K5Z A;  3K5Q A;  2X1G F;  2C1T A;  4A3T A;  1I7X A;  4HNM A;  5CL9 A;  4FFB C;  4MZ6 E;  3W3U A;  4BPL A;  5AEI A;  2JKR B;  2Z5K A;  3UKZ B;  3K5Y A;  3UKY B;  3ODS A;  4H3H A;  4B8P A;  2IX3 A;  3K49 A;  4O27 A;  4U5L A;  4JW2 B;  4P6Z B;  5KLT B;  2GL7 A;  2IW3 A;  2PKG A;  4PLQ A;  3JY1 A;  3BX3 A;  4I5L A;  3O4X A;  4K92 A;  3LTJ A;  4DB9 A;  2IAE A;  4L4I A;  4U5O A;  2PF4 A;  3BCT A;  1W9C A;  2JKT A;  3BSB A;  3Q0Q A;  1Q1S C;  4DVG B;  4I5N A;  4K6J A;  5CLB A;  3V71 A;  4U3J C;  5DN7 A;  4EV8 A;  4RXH B;  5KL8 A;  1U6G C;  2NYM B;  2DB0 A;  4U5S A;  5CL8 A;  1W63 B;  4KZG A;  4HM9 A;  2QK2 A;  4NZW A;  1N4K A;  2NPP A;  3UL1 B;  4LAC A;  4E4V A;  3ZIQ A;  3V6Y A;  2WTK A;  1WA5 C;  3EA5 B;  4UQI B;  5HUY C;  3TPO A;  1UPL A;  4B8J A;  5CLC A;  4FQ3 A;  1IB2 A;  3O2Q A;  4CV5 B;  3AU3 A;  3QHE A;  4HXT A; 
#chains in the Genus database with same CATH homology
 1IAL A;  1HO8 A;  1M8Y A;  2QK1 A;  5KL1 A;  4DJS A;  3TX7 A;  1JPP A;  1XQR A;  3FGA A;  5K6S A;  3O2T A;  5K9S A;  1M8X A;  3L3Q A;  2VGL B;  4U2X D;  3OPB A;  3ZIR A;  5CL7 A;  4UAE A;  4YK6 A;  3Q0O A;  3Q5U A;  2JAK A;  4R10 A;  4U58 A;  4U5N A;  3TJ3 A;  2JKR A;  2XA7 B;  3GB8 A;  3KND A;  1EE4 A;  2C1M A;  3PST A;  3EG5 B;  4JW2 A;  3FEX C;  3Q0L A;  3K4E A;  3UL0 B;  4B8O A;  3K7V A;  4I2S A;  4R11 A;  1PJN B;  2RU4 B;  3H3D X;  4FDD A;  3K61 A;  4UAD A;  2BAP A;  4EVT A;  4I6I A;  4QMI A;  4I37 A;  4YJE A;  3Q0S A;  4EV9 A;  3WOY A;  3ZIP A;  2W3C A;  2Z5J A;  3BTR C;  4FZA A;  4U5U A;  3C2G A;  1B3U A;  4IMI A;  1QGK A;  2IE4 A;  2NYM A;  1W63 A;  4D49 A;  2X19 B;  1UKL A;  3OUX A;  4XZR B;  2Z5M A;  1IBR B;  2QMR A;  4JLQ A;  1BK5 A;  4TNM A;  3WPT A;  4QMJ A;  4GMN A;  4PLR A;  1UN0 A;  4I0Y A;  3C5W A;  2XOA A;  4OIH A;  4CT7 B;  3DAD A;  5HHG E;  5D5K C;  4U5V A;  4UQI A;  4A3V A;  3PSP A;  4V3O A;  5LSW A;  4UWX A;  5CL4 A;  4DBA A;  2YJY A;  3NOW A;  4QMH A;  4CRU B;  5EWP A;  1M8W A;  3UVU A;  1PJM B;  4BQK A;  4B18 A;  1JDH A;  3UKX B;  3BSX A;  2YNS A;  1QGR A;  1Z2C B;  5HUW C;  4FP7 A;  3C2H A;  2VGL A;  3L6Y A;  3JXZ A;  1QZ7 A;  2BNX A;  3ODR A;  3VLF A;  3VLD A;  3VLE A;  2XA7 A;  3OQS A;  4GMO A;  2Q5D A;  3SLA A;  3LTM A;  3IFQ A;  3NMX A;  3Q0P A;  5BZU A;  4CB9 A;  5B56 A;  3GRL A;  1TH1 A;  5SVZ A;  4HTV A;  5CLD A;  4FZF A;  1GCJ A;  3Q0N A;  4CT6 B;  3LWW A;  1LUJ A;  3BWT A;  4YGX A;  4Y5J A;  3QG9 A;  1WA5 B;  5H2W A;  3T7U