2RU4B

Designed armadillo repeat protein self-assembled complex (yiim2-maii)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
84
structure length
84
Chain Sequence
GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Armadillo Repeat Protein, N-terminal fragment, YIIM2
publication title Spontaneous self-assembly of engineered armadillo repeat protein fragments into a folded structure
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 32
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2013-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 2ru4B00
2YNSA 1BK5A 1M8YA 3L3QA 3OUXA 5EWPA 3GRLA 3QG9A 3QGCA 4UADA 4UQIA 2IE3A 3GVOA 1M8WA 1I7WA 1O6PA 2W3CA 5HUYC 1I7XA 4P6ZG 1XQRA 4L7MA 5K9SA 3BX3A 4FZAA 3K62A 1XM9A 2RU4B 2QMRA 2IAEA 3O2QA 3WOYA 4B8PA 1O6OA 2BNXA 3UKYB 2PKGA 4R10A 3K49A 3BSXA 3FGAB 2NPPB 3LTJA 4CB9A 1TH1A 5BZVA 2GL7A 3NMWA 4CV5B 4HTVA 4U5LA 5LSWA 4IMIA 3WOZA 5SVZA 3IBVA 1W63A 2VGLA 3BCTA 4D4EA 3WYFC 4HM9A 1HO8A 4G3AA 4R11A 3ZINA 4U5SA 4R0ZA 2JDQA 4YGXA 1JPWA 4I2WA 3K61A 3ZHPA 1Q1SC 4QMIA 4EVPA 3QGBA 4FFBC 4CT7B 1M5NS 1EJLI 4D49A 4DZSA 4WV6A 3DW8A 1F59A 3NMZA 3ND2A 4EVAA 4E4VA 5H2XA 3VE6A 1UKLA 5HUWC 3Q0NA 4LACA 3ZKVA 4U5NA 5E6QB 3L6YA 4B8OA 3Q0QA 1JDHA 4BQKA 4HNMA 2P8QA 3PSTA 3QMLC 4CT6B 3GAEA 1Q1TC 5BZ5A 4CB8A 1IB2A 1B3UA 3L3FX 3OPBA 4EV9A 3TJ3A 4TNMA 2C1MA 3GB8A 4NEEA 1WA5B 3ODSA 4CRVB 3AU3A 5CTTA 2H4MA 3K5YA 3V74A 1BK6A 4GMNA 4IMJA 3KNDA 2FV2A 3UVUA 1W9CA 4K92A 3EG5B 3QHEA 3FEXC 3IFQA 4MFUA 2JKRA 3O2SA 4EV8A 3FEYC 3GVTA 3C2HA 5SW9A 3K7VA 5BYMA 3K4EA 3A6PA 3Q0MA 2XA7A 2QK1A 2Z5OA 5K6SA 3ZIQA 2Z5MA 5D5KC 4H3KA 4ZDUA 1WA5C 4BPLA 3DADA 5KLRB 4YI0C 2JKTB 2Z5JA 4I5LA 5KLTB 4DBAA 3ZIRA 2NYLB 4I5NA 2DB0A 4FDDA 2OT8A 4JW2B 4P6ZB 5FC8E 2BCTA 4CRUB 4U5OA 3BTRC 5J3VA 4UQIB 4DJSA 2BAPA 4UAFB 1LUJA 4NZWA 3RZXA 4PVZA 5DN7A 3GNIA 4Y5JA 5H2WA 4H3HA 4DB9A 3Q0RA 4V3RA 2QNAA 4JLQA 3TX7A 2X19B 3K64A 3Q0LA 4A0CA 2OF3A 2IWHA 5EKFA 3K5QA 3VWAA 3RZ9A 2RU4A 4I2ZA 5KL8A 3UL1B 4MFVA 5SWFA 3OBVA 4B8JA 3O4XA 5EKGA 4ADYA 1W63B 2VGLB 