4WV6A

Heterodimer of importin alpha 1 with nuclear localization signal of taf8
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
426
structure length
426
Chain Sequence
GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Importin subunit alpha-1
publication title Cytoplasmic TAF2-TAF8-TAF10 complex provides evidence for nuclear holo-TFIID assembly from preformed submodules.
pubmed doi rcsb
source organism Homo sapiens
total genus 176
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2014-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00514 Arm Armadillo/beta-catenin-like repeat
A PF16186 Arm_3 Atypical Arm repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 4wv6A00
3H3DX 4I5NA 1JPPA 2XA7B 3GVTA 3C2HA 4HXTA 3L6YA 3V6YA 1HO8A 3EA5B 4CT7B 1UPKA 5SWFA 1QGKA 1G3JA 1UPLA 4DVGB 5KL8A 1EJYI 2NPPA 1LUJA 1QGRA 1Q1TC 3NOWA 4UQIB 4Y5JA 1I7WA 3Q0QA 4U5LA 3K7VA 3QGCA 3AU3A 2PF4A 2Z6GA 3GNIA 1BK5A 1BK6A 3GS3A 5CTTA 4B18A 4D49A 1EE4A 4CRVB 3BX3A 4FQ3A 1V18A 1W9CA 3TPMA 4DZSA 3VE6A 4TNMA 5DN7A 4CBAA 4CRUB 4I2ZA 5SW9A 3RZXA 2RU4B 1Y2AC 3Q0OA 5KL1A 4O27A 1M8WA 1M8ZA 5AEIA 4QMJA 2NYLB 2WTKA 4PLRA 1M8YA 3WYFC 4UAFB 4BQKA 2JKRA 3A6PA 3UKZB 2YNSA 3TJ3A 3TX7A 2IE3A 2YJYA 4B8OA 4MFVA 2Z5MA 4U5OA 5K6SA 2VGLA 1TH1A 2C1TA 4KZGA 3ZIPA 3O2QA 3BX2A 3FEYC 3DADA 3Q0RA 3OBVA 2QK1A 3EG5B 2X19B 5BZVA 4PVZA 4U58A 5KLTB 3K5QA 3C2GA 4K92A 3ZIOA 5EKGA 2XA7A 2Z5KA 4PLSA 3UL1B 5H2WA 4K6JA 2JAKA 4B8JA 1M8XA 3BWTA 5EWPA 4MZ5E 3L6XA 4LACA 3KNDA 4FDDA 1I7XA 2JKTB 3IFQA 1WA5C 4UQIA 4EV9A 4WV6A 3LWWA 4NZWA 4V3RA 1IBRB 4RV1A 2QK2A 2Z5NA 4IMJA 4JLQA 4DB6A 1O6OA 5E6QB 4QMIA 3UKXB 1XM9A 3ZINA 5BYMA 3TPOA 1QBKB 1PJMB 3O4XA 4D4EA 4YJLA 3FEXC 3K5YA 3GAEA 1QZ7A 1T08A 5BZUA 4UADA 2PKGA 3UVUA 4CT6B 4EVAA 3O2SA 3VWAA 4U5VA 3Q0MA 2RU4A 2OT8A 2Z5OA 4NEEA 4YJEA 4ZDUA 2NYLA 3WOYA 3OUXA 3GQ2A 4DBAA 4DB8A 3V71A 4I2WA 4EV8A 3EBBA 1W63B 4UAEA 1EJLI 3GVOA 1IB2A 1UKLA 3ZKVA 2IW3A 4YI0C 3GB8A 4OIHA 2IAEB 3PSTA 3GRLA 2F31A 5LSWA 1F59A 3T7UA 5HHGE 2YNRA 4RXHB 3QHEA 3ZIRA 3K64A 4U5SA 1B3UA 3Q5UA 1M1EA 5KLRB 3NMZA 3RZ9A 4CB9A 2OF3A 3QG9A 3FGAB 2QMRA 1XQRA 2QNAA 4B8PA 3W3UA 4U3JC 3ODRA 1O6PA 3ODSA 2Q5DA 5H2XA 1WA5B 3WPTA 3TJZB 2JKTA 3UKYB 4OO6A 3Q0LA 3K61A 2P8QA 4CV5B 4H3HA 4DJSA 2BAPA 4FFBC 1OYZA 3LTMA 4BPLA 1LRVA 3LTJA 2H4MA 5K9SA 1JDHA 2FV2A 1JPWA 2BCTA 4E4VA 4R10A 3ZHPA 4QMHA 4V3QA 3BTRC 4FZAA 3ND2A 4DB9A 1XQSA 3UL0B 2IE4A 2NYMB 3NMXA 4HNMA 3Q0PA 3L3FX 3K62A 5BZ5A 5D5KC 3V74A 1IALA 4V3OA 3ZIQA 1U6GC 4L7MA 2X1GF 1W63A 4YGXA 4R11A 