A;  2F31 A;  2RU4 A;  4I2W A;  5KLA A;  4CB8 A;  2BCT A;  4IMJ A;  4BA3 A;  4V3Q A;  2IE3 A;  1QBK B;  3Q0M A;  4YI0 C;  3OUW A;  1EE5 A;  3RZ9 A;  4U54 A;  3GVT A;  5CL3 A;  2Z6H A;  2OF3 A;  4DZS A;  1O6P A;  5CLE A;  4NEE A;  4I96 A;  1I7W A;  5SW9 A;  2QNA A;  1M5N S;  2Z6G A;  1TE4 A;  5CTT A;  1V18 A;  3ZIN A;  4I3N A;  2IWH A;  3JX7 A;  5FC8 E;  4WV6 A;  4V3R A;  1T08 A;  2NYL B;  2H4M A;  4DB8 A;  3WOZ A;  3QML C;  5EKF A;  3ZIO A;  2JDQ A;  1OYZ A;  3ZIK A;  1G3J A;  4DB6 A;  4L7M A;  3GNI A;  4G3A A;  3DW8 A;  3GS3 A;  5E6Q B;  3EBB A;  4H3K A;  4MFV A;  3O2S A;  5SWF A;  3V74 A;  1O6O A;  4PLS A;  1EJY I;  3GAE A;  3NMZ A;  2BKU B;  3K62 A;  4CBA A;  5BZV A;  4RZP A;  3Q0R A;  4JW3 C;  1Y2A C;  3K7W A;  4UAF B;  5CLA A;  4L4H A;  4RV1 A;  4EVA A;  1M8Z A;  3JXY A;  1Q1T C;  3L3F X;  5BZ5 A;  2Z5N A;  3ZHP A;  3UKW B;  4OO6 A;  5KLR B;  3TT9 A;  4JKQ A;  2FV2 A;  4I1E A;  1XQS A;  1IQ1 C;  1XM9 A;  4I2Z A;  3L6X A;  2YNR A;  4P6Z G;  1BK6 A;  2IAE B;  3GQ2 A;  2JKT B;  3RZX A;  4I8M A;  1F59 A;  5CL5 A;  3ZKV A;  3QGB A;  1UPK A;  2Z5O A;  5KUB A;  5H2X A;  4YJL A;  3NMW A;  3A6P A;  3ZIL A;  4A0C A;  5BZ1 A;  5JJA A;  3GVO A;  3ND2 A;  3OBV A;  5BYM A;  2P8Q A;  3IBV A;  4R0Z A;  3FEY C;  1LRV A;  2NPP B;  4ADY A;  5CL6 A;  4FZD A;  3TPM A;  3BVS A;  4D4E A;  2NYL A;  3VWA A;  3TJZ B;  3WYF C;  4I7I A;  3VE6 A;  4ZDU A;  3QGC A;  4MFU A;  1JPW A;  2OT8 A;  5J3V A;  3SL9 A;  4PVZ A;  5EKG A;  4MZ5 E;  3BX2 A;  4CRV B;  3K64 A;  1EJL I;  1M1E A;  3FGA B;  4EVP A;  3K5Z A;  3K5Q A;  2X1G F;  2C1T A;  4A3T A;  1I7X A;  4HNM A;  5CL9 A;  4FFB C;  4MZ6 E;  3W3U A;  4BPL A;  5AEI A;  2JKR B;  2Z5K A;  3UKZ B;  3K5Y A;  3UKY B;  3ODS A;  4H3H A;  4B8P A;  2IX3 A;  3K49 A;  4O27 A;  4U5L A;  4JW2 B;  4P6Z B;  5KLT B;  2GL7 A;  2IW3 A;  2PKG A;  4PLQ A;  3JY1 A;  3BX3 A;  4I5L A;  3O4X A;  4K92 A;  3LTJ A;  4DB9 A;  2IAE A;  4L4I A;  4U5O A;  2PF4 A;  3BCT A;  1W9C A;  2JKT A;  3BSB A;  3Q0Q A;  1Q1S C;  4DVG B;  4I5N A;  4K6J A;  5CLB A;  3V71 A;  4U3J C;  5DN7 A;  4EV8 A;  4RXH B;  5KL8 A;  1U6G C;  2NYM B;  2DB0 A;  4U5S A;  5CL8 A;  1W63 B;  4KZG A;  4HM9 A;  2QK2 A;  4NZW A;  2NPP A;  3UL1 B;  4LAC A;  4E4V A;  3ZIQ A;  3V6Y A;  2WTK A;  1WA5 C;  3EA5 B;  4UQI B;  5HUY C;  3TPO A;  1UPL A;  4B8J A;  5CLC A;  4FQ3 A;  1IB2 A;  3O2Q A;  4CV5 B;  3AU3 A;  3QHE A;  4HXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...