1PJNB 3L6XA 1GCJA 1T08A 1UPLA 3FGAA 2X1GF 3EA5B 1QZ7A 2NPPA 3LTMA 5KL1A 4PLSA 3TPOA 2YJYA 5BZUA 4BA3A 3Q0OA 4B18A 1Z2CB 2JKTA 4V3OA 1EE4A 2Z5KA 4RZPA 2Q5DA 4XZRB 3GQ2A 3NMXA 4YJLA 1QGRA 5JJAA 1Y2AC 4U5UA 4OO6A 1OYZA 2IW3A 2NYMB 3K5ZA 2C1TA 3UKWB 3K7WA 2F31A 3C2GA 3ODRA 4UWXA 1IQ1C 4FZFA 4UAEA 1LRVA 2BKUB 4MZ6E 1UN0A 3Q0SA 3OUWA 4K6JA 3UKXB 3H3DX 2QK2A 5AEIA 3PSPA 2Z6HA 3TT9A 2JAKA 4CBAA 3Q5UA 4U5VA 4KZGA 1G3JA 4OIHA 1PJMB 4GMOA 4FQ3A 1U6GC 4QMJA 1IBRB 3BWTA 1QGKA 4MZ5E 5HHGE 3T7UA 5BZ1A 1EJYI 2WTKA 1JPPA 3EBBA 3V71A 3V6YA 3WPTA 2JKRB 4FZDA 1M8ZA 4PLQA 3C5WA 1M8XA 1XQSA 2IAEB 4HXTA 3BSBA 3UKZB 3OQSA 4YK6A 1IALA 1QBKB 2XA7B 2PF4A 4DVGB 5KLAA 4O27A 3ZIPA 3W3UA 5B56A 2Z5NA 4DB8A 4U54A 4QMHA 4EVTA 3O2TA 3LWWA 3ZIOA 2NYMA 2Z6GA 3Q0PA 4YJEA 1M1EA 3BX2A 4RV1A 2IX3A 4RXHB 3UL0B 2IE4A 3NOWA 3TJZB 4U58A 2YNRA 4PLRA 4U3JC 4V3QA 2NYLA 3GS3A 3TPMA 4DB6A 1EE5A 1V18A 1UPKA
chains in the Genus database with same CATH superfamily
2YNSA 1BK5A 1M8YA 3L3QA 3OUXA 5EWPA 3GRLA 3QG9A 3QGCA 4UADA 4UQIA 4I2SA 2IE3A 3GVOA 1M8WA 1I7WA 1O6PA 4I6IA 2W3CA 5HUYC 1I7XA 4P6ZG 1XQRA 4L7MA 5CL8A 5K9SA 3BX3A 4FZAA 3K62A 1XM9A 2RU4B 2QMRA 2IAEA 4FP7A 3O2QA 3WOYA 4B8PA 1O6OA 2BNXA 3UKYB 2PKGA 4R10A 3K49A 3BSXA 3FGAB 2NPPB 3LTJA 3VLDA 4CB9A 1TH1A 5BZVA 2GL7A 4U2XD 3NMWA 4CV5B 4HTVA 4U5LA 5LSWA 4IMIA 3WOZA 5SVZA 3IBVA 1W63A 2VGLA 3BCTA 4D4EA 3WYFC 4HM9A 1HO8A 3JXZA 4G3AA 4R11A 3ZINA 4U5SA 4R0ZA 2JDQA 4YGXA 2XOAA 1JPWA 4I2WA 3K61A 5KUBA 3ZHPA 1Q1SC 4QMIA 4EVPA 3QGBA 4FFBC 3UJ0A 3T8SA 4I7IA 4CT7B 1TE4A 1M5NS 1EJLI 4D49A 5CLAA 5CLDA 3ZILA 4DZSA 4WV6A 3DW8A 1F59A 3NMZA 3ND2A 4EVAA 4E4VA 3ZIKA 5H2XA 3VE6A 1UKLA 5HUWC 3Q0NA 4LACA 3ZKVA 4U5NA 5E6QB 3L6YA 4B8OA 3Q0QA 3JX7A 1JDHA 4BQKA 5CL6A 4HNMA 2P8QA 3PSTA 3QMLC 4CT6B 3GAEA 1Q1TC 5BZ5A 4CB8A 1IB2A 1B3UA 3L3FX 3OPBA 4EV9A 3TJ3A 4TNMA 2C1MA 3GB8A 4NEEA 1WA5B 3ODSA 4CRVB 3AU3A 5CTTA 2H4MA 3K5YA 3V74A 1BK6A 4GMNA 4I1EA 4IMJA 4I0YA 3KNDA 2FV2A 3UVUA 1W9CA 4K92A 3EG5B 3QHEA 3FEXC 3IFQA 4MFUA 2JKRA 3O2SA 4EV8A 3FEYC 3GVTA 3C2HA 5SW9A 