1PJNB 1GCJA 4YK6A 4EVPA 4HM9A 4MFUA 2IAEA 3IBVA 5FC8E 2Z5JA 3C5WA 4U54A 4RZPA 2NPPB 4FZFA 2W3CA 3BSXA 4G3AA 3QGBA 4I5LA 3K4EA 1EE5A 5SVZA 3Q0SA 3FGAA 5EKFA 3O2TA 3UKWB 2IWHA 3L3QA 3K49A 5BZ1A 4R0ZA 3NMWA 1Z2CB 5JJAA 3OUWA 4GMOA 4PLQA 2DB0A 1UN0A 3BCTA 5J3VA 4P6ZB 1IQ1C 3DW8A 4BA3A 3K5ZA 4U5UA 4XZRB 4CB8A 4U5NA 4A0CA 5KLAA 1M5NS 5HUYC 2BNXA 2JKRB 1Q1SC 4HTVA 3TT9A 3QMLC 2IX3A 3PSPA 4IMIA 2Z6HA 3WOZA 3Q0NA 2JDQA 2NYMA 2VGLB 3OPBA 4FZDA 3BSBA 4EVTA 4P6ZG 2C1MA 4H3KA 3OQSA 2GL7A 5HUWC 4MZ6E 4ADYA 3K7WA 5B56A 4GMNA 4UWXA 4JW2B 2BKUB
chains in the Genus database with same CATH superfamily
3H3DX 4I5NA 1JPPA 2XA7B 3GVTA 3C2HA 4HXTA 3L6YA 3V6YA 1HO8A 3EA5B 4L4HA 4CT7B 1UPKA 5SWFA 1QGKA 1G3JA 1UPLA 4DVGB 5KL8A 1EJYI 2NPPA 1LUJA 1QGRA 1Q1TC 3NOWA 4JKQA 4UQIB 4Y5JA 1I7WA 3Q0QA 4U5LA 3K7VA 3QGCA 3AU3A 2PF4A 2Z6GA 3GNIA 1BK5A 1BK6A 3GS3A 5CTTA 4B18A 4D49A 1EE4A 4CRVB 3BX3A 4FQ3A 1V18A 1W9CA 3TPMA 4DZSA 3VE6A 4TNMA 5DN7A 2BKUB 4CBAA 4CRUB 4I2ZA 5SW9A 3RZXA 2RU4B 1Y2AC 3Q0OA 5KL1A 4O27A 1M8WA 1M8ZA 5AEIA 4QMJA 2NYLB 2WTKA 4PLRA 1M8YA 3WYFC 4UAFB 4BQKA 1TE4A 2JKRA 3T8SA 3A6PA 3UKZB 5CL4A 2YNSA 3TJ3A 3TX7A 2IE3A 2YJYA 4U5OA 4MFVA 2Z5MA 4B8OA 5K6SA 3SL9A 2VGLA 1TH1A 2C1TA 4KZGA 3O2QA 3ZIPA 3BX2A 5CL8A 3FEYC 3DADA 3Q0RA 3OBVA 2QK1A 3EG5B 2X19B 4JW2A 5BZVA 4PVZA 4U58A 5KLTB 3K5QA 3C2GA 4K92A 3ZIOA 5EKGA 2XA7A 2Z5KA 4PLSA 3UL1B 5H2WA 4K6JA 2JAKA 4A3VA 4U2XD 4B8JA 1M8XA 3ZILA 5CL9A 3BWTA 5EWPA 4MZ5E 3L6XA 4LACA 3KNDA 4FDDA 4I0YA 1I7XA 3VLDA 2JKTB 3IFQA 1WA5C 4UQIA 4EV9A 4WV6A 3LWWA 4NZWA 4V3RA 1IBRB 4RV1A 2QK2A 2Z5NA 4IMJA 4JLQA 4DB6A 1O6OA 5E6QB 4QMIA 3UKXB 1XM9A 3ZINA 5BYMA 3SLAA 3TPOA 1QBKB 5CLDA 5CL5A 1PJMB 3O4XA 4D4EA 4YJLA 3FEXC 3K5YA 3GAEA 1QZ7A 1T08A 5BZUA 4UADA 2PKGA 3UVUA 4CT6B 4I2SA 4I1EA 4EVAA 3O2SA 3VWAA 4U5VA 3Q0MA 2RU4A 2OT8A 2Z5OA 3VLFA 4NEEA 4YJEA 4A3TA 4ZDUA 2NYLA 3UJ0A 3WOYA 3OUXA 3GQ2A 5CL6A 4DBAA 4DB8A 3V71A 4I2WA 4EV8A 3EBBA 1W63B 4UAEA 1EJLI 3GVOA 1IB2A 1UKLA 3ZKVA 2IW3A 4YI0C 3ZIKA 3GB8A 4OIHA 2IAEB 3PSTA 3GRLA 2F31A 5LSWA 1F59A 3T7UA 5HHGE 2YNRA 4RXHB 3QHEA 3ZIRA 3K64A 4U5SA 1B3UA 3Q5UA 1M1EA 4I3NA 5KLRB 3NMZA 3RZ9A 4CB9A 2OF3A 3QG9A 3FGAB 5CLAA 2QMRA 1XQRA 2QNAA 3JXYA 4B8PA 3W3UA 4U3JC 3ODRA 1O6PA 3ODSA 2Q5DA 5H2XA 1WA5B 3WPTA 3TJZB 2JKTA 3UKYB 5CLEA 4OO6A 3Q0LA 3K61A 1N4KA 2P8QA 4CV5B 3BVSA 4H3HA 4DJSA 2BAPA 4FFBC 1OYZA 3LTMA 4BPLA 1LRVA 3LTJA 4I7IA 2H4MA 5K9SA 1JDHA 2FV2A 1JPWA 2BCTA 4E4VA 4R10A 3ZHPA 4QMHA 4V3QA 3BTRC 5KUBA 4FZAA 3ND2A 4DB9A 1XQSA 3UL0B 2IE4A 2NYMB 4I96A 3NMXA 