3K7VA 5BYMA 3K4EA 3A6PA 3Q0MA 2XA7A 2QK1A 2Z5OA 5K6SA 3ZIQA 2Z5MA 5D5KC 4H3KA 4ZDUA 1WA5C 4BPLA 5CLCA 3DADA 5KLRB 5CLEA 4YI0C 2JKTB 2Z5JA 4I5LA 5KLTB 4DBAA 3ZIRA 2NYLB 4I5NA 2DB0A 4I96A 4FDDA 2OT8A 4JW2B 4P6ZB 5FC8E 2BCTA 4CRUB 4U5OA 3BTRC 5J3VA 4JKQA 4UQIB 4DJSA 2BAPA 4UAFB 1LUJA 4NZWA 3VLFA 3RZXA 4PVZA 5DN7A 3GNIA 5CLBA 3SL9A 4Y5JA 5H2WA 4H3HA 4L4IA 4DB9A 3Q0RA 4V3RA 2QNAA 4JLQA 3TX7A 2X19B 3K64A 3Q0LA 4A0CA 2OF3A 2IWHA 5EKFA 3K5QA 3VWAA 3RZ9A 2RU4A 4I2ZA 5KL8A 3UL1B 4MFVA 5SWFA 3OBVA 4B8JA 5CL5A 3O4XA 4A3TA 5EKGA 4ADYA 1W63B 2VGLB 4JW3C 1PJNB 3L6XA 1GCJA 1T08A 1N4KA 1UPLA 3FGAA 2X1GF 3EA5B 5CL9A 1QZ7A 2NPPA 1LSHA 3LTMA 5KL1A 4PLSA 3TPOA 2YJYA 5BZUA 4BA3A 4I8MA 4L4HA 3Q0OA 4A3VA 4B18A 1Z2CB 2JKTA 4V3OA 1EE4A 2Z5KA 4RZPA 2Q5DA 4XZRB 3GQ2A 3NMXA 4YJLA 1QGRA 4I3NA 5JJAA 1Y2AC 4U5UA 4OO6A 1OYZA 2IW3A 2NYMB 3K5ZA 4I37A 2C1TA 3UKWB 3K7WA 2F31A 3C2GA 3ODRA 4UWXA 1IQ1C 4FZFA 4UAEA 1LRVA 2BKUB 4MZ6E 1UN0A 3Q0SA 3OUWA 4K6JA 3UKXB 3VLEA 3H3DX 2QK2A 5AEIA 3PSPA 2Z6HA 3TT9A 2JAKA 4CBAA 3Q5UA 4U5VA 3JXYA 4KZGA 1G3JA 4OIHA 1PJMB 4GMOA 4FQ3A 1U6GC 4QMJA 1IBRB 3BWTA 1QGKA 4MZ5E 5HHGE 3T7UA 5BZ1A 1EJYI 2WTKA 1JPPA 5CL4A 3EBBA 3V71A 3SLAA 3V6YA 3WPTA 2JKRB 5CL7A 4FZDA 1M8ZA 4PLQA 3C5WA 1M8XA 1XQSA 2IAEB 4HXTA 3BSBA 3UKZB 3OQSA 4YK6A 1IALA 1QBKB 2XA7B 2PF4A 3JY1A 4DVGB 5KLAA 4O27A 3ZIPA 5CL3A 3W3UA 5B56A 2Z5NA 4DB8A 4U54A 4QMHA 4EVTA 3O2TA 3UJ4A 3LWWA 3ZIOA 2NYMA 2Z6GA 3Q0PA 4YJEA 1M1EA 3BX2A 4RV1A 2IX3A 4RXHB 3UL0B 2IE4A 3NOWA 3TJZB 3BVSA 4U58A 2YNRA 4PLRA 4U3JC 4V3QA 2NYLA 3GS3A 3TPMA 4DB6A 1EE5A 1V18A 1UPKA 4JW2A
chains in the Genus database with same CATH topology
2YNSA 1BK5A 1M8YA 3L3QA 3OUXA 5EWPA 3GRLA 3QG9A 3QGCA 4UADA 4UQIA 4I2SA 2IE3A 3GVOA 1M8WA 1I7WA 1O6PA 4I6IA 2W3CA 5HUYC 1I7XA 4P6ZG 1XQRA 4L7MA 5CL8A 5K9SA 3BX3A 4FZAA 3K62A 1XM9A 2RU4B 2QMRA 2IAEA 4FP7A 3O2QA 3WOYA 4B8PA 1O6OA 2BNXA 3UKYB 2PKGA 4R10A 3K49A 3BSXA 3FGAB 2NPPB 3LTJA 3VLDA 4CB9A 1TH1A 5BZVA 2GL7A 4U2XD 3NMWA 4CV5B 4HTVA 4U5LA 5LSWA 4IMIA 3WOZA 5SVZA 3IBVA 1W63A 2VGLA 3BCTA 4D4EA 3WYFC 4HM9A 1HO8A 3JXZA 4G3AA 4R11A 3ZINA 4U5SA 4R0ZA 2JDQA 4YGXA 2XOAA 1JPWA 4I2WA 3K61A 5KUBA 3ZHPA 1Q1SC 4QMIA 4EVPA 3QGBA 4FFBC 4I7IA 4CT7B 1TE4A 1M5NS 1EJLI 4D49A 5CLAA 5CLDA 3ZILA 4DZSA 4WV6A 3DW8A 1F59A 3NMZA 3ND2A 4EVAA 4E4VA 3ZIKA 5H2XA 3VE6A 1UKLA 5HUWC 3Q0NA 4LACA 3ZKVA 4U5NA 5E6QB 3L6YA 4B8OA 3Q0QA 3JX7A 1JDHA 4BQKA 5CL6A 4HNMA 2P8QA 3PSTA 3QMLC 4CT6B 3GAEA 1Q1TC 5BZ5A 4CB8A 1IB2A 1B3UA 3L3FX 3OPBA 4EV9A 3TJ3A 4TNMA 2C1MA 3GB8A 4NEEA 1WA5B 3ODSA 4CRVB 3AU3A 5CTTA 2H4MA 3K5YA 3V74A 1BK6A 4GMNA 4I1EA 4IMJA 4I0YA 3KNDA 2FV2A 3UVUA 1W9CA 4K92A 3EG5B 3QHEA 3FEXC 3IFQA 4MFUA 2JKRA 3O2SA 4EV8A 3FEYC 3GVTA 3C2HA 5SW9A 3K7VA 5BYMA 3K4EA 3A6PA 3Q0MA 2XA7A 2QK1A 2Z5OA 5K6SA 3ZIQA 2Z5MA 5D5KC 4H3KA 4ZDUA 1WA5C 4BPLA 5CLCA 3DADA 5KLRB 5CLEA 4YI0C 2JKTB 2Z5JA 4I5LA 5KLTB 4DBAA 3ZIRA 2NYLB 4I5NA 2DB0A 4I96A 4FDDA 2OT8A 4JW2B 4P6ZB 5FC8E 2BCTA 4CRUB 4U5OA 3BTRC 5J3VA 4JKQA 4UQIB 4DJSA 2BAPA 4UAFB 1LUJA 4NZWA 3VLFA 3RZXA 4PVZA 5DN7A 3GNIA 5CLBA 3SL9A 4Y5JA 5H2WA 4H3HA 4L4IA 4DB9A 3Q0RA 4V3RA 2QNAA 4JLQA 3TX7A 2X19B 3K64A 3Q0LA 4A0CA 2OF3A 2IWHA 5EKFA 3K5QA 3VWAA 3RZ9A 2RU4A 4I2ZA 5KL8A 3UL1B 4MFVA 5SWFA 3OBVA 4B8JA 5CL5A 3O4XA 4A3TA 5EKGA 4ADYA 1W63B 2VGLB 4JW3C 1PJNB 3L6XA 1GCJA 1T08A 1UPLA 3FGAA 2X1GF 3EA5B 5CL9A 1QZ7A 2NPPA 3LTMA 5KL1A 4PLSA 3TPOA 2YJYA 5BZUA 4BA3A 4I8MA 4L4HA 3Q0OA 4A3VA 4B18A 1Z2CB 2JKTA 4V3OA 1EE4A 2Z5KA 4RZPA 2Q5DA 4XZRB 3GQ2A 3NMXA 4YJLA 1QGRA 4I3NA 5JJAA 1Y2AC 4U5UA 4OO6A 1OYZA 2IW3A 2NYMB 3K5ZA 4I37A 2C1TA 3UKWB 3K7WA 2F31A 3C2GA 3ODRA 4UWXA 1IQ1C 4FZFA 4UAEA 1LRVA 2BKUB 4MZ6E 1UN0A 3Q0SA 3OUWA 4K6JA 3UKXB 3VLEA 3H3DX 2QK2A 5AEIA 3PSPA 2Z6HA 3TT9A 2JAKA 4CBAA 3Q5UA 4U5VA 3JXYA 4KZGA 1G3JA 4OIHA 1PJMB 4GMOA 4FQ3A 1U6GC 4QMJA 1IBRB 3BWTA 1QGKA 4MZ5E 5HHGE 3T7UA 5BZ1A 1EJYI 2WTKA 1JPPA 5CL4A 3EBBA 3V71A 3SLAA 3V6YA 3WPTA 2JKRB 5CL7A 4FZDA 1M8ZA 4PLQA 3C5WA 1M8XA 1XQSA 2IAEB 4HXTA 3BSBA 3UKZB 3OQSA 4YK6A 1IALA 1QBKB 2XA7B 2PF4A 3JY1A 4DVGB 5KLAA 4O27A 3ZIPA 5CL3A 3W3UA 5B56A 2Z5NA 4DB8A 4U54A 4QMHA 4EVTA 