4HNMA 3Q0PA 3L3FX 3K62A 5BZ5A 3JXZA 5D5KC 3V74A 1IALA 4V3OA 3ZIQA 5CLBA 2XOAA 1U6GC 4L7MA 5CL7A 2X1GF 1W63A 4YGXA 4R11A 1PJNB 1GCJA 4YK6A 4EVPA 4HM9A 4I6IA 4MFUA 2IAEA 3IBVA 5FC8E 5CLCA 2Z5JA 3C5WA 4U54A 3VLEA 4RZPA 2NPPB 4FZFA 2W3CA 3BSXA 4G3AA 3QGBA 4I5LA 3K4EA 1EE5A 5SVZA 3Q0SA 3FGAA 5EKFA 3O2TA 3UKWB 2IWHA 3L3QA 5CL3A 3K49A 5BZ1A 4JW3C 4R0ZA 3JX7A 3NMWA 1Z2CB 5JJAA 3OUWA 4GMOA 4L4IA 4PLQA 2DB0A 4FP7A 1UN0A 3BCTA 5J3VA 4P6ZB 1IQ1C 3DW8A 1LSHA 4BA3A 3K5ZA 4U5UA 4XZRB 4CB8A 4I37A 4U5NA 4A0CA 5KLAA 1M5NS 3JY1A 5HUYC 2BNXA 2JKRB 1Q1SC 4HTVA 3TT9A 3QMLC 2IX3A 3PSPA 4IMIA 2Z6HA 3WOZA 3Q0NA 2JDQA 2NYMA 2VGLB 4I8MA 3OPBA 4FZDA 3BSBA 4EVTA 4P6ZG 2C1MA 4H3KA 3OQSA 2GL7A 5HUWC 4MZ6E 3K7WA 4ADYA 5B56A 4GMNA 4UWXA 4JW2B 3UJ4A
chains in the Genus database with same CATH topology
3H3DX 4I5NA 1JPPA 2XA7B 3GVTA 3C2HA 4HXTA 3L6YA 3V6YA 1HO8A 3EA5B 4L4HA 4CT7B 1UPKA 5SWFA 1QGKA 1G3JA 1UPLA 4DVGB 5KL8A 1EJYI 2NPPA 1LUJA 1QGRA 1Q1TC 3NOWA 4JKQA 4UQIB 4Y5JA 1I7WA 3Q0QA 4U5LA 3K7VA 3QGCA 3AU3A 2PF4A 2Z6GA 3GNIA 1BK5A 1BK6A 3GS3A 5CTTA 4B18A 4D49A 1EE4A 4CRVB 3BX3A 4FQ3A 1V18A 1W9CA 3TPMA 4DZSA 3VE6A 4TNMA 5DN7A 4CBAA 4CRUB 4I2ZA 5SW9A 3RZXA 2RU4B 1Y2AC 3Q0OA 5KL1A 4O27A 1M8WA 1M8ZA 5AEIA 4QMJA 2NYLB 2WTKA 4PLRA 1M8YA 3WYFC 4UAFB 4BQKA 1TE4A 2JKRA 3A6PA 3UKZB 5CL4A 2YNSA 3TJ3A 3TX7A 2IE3A 2YJYA 4U5OA 4MFVA 2Z5MA 4B8OA 5K6SA 3SL9A 2VGLA 1TH1A 2C1TA 4KZGA 3O2QA 3ZIPA 3BX2A 5CL8A 3FEYC 3DADA 3Q0RA 3OBVA 2QK1A 3EG5B 2X19B 4JW2A 5BZVA 4PVZA 4U58A 5KLTB 3K5QA 3C2GA 4K92A 3ZIOA 5EKGA 2XA7A 2Z5KA 4PLSA 3UL1B 5H2WA 4K6JA 2JAKA 4A3VA 4U2XD 4B8JA 1M8XA 3ZILA 5CL9A 3BWTA 5EWPA 4MZ5E 3L6XA 4LACA 3KNDA 4FDDA 4I0YA 1I7XA 3VLDA 2JKTB 3IFQA 1WA5C 4UQIA 4EV9A 4WV6A 3LWWA 4NZWA 4V3RA 1IBRB 4RV1A 2QK2A 2Z5NA 4IMJA 4JLQA 4DB6A 1O6OA 5E6QB 4QMIA 3UKXB 1XM9A 3ZINA 5BYMA 3SLAA 3TPOA 1QBKB 5CLDA 5CL5A 1PJMB 3O4XA 4D4EA 4YJLA 3FEXC 3K5YA 3GAEA 1QZ7A 1T08A 5BZUA 4UADA 2PKGA 3UVUA 4CT6B 4I2SA 4I1EA 4EVAA 3O2SA 3VWAA 4U5VA 3Q0MA 2RU4A 2OT8A 2Z5OA 3VLFA 4NEEA 4YJEA 4A3TA 4ZDUA 2NYLA 3WOYA 3OUXA 3GQ2A 5CL6A 4DBAA 4DB8A 3V71A 4I2WA 4EV8A 3EBBA 1W63B 4UAEA 1EJLI 3GVOA 1IB2A 1UKLA 3ZKVA 2IW3A 4YI0C 3ZIKA 3GB8A 4OIHA 2IAEB 3PSTA 3GRLA 2F31A 5LSWA 1F59A 3T7UA 5HHGE 2YNRA 4RXHB 3QHEA 3ZIRA 3K64A 4U5SA 1B3UA 3Q5UA 1M1EA 4I3NA 5KLRB 3NMZA 3RZ9A 4CB9A 2OF3A 3QG9A 3FGAB 5CLAA 2QMRA 1XQRA 2QNAA 3JXYA 4B8PA 3W3UA 4U3JC 3ODRA 1O6PA 3ODSA 2Q5DA 5H2XA 3WPTA 1WA5B 3TJZB 2JKTA 3UKYB 5CLEA 4OO6A 3Q0LA 3K61A 2P8QA 4CV5B 3BVSA 4H3HA 4DJSA 2BAPA 4FFBC 1OYZA 