3O2TA 3LWWA 3ZIOA 2NYMA 2Z6GA 3Q0PA 4YJEA 1M1EA 3BX2A 4RV1A 2IX3A 4RXHB 3UL0B 2IE4A 3NOWA 3TJZB 3BVSA 4U58A 2YNRA 4PLRA 4U3JC 4V3QA 2NYLA 3GS3A 3TPMA 4DB6A 1EE5A 1V18A 1UPKA 4JW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNS A;  1BK5 A;  1M8Y A;  3L3Q A;  3OUX A;  5EWP A;  3GRL A;  3QG9 A;  3QGC A;  4UAD A;  4UQI A;  2IE3 A;  3GVO A;  1M8W A;  1I7W A;  1O6P A;  2W3C A;  5HUY C;  1I7X A;  4P6Z G;  1XQR A;  4L7M A;  5K9S A;  3BX3 A;  4FZA A;  3K62 A;  1XM9 A;  2RU4 B;  2QMR A;  2IAE A;  3O2Q A;  3WOY A;  4B8P A;  1O6O A;  2BNX A;  3UKY B;  2PKG A;  4R10 A;  3K49 A;  3BSX A;  3FGA B;  2NPP B;  3LTJ A;  4CB9 A;  1TH1 A;  5BZV A;  2GL7 A;  3NMW A;  4CV5 B;  4HTV A;  4U5L A;  5LSW A;  4IMI A;  3WOZ A;  5SVZ A;  3IBV A;  1W63 A;  2VGL A;  3BCT A;  4D4E A;  3WYF C;  4HM9 A;  1HO8 A;  4G3A A;  4R11 A;  3ZIN A;  4U5S A;  4R0Z A;  2JDQ A;  4YGX A;  1JPW A;  4I2W A;  3K61 A;  3ZHP A;  1Q1S C;  4QMI A;  4EVP A;  3QGB A;  4FFB C;  4CT7 B;  1M5N S;  1EJL I;  4D49 A;  4DZS A;  4WV6 A;  3DW8 A;  1F59 A;  3NMZ A;  3ND2 A;  4EVA A;  4E4V A;  5H2X A;  3VE6 A;  1UKL A;  5HUW C;  3Q0N A;  4LAC A;  3ZKV A;  4U5N A;  5E6Q B;  3L6Y A;  4B8O A;  3Q0Q A;  1JDH A;  4BQK A;  4HNM A;  2P8Q A;  3PST A;  3QML C;  4CT6 B;  3GAE A;  1Q1T C;  5BZ5 A;  4CB8 A;  1IB2 A;  1B3U A;  3L3F X;  3OPB A;  4EV9 A;  3TJ3 A;  4TNM A;  2C1M A;  3GB8 A;  4NEE A;  1WA5 B;  3ODS A;  4CRV B;  3AU3 A;  5CTT A;  2H4M A;  3K5Y A;  3V74 A;  1BK6 A;  4GMN A;  4IMJ A;  3KND A;  2FV2 A;  3UVU A;  1W9C A;  4K92 A;  3EG5 B;  3QHE A;  3FEX C;  3IFQ A;  4MFU A;  2JKR A;  3O2S A;  4EV8 A;  3FEY C;  3GVT A;  3C2H A;  5SW9 A;  3K7V A;  5BYM A;  3K4E A;  3A6P A;  3Q0M A;  2XA7 A;  2QK1 A;  2Z5O A;  5K6S A;  3ZIQ A;  2Z5M A;  5D5K C;  4H3K A;  4ZDU A;  1WA5 C;  4BPL A;  3DAD A;  5KLR B;  4YI0 C;  2JKT B;  2Z5J A;  4I5L A;  5KLT B;  4DBA A;  3ZIR A;  2NYL B;  4I5N A;  2DB0 A;  4FDD A;  2OT8 A;  4JW2 B;  4P6Z B;  5FC8 E;  2BCT A;  4CRU B;  4U5O A;  3BTR C;  5J3V A;  4UQI B;  4DJS A;  2BAP A;  4UAF B;  1LUJ A;  4NZW A;  3RZX A;  4PVZ A;  5DN7 A;  3GNI A;  4Y5J A;  5H2W A;  4H3H A;  4DB9 A;  3Q0R A;  4V3R A;  2QNA A;  4JLQ A;  3TX7 A;  2X19 B;  3K64 A;  3Q0L A;  4A0C A;  2OF3 A;  2IWH A;  5EKF A;  3K5Q A;  3VWA A;  3RZ9 A;  2RU4 A;  4I2Z A;  5KL8 A;  3UL1 B;  4MFV A;  5SWF A;  3OBV A;  4B8J A;  3O4X A;  5EKG A;  4ADY A;  1W63 B;  2VGL B;  1PJN B;  3L6X A;  1GCJ A;  1T08 A;  1UPL A;  3FGA A;  2X1G F;  3EA5 B;  1QZ7 A;  2NPP A;  3LTM A;  5KL1 A;  4PLS A;  3TPO A;  2YJY A;  5BZU A;  4BA3 A;  3Q0O A;  4B18 A;  1Z2C B;  2JKT A;  4V3O A;  1EE4 A;  2Z5K A;  4RZP A;  2Q5D A;  4XZR B;  3GQ2 A;  3NMX A;  4YJL A;  1QGR A;  5JJA A;  1Y2A C;  4U5U A;  4OO6 A;  1OYZ A;  2IW3 A;  2NYM B;  3K5Z A;  2C1T A;  3UKW B;  3K7W A;  2F31 A;  3C2G A;  3ODR A;  4UWX A;  1IQ1 C;  4FZF A;  4UAE A;  1LRV A;  2BKU B;  4MZ6 E;  1UN0 A;  3Q0S A;  3OUW A;  4K6J A;  3UKX B;  3H3D X;  2QK2 A;  5AEI A;  3PSP A;  2Z6H A;  3TT9 A;  2JAK A;  4CBA A;  3Q5U A;  4U5V A;  4KZG A;  1G3J A;  4OIH A;  1PJM B;  4GMO A;  4FQ3 A;  1U6G C;  4QMJ A;  1IBR B;  3BWT A;  1QGK A;  4MZ5 E;  5HHG E;  3T7U A;  5BZ1 A;  1EJY I;  2WTK A;  1JPP A;  3EBB A;  3V71 A;  3V6Y A;  3WPT A;  2JKR B;  4FZD A;  1M8Z A;  4PLQ A;  3C5W A;  1M8X A;  1XQS A;  2IAE B;  4HXT A;  3BSB A;  3UKZ B;  3OQS A;  4YK6 A;  1IAL A;  1QBK B;  2XA7 B;  2PF4 A;  4DVG B;  5KLA A;  4O27 A;  3ZIP A;  3W3U A;  5B56 A;  2Z5N A;  4DB8 A;  4U54 A;  4QMH A;  4EVT A;  3O2T A;  3LWW A;  3ZIO A;  2NYM A;  2Z6G A;  3Q0P A;  4YJE A;  1M1E A;  3BX2 A;  4RV1 A;  2IX3 A;  4RXH B;  3UL0 B;  2IE4 A;  3NOW A;  3TJZ B;  4U58 A;  2YNR A;  4PLR A;  4U3J C;  4V3Q A;  2NYL A;  3GS3 A;  3TPM A;  4DB6 A;  1EE5 A;  1V18 A;  1UPK A; 
#chains in the Genus database with same CATH topology