3LTMA 4BPLA 1LRVA 3LTJA 4I7IA 2H4MA 5K9SA 1JDHA 2FV2A 1JPWA 2BCTA 4E4VA 4R10A 3ZHPA 4QMHA 4V3QA 3BTRC 5KUBA 4FZAA 3ND2A 4DB9A 1XQSA 3UL0B 2IE4A 2NYMB 4I96A 3NMXA 4HNMA 3Q0PA 3L3FX 3K62A 5BZ5A 3JXZA 5D5KC 3V74A 1IALA 4V3OA 3ZIQA 5CLBA 2XOAA 1U6GC 4L7MA 5CL7A 2X1GF 1W63A 4YGXA 4R11A 1PJNB 1GCJA 4YK6A 4EVPA 4HM9A 4I6IA 4MFUA 2IAEA 3IBVA 5FC8E 5CLCA 2Z5JA 3C5WA 4U54A 3VLEA 4RZPA 2NPPB 4FZFA 2W3CA 3BSXA 4G3AA 3QGBA 4I5LA 3K4EA 1EE5A 5SVZA 3Q0SA 3FGAA 5EKFA 3O2TA 3UKWB 2IWHA 3L3QA 5CL3A 3K49A 5BZ1A 4JW3C 4R0ZA 3JX7A 3NMWA 1Z2CB 5JJAA 3OUWA 4GMOA 4L4IA 4PLQA 2DB0A 4FP7A 1UN0A 3BCTA 5J3VA 4P6ZB 1IQ1C 3DW8A 4BA3A 3K5ZA 4U5UA 4XZRB 4CB8A 4I37A 4U5NA 4A0CA 5KLAA 1M5NS 3JY1A 5HUYC 2BNXA 2JKRB 1Q1SC 4HTVA 3TT9A 3QMLC 2IX3A 3PSPA 4IMIA 2Z6HA 3WOZA 3Q0NA 2JDQA 2NYMA 2VGLB 4I8MA 3OPBA 4FZDA 3BSBA 4EVTA 4P6ZG 2C1MA 4H3KA 3OQSA 2GL7A 5HUWC 4MZ6E 3K7WA 4ADYA 5B56A 4GMNA 4UWXA 4JW2B 2BKUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3D X;  4I5N A;  1JPP A;  2XA7 B;  3GVT A;  3C2H A;  4HXT A;  3L6Y A;  3V6Y A;  1HO8 A;  3EA5 B;  4CT7 B;  1UPK A;  5SWF A;  1QGK A;  1G3J A;  1UPL A;  4DVG B;  5KL8 A;  1EJY I;  2NPP A;  1LUJ A;  1QGR A;  1Q1T C;  3NOW A;  4UQI B;  4Y5J A;  1I7W A;  3Q0Q A;  4U5L A;  3K7V A;  3QGC A;  3AU3 A;  2PF4 A;  2Z6G A;  3GNI A;  1BK5 A;  1BK6 A;  3GS3 A;  5CTT A;  4B18 A;  4D49 A;  1EE4 A;  4CRV B;  3BX3 A;  4FQ3 A;  1V18 A;  1W9C A;  3TPM A;  4DZS A;  3VE6 A;  4TNM A;  5DN7 A;  4CBA A;  4CRU B;  4I2Z A;  5SW9 A;  3RZX A;  2RU4 B;  1Y2A C;  3Q0O A;  5KL1 A;  4O27 A;  1M8W A;  1M8Z A;  5AEI A;  4QMJ A;  2NYL B;  2WTK A;  4PLR A;  1M8Y A;  3WYF C;  4UAF B;  4BQK A;  2JKR A;  3A6P A;  3UKZ B;  2YNS A;  3TJ3 A;  3TX7 A;  2IE3 A;  2YJY A;  4B8O A;  4MFV A;  2Z5M A;  4U5O A;  5K6S A;  2VGL A;  1TH1 A;  2C1T A;  4KZG A;  3ZIP A;  3O2Q A;  3BX2 A;  3FEY C;  3DAD A;  3Q0R A;  3OBV A;  2QK1 A;  3EG5 B;  2X19 B;  5BZV A;  4PVZ A;  4U58 A;  5KLT B;  3K5Q A;  3C2G A;  4K92 A;  3ZIO A;  5EKG A;  2XA7 A;  2Z5K A;  4PLS A;  3UL1 B;  5H2W A;  4K6J A;  2JAK A;  4B8J A;  1M8X A;  3BWT A;  5EWP A;  4MZ5 E;  3L6X A;  4LAC A;  3KND A;  4FDD A;  1I7X A;  2JKT B;  3IFQ A;  1WA5 C;  4UQI A;  4EV9 A;  4WV6 A;  3LWW A;  4NZW A;  4V3R A;  1IBR B;  4RV1 A;  2QK2 A;  2Z5N A;  4IMJ A;  4JLQ A;  4DB6 A;  1O6O A;  5E6Q B;  4QMI A;  3UKX B;  1XM9 A;  3ZIN A;  5BYM A;  3TPO A;  1QBK B;  1PJM B;  3O4X A;  4D4E A;  4YJL A;  3FEX C;  3K5Y A;  3GAE A;  1QZ7 A;  1T08 A;  5BZU A;  4UAD A;  2PKG A;  3UVU A;  4CT6 B;  4EVA A;  3O2S A;  3VWA A;  4U5V A;  3Q0M A;  2RU4 A;  2OT8 A;  2Z5O A;  4NEE A;  4YJE A;  4ZDU A;  2NYL A;  3WOY A;  3OUX A;  3GQ2 A;  4DBA A;  4DB8 A;  3V71 A;  4I2W A;  4EV8 A;  3EBB A;  1W63 B;  4UAE A;  1EJL I;  3GVO A;  1IB2 A;  1UKL A;  3ZKV A;  2IW3 A;  4YI0 C;  3GB8 A;  4OIH A;  2IAE B;  3PST A;  3GRL A;  2F31 A;  5LSW A;  1F59 A;  3T7U A;  5HHG E;  2YNR A;  4RXH B;  3QHE A;  3ZIR A;  3K64 A;  4U5S A;  1B3U A;  3Q5U A;  1M1E A;  5KLR B;  3NMZ A;  3RZ9 A;  4CB9 A;  2OF3 A;  3QG9 A;  3FGA B;  2QMR A;  1XQR A;  2QNA A;  4B8P A;  3W3U A;  4U3J C;  3ODR A;  1O6P A;  3ODS A;  2Q5D A;  5H2X A;  1WA5 B;  3WPT A;  3TJZ B;  2JKT A;  3UKY B;  4OO6 A;  3Q0L A;  3K61 A;  2P8Q A;  4CV5 B;  4H3H A;  4DJS A;  2BAP A;  4FFB C;  1OYZ A;  3LTM A;  4BPL A;  1LRV A;  3LTJ A;  2H4M A;  5K9S A;  1JDH A;  2FV2 A;  1JPW A;  2BCT A;  4E4V A;  4R10 A;  3ZHP A;  4QMH A;  4V3Q A;  3BTR C;  4FZA A;  3ND2 A;  4DB9 A;  1XQS A;  3UL0 B;  2IE4 A;  2NYM B;  3NMX A;  4HNM A;  3Q0P A;  3L3F X;  3K62 A;  5BZ5 A;  5D5K C;  3V74 A;  1IAL A;  4V3O A;  3ZIQ A;  1U6G C;  4L7M A;  2X1G F;  1W63 A;  4YGX A;  4R11 A;  1PJN B;  1GCJ A;  4YK6 A;  4EVP A;  4HM9 A;  4MFU A;  2IAE A;  3IBV A;  5FC8 E;  2Z5J A;  3C5W A;  4U54 A;  4RZP A;  2NPP B;  4FZF A;  2W3C A;  3BSX A;  4G3A A;  3QGB A;  4I5L A;  3K4E A;  1EE5 A;  5SVZ A;  3Q0S A;  3FGA A;  5EKF A;  3O2T A;  3UKW B;  2IWH A;  3L3Q A;  3K49 A;  5BZ1 A;  4R0Z A;  3NMW A;  1Z2C B;  5JJA A;  3OUW A;  4GMO A;  4PLQ A;  2DB0 A;  1UN0 A;  3BCT A;  5J3V A;  4P6Z B;  1IQ1 C;  3DW8 A;  4BA3 A;  3K5Z A;  4U5U A;  4XZR B;  4CB8 A;  4U5N A;  4A0C A;  5KLA A;  1M5N S;  5HUY C;  2BNX A;  2JKR B;  1Q1S C;  4HTV A;  3TT9 A;  3QML C;  2IX3 A;  3PSP A;  4IMI A;  2Z6H A;  3WOZ A;  3Q0N A;  2JDQ A;  2NYM A;  2VGL B;  3OPB A;  4FZD A;  3BSB A;  4EVT A;  4P6Z G;  2C1M A;  4H3K A;  3OQS A;  2GL7 A;  5HUW C;  4MZ6 E;  4ADY A;  3K7W A;  5B56 A;  4GMN A;  4UWX A;  4JW2 B;  2BKU B; 
#chains in the Genus database with same CATH topology
 3H3D X;  4I5N A;  1JPP A;  2XA7 B;  3GVT A;  3C2H A;  4HXT A;  3L6Y A;  3V6Y A;  1HO8 A;  3EA5 B;  4L4H A;  4CT7 B;  1UPK A;  5SWF A;  1QGK A;  1G3J A;  1UPL A;  4DVG B;  5KL8 A;  1EJY I;  2NPP A;  1LUJ A;  1QGR A;  1Q1T C;  3NOW A;  4JKQ A;  4UQI B;  4Y5J A;  1I7W A;  3Q0Q A;  4U5L A;  3K7V A;  3QGC A;  3AU3 A;  2PF4 A;  2Z6G A;  3GNI A;  1BK5 A;  1BK6 A;  3GS3 A;  5CTT A;  4B18 A;  4D49 A;  1EE4 A;  4CRV B;  3BX3 A;  4FQ3 A;  1V18 A;  1W9C A;  3TPM A;  4DZS A;  3VE6 A;  4TNM A;  5DN7 A;  2BKU B;  4CBA A;  4CRU B;  4I2Z A;  5SW9 A;  3RZX A;  2RU4 B;  1Y2A C;  3Q0O A;  5KL1 A;  4O27 A;  1M8W A;  1M8Z A;  5AEI A;  4QMJ A;  2NYL B;  2WTK A;  4PLR A;  1M8Y A;  3WYF C;  4UAF B;  4BQK A;  1TE4 A;  2JKR A;  3T8S A;  3A6P A;  3UKZ B;  5CL4 A;  2YNS A;  3TJ3 A;  3TX7 A;  2IE3 A;  2YJY A;  4U5O A;  4MFV A;  2Z5M A;  4B8O A;  5K6S A;  3SL9 A;  2VGL A;  1TH1 A;  2C1T A;  4KZG A;  3O2Q A;  3ZIP A;  3BX2 A;  5CL8 A;  3FEY C;  3DAD A;  3Q0R A;  3OBV A;  2QK1 A;  3EG5 B;  2X19 B;  4JW2 A;  5BZV A;  4PVZ A;  4U58 A;  5KLT B;  3K5Q A;  3C2G A;  4K92 A;  3ZIO A;  5EKG A;  2XA7 A;  2Z5K A;  4PLS A;  3UL1 B;  5H2W A;  4K6J A;  2JAK A;  4A3V A;  4U2X D;  4B8J A;  1M8X A;  3ZIL A;  5CL9 A;  3BWT A;  5EWP A;  4MZ5 E;  3L6X A;  4LAC A;  3KND A;  4FDD A;  4I0Y A;  1I7X A;  3VLD A;  2JKT B;  3IFQ A;  1WA5 C;  4UQI A;  4EV9 A;  4WV6 A;  3LWW A;  4NZW A;  4V3R A;  1IBR B;  4RV1 A;  2QK2 A;  2Z5N A;  4IMJ A;  4JLQ A;  4DB6 A;  1O6O A;  5E6Q B;  4QMI A;  3UKX B;  1XM9 A;  3ZIN A;  5BYM A;  3SLA A;  3TPO A;  1QBK B;  5CLD A;  5CL5 A;  1PJM B;  3O4X A;  4D4E A;  4YJL A;  3FEX C;  3K5Y A;  3GAE A;  1QZ7 A;  1T08 A;  5BZU A;  4UAD A;  2PKG A;  3UVU A;  4CT6 B;  4I2S A;  4I1E A;  4EVA A;  3O2S A;  3VWA A;  4U5V A;  3Q0M A;  2RU4 A;  2OT8 A;  2Z5O A;  3VLF A;  4NEE A;  4YJE A;  4A3T A;  4ZDU A;  2NYL A;  3UJ0 A;  3WOY A;  3OUX A;  3GQ2 A;  5CL6 A;  4DBA A;  4DB8 A;  3V71 A;  4I2W A;  4EV8 A;  3EBB A;  1W63 B;  4UAE A;  1EJL I;  3GVO A;  1IB2 A;  1UKL A;  3ZKV A;  2IW3 A;  4YI0 C;  3ZIK A;  3GB8 A;  4OIH A;  2IAE B;  3PST A;  3GRL A;  2F31 A;  5LSW A;  1F59 A;  3T7U A;  5HHG E;  2YNR A;  4RXH B;  3QHE A;  3ZIR A;  3K64 A;  4U5S A;  1B3U A;  3Q5U A;  1M1E A;  4I3N A;  5KLR B;  3NMZ A;  3RZ9 A;  4CB9 A;  2OF3 A;  3QG9 A;  3FGA B;  5CLA A;  2QMR A;  1XQR A;  2QNA A;  3JXY A;  4B8P A;  3W3U A;  4U3J C;  3ODR A;  1O6P A;  3ODS A;  2Q5D A;  5H2X A;  1WA5 B;  3WPT A;  3TJZ B;  2JKT A;  3UKY B;  5CLE A;  4OO6 A;  3Q0L A;  3K61 A;  1N4K A;  2P8Q A;  4CV5 B;  3BVS A;  4H3H A;  4DJS A;  2BAP A;  4FFB C;  1OYZ A;  3LTM A;  4BPL A;  1LRV A;  3LTJ A;  4I7I A;  2H4M A;  5K9S A;  1JDH A;  2FV2 A;  1JPW A;  2BCT A;  4E4V A;  4R10 A;  3ZHP A;  4QMH A;  4V3Q A;  3BTR C;  5KUB A;  4FZA A;  3ND2 A;  4DB9 A;  1XQS A;  3UL0 B;  2IE4 A;  2NYM B;  4I96 A;  3NMX A;  4HNM A;  3Q0P A;  3L3F X;  3K62 A;  5BZ5 A;  3JXZ A;  5D5K C;  3V74 A;  1IAL A;  4V3O A;  3ZIQ A;  5CLB A;  2XOA A;  1U6G C;  4L7M A;  5CL7 A;  2X1G F;  1W63 A;  4YGX A;  4R11 A;  1PJN B;  1GCJ A;  4YK6 A;  4EVP A;  4HM9 A;  4I6I A;  4MFU A;  2IAE A;  3IBV A;  5FC8 E;  5CLC A;  2Z5J A;  3C5W A;  4U54 A;  3VLE A;  4RZP A;  2NPP B;  4FZF A;  2W3C A;  3BSX A;  4G3A A;  3QGB A;  4I5L A;  3K4E A;  1EE5 A;  5SVZ A;  3Q0S A;  3FGA A;  5EKF A;  3O2T A;  3UKW B;  2IWH A;  3L3Q A;  5CL3 A;  3K49 A;  5BZ1 A;  4JW3 C;  4R0Z A;  3JX7 A;  3NMW A;  1Z2C B;  5JJA A;  3OUW A;  4GMO A;  4L4I A;  4PLQ A;  2DB0 A;  4FP7 A;  1UN0 A;  3BCT A;  5J3V A;  4P6Z B;  1IQ1 C;  3DW8 A;  1LSH A;  4BA3 A;  3K5Z A;  4U5U A;  4XZR B;  4CB8 A;  4I37 A;  4U5N A;  4A0C A;  5KLA A;  1M5N S;  3JY1 A;  5HUY C;  2BNX A;  2JKR B;  1Q1S C;  4HTV A;  3TT9 A;  3QML C;  2IX3 A;  3PSP A;  4IMI A;  2Z6H A;  3WOZ A;  3Q0N A;  2JDQ A;  2NYM A;  2VGL B;  4I8M A;  3OPB A;  4FZD A;  3BSB A;  4EVT A;  4P6Z G;  2C1M A;  4H3K A;  3OQS A;  2GL7 A;  5HUW C;  4MZ6 E;  3K7W A;  4ADY A;  5B56 A;  4GMN A;  4UWX A;  4JW2 B;  3UJ4 A; 
#chains in the Genus database with same CATH homology
 3H3D X;  4I5N A;  1JPP A;  2XA7 B;  3GVT A;  3C2H A;  4HXT A;  3L6Y A;  3V6Y A;  1HO8 A;  3EA5 B;  4L4H A;  4CT7 B;  1UPK A;  5SWF A;  1QGK A;  1G3J A;  1UPL A;  4DVG B;  5KL8 A;  1EJY I;  2NPP A;  1LUJ A;  1QGR A;  1Q1T C;  3NOW A;  4JKQ A;  4UQI B;  4Y5J A;  1I7W A;  3Q0Q A;  4U5L A;  3K7V A;  3QGC A;  3AU3 A;  2PF4 A;  2Z6G A;  3GNI A;  1BK5 A;  1BK6 A;  3GS3 A;  5CTT A;  4B18 A;  4D49 A;  1EE4 A;  4CRV B;  3BX3 A;  4FQ3 A;  1V18 A;  1W9C A;  3TPM A;  4DZS A;  3VE6 A;  4TNM A;  5DN7 A;  4CBA A;  4CRU B;  4I2Z A;  5SW9 A;  3RZX A;  2RU4 B;  1Y2A C;  3Q0O A;  5KL1 A;  4O27 A;  1M8W A;  1M8Z A;  5AEI A;  4QMJ A;  2NYL B;  2WTK A;  4PLR A;  1M8Y A;  3WYF C;  4UAF B;  4BQK A;  1TE4 A;  2JKR A;  3A6P A;  3UKZ B;  5CL4 A;  2YNS A;  3TJ3 A;  3TX7 A;  2IE3 A;  2YJY A;  4U5O A;  4MFV A;  2Z5M A;  4B8O A;  5K6S A;  3SL9 A;  2VGL A;  1TH1 A;  2C1T A;  4KZG A;  3O2Q A;  3ZIP A;  3BX2 A;  5CL8 A;  3FEY C;  3DAD A;  3Q0R A;  3OBV A;  2QK1 A;  3EG5 B;  2X19 B;  4JW2 A;  5BZV A;  4PVZ A;  4U58 A;  5KLT B;  3K5Q A;  3C2G A;  4K92 A;  3ZIO A;  5EKG A;  2XA7 A;  2Z5K A;  4PLS A;  3UL1 B;  5H2W A;  4K6J A;  2JAK A;  4A3V A;  4U2X D;  4B8J A;  1M8X A;  3ZIL A;  5CL9 A;  3BWT A;  5EWP A;  4MZ5 E;  3L6X A;  4LAC A;  3KND A;  4FDD A;  4I0Y A;  1I7X A;  3VLD A;  2JKT B;  3IFQ A;  1WA5 C;  4UQI A;  4EV9 A;  4WV6 A;  3LWW A;  4NZW A;  4V3R A;  1IBR B;  4RV1 A;  2QK2 A;  2Z5N A;  4IMJ A;  4JLQ A;  4DB6 A;  1O6O A;  5E6Q B;  4QMI A;  3UKX B;  1XM9 A;  3ZIN A;  5BYM A;  3SLA A;  3TPO A;  1QBK B;  5CLD A;  5CL5 A;  1PJM B;  3O4X A;  4D4E A;  4YJL A;  3FEX C;  3K5Y A;  3GAE A;  1QZ7 A;  1T08 A;  5BZU A;  4UAD A;  2PKG A;  3UVU A;  4CT6 B;  4I2S A;  4I1E A;  4EVA A;  3O2S A;  3VWA A;  4U5V A;  3Q0M A;  2RU4 A;  2OT8 A;  2Z5O A;  3VLF A;  4NEE A;  4YJE A;  4A3T A;  4ZDU A;  2NYL A;  3WOY A;  3OUX A;  3GQ2 A;  5CL6 A;  4DBA A;  4DB8 A;  3V71 A;  4I2W A;  4EV8 A;  3EBB A;  1W63 B;  4UAE A;  1EJL I;  3GVO A;  1IB2 A;  1UKL A;  3ZKV A;  2IW3 A;  4YI0 C;  3ZIK A;  3GB8 A;  4OIH A;  2IAE B;  3PST A;  3GRL A;  2F31 A;  5LSW A;  1F59 A;  3T7U A;  5HHG E;  2YNR A;  4RXH B;  3QHE A;  3ZIR A;  3K64 A;  4U5S A;  1B3U A;  3Q5U A;  1M1E A;  4I3N A;  5KLR B;  3NMZ A;  3RZ9 A;  4CB9 A;  2OF3 A;  3QG9 A;  3FGA B;  5CLA A;  2QMR A;  1XQR A;  2QNA A;  3JXY A;  4B8P A;  3W3U A;  4U3J C;  3ODR A;  1O6P A;  3ODS A;  2Q5D A;  5H2X A;  3WPT A;  1WA5 B;  3TJZ B;  2JKT A;  3UKY B;  5CLE A;  4OO6 A;  3Q0L A;  3K61 A;  2P8Q A;  4CV5 B;  3BVS A;  4H3H A;  4DJS A;  2BAP A;  4FFB C;  1OYZ A;  3LTM A;  4BPL A;  1LRV A;  3LTJ A;  4I7I A;  2H4M A;  5K9S A;  1JDH A;  2FV2 A;  1JPW A;  2BCT A;  4E4V A;  4R10 A;  3ZHP A;  4QMH A;  4V3Q A;  3BTR C;  5KUB A;  4FZA A;  3ND2 A;  4DB9 A;  1XQS A;  3UL0 B;  2IE4 A;  2NYM B;  4I96 A;  3NMX A;  4HNM A;  3Q0P A;  3L3F X;  3K62 A;  5BZ5 A;  3JXZ A;  5D5K C;  3V74 A;  1IAL A;  4V3O A;  3ZIQ A;  5CLB A;  2XOA A;  1U6G C;  4L7M A;  5CL7 A;  2X1G F;  1W63 A;  4YGX A;  4R11 A;  1PJN B;  1GCJ A;  4YK6 A;  4EVP A;  4HM9 A;  4I6I A;  4MFU A;  2IAE A;  3IBV A;  5FC8 E;  5CLC A;  2Z5J A;  3C5W A;  4U54 A;  3VLE A;  4RZP A;  2NPP B;  4FZF A;  2W3C A;  3BSX A;  4G3A A;  3QGB A;  4I5L A;  3K4E A;  1EE5 A;  5SVZ A;  3Q0S A;  3FGA A;  5EKF A;  3O2T A;  3UKW B;  2IWH A;  3L3Q A;  5CL3 A;  3K49 A;  5BZ1 A;  4JW3 C;  4R0Z A;  3JX7 A;  3NMW A;  1Z2C B;  5JJA A;  3OUW A;  4GMO A;  4L4I A;  4PLQ A;  2DB0 A;  4FP7 A;  1UN0 A;  3BCT A;  5J3V A;  4P6Z B;  1IQ1 C;  3DW8 A;  4BA3 A;  3K5Z A;  4U5U A;  4XZR B;  4CB8 A;  4I37 A;  4U5N A;  4A0C A;  5KLA A;  1M5N S;  3JY1 A;  5HUY C;  2BNX A;  2JKR B;  1Q1S C;  4HTV A;  3TT9 A;  3QML C;  2IX3 A;  3PSP A;  4IMI A;  2Z6H A;  3WOZ A;  3Q0N A;  2JDQ A;  2NYM A;  2VGL B;  4I8M A;  3OPB A;  4FZD A;  3BSB A;  4EVT A;  4P6Z G;  2C1M A;  4H3K A;  3OQS A;  2GL7 A;  5HUW C;  4MZ6 E;  3K7W A;  4ADY A;  5B56 A;  4GMN A;  4UWX A;  4JW2 B;  2BKU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...