 2YNS A;  1BK5 A;  1M8Y A;  3L3Q A;  3OUX A;  5EWP A;  3GRL A;  3QG9 A;  3QGC A;  4UAD A;  4UQI A;  4I2S A;  2IE3 A;  3GVO A;  1M8W A;  1I7W A;  1O6P A;  4I6I A;  2W3C A;  5HUY C;  1I7X A;  4P6Z G;  1XQR A;  4L7M A;  5CL8 A;  5K9S A;  3BX3 A;  4FZA A;  3K62 A;  1XM9 A;  2RU4 B;  2QMR A;  2IAE A;  4FP7 A;  3O2Q A;  3WOY A;  4B8P A;  1O6O A;  2BNX A;  3UKY B;  2PKG A;  4R10 A;  3K49 A;  3BSX A;  3FGA B;  2NPP B;  3LTJ A;  3VLD A;  4CB9 A;  1TH1 A;  5BZV A;  2GL7 A;  4U2X D;  3NMW A;  4CV5 B;  4HTV A;  4U5L A;  5LSW A;  4IMI A;  3WOZ A;  5SVZ A;  3IBV A;  1W63 A;  2VGL A;  3BCT A;  4D4E A;  3WYF C;  4HM9 A;  1HO8 A;  3JXZ A;  4G3A A;  4R11 A;  3ZIN A;  4U5S A;  4R0Z A;  2JDQ A;  4YGX A;  2XOA A;  1JPW A;  4I2W A;  3K61 A;  5KUB A;  3ZHP A;  1Q1S C;  4QMI A;  4EVP A;  3QGB A;  4FFB C;  3UJ0 A;  3T8S A;  4I7I A;  4CT7 B;  1TE4 A;  1M5N S;  1EJL I;  4D49 A;  5CLA A;  5CLD A;  3ZIL A;  4DZS A;  4WV6 A;  3DW8 A;  1F59 A;  3NMZ A;  3ND2 A;  4EVA A;  4E4V A;  3ZIK A;  5H2X A;  3VE6 A;  1UKL A;  5HUW C;  3Q0N A;  4LAC A;  3ZKV A;  4U5N A;  5E6Q B;  3L6Y A;  4B8O A;  3Q0Q A;  3JX7 A;  1JDH A;  4BQK A;  5CL6 A;  4HNM A;  2P8Q A;  3PST A;  3QML C;  4CT6 B;  3GAE A;  1Q1T C;  5BZ5 A;  4CB8 A;  1IB2 A;  1B3U A;  3L3F X;  3OPB A;  4EV9 A;  3TJ3 A;  4TNM A;  2C1M A;  3GB8 A;  4NEE A;  1WA5 B;  3ODS A;  4CRV B;  3AU3 A;  5CTT A;  2H4M A;  3K5Y A;  3V74 A;  1BK6 A;  4GMN A;  4I1E A;  4IMJ A;  4I0Y A;  3KND A;  2FV2 A;  3UVU A;  1W9C A;  4K92 A;  3EG5 B;  3QHE A;  3FEX C;  3IFQ A;  4MFU A;  2JKR A;  3O2S A;  4EV8 A;  3FEY C;  3GVT A;  3C2H A;  5SW9 A;  3K7V A;  5BYM A;  3K4E A;  3A6P A;  3Q0M A;  2XA7 A;  2QK1 A;  2Z5O A;  5K6S A;  3ZIQ A;  2Z5M A;  5D5K C;  4H3K A;  4ZDU A;  1WA5 C;  4BPL A;  5CLC A;  3DAD A;  5KLR B;  5CLE A;  4YI0 C;  2JKT B;  2Z5J A;  4I5L A;  5KLT B;  4DBA A;  3ZIR A;  2NYL B;  4I5N A;  2DB0 A;  4I96 A;  4FDD A;  2OT8 A;  4JW2 B;  4P6Z B;  5FC8 E;  2BCT A;  4CRU B;  4U5O A;  3BTR C;  5J3V A;  4JKQ A;  4UQI B;  4DJS A;  2BAP A;  4UAF B;  1LUJ A;  4NZW A;  3VLF A;  3RZX A;  4PVZ A;  5DN7 A;  3GNI A;  5CLB A;  3SL9 A;  4Y5J A;  5H2W A;  4H3H A;  4L4I A;  4DB9 A;  3Q0R A;  4V3R A;  2QNA A;  4JLQ A;  3TX7 A;  2X19 B;  3K64 A;  3Q0L A;  4A0C A;  2OF3 A;  2IWH A;  5EKF A;  3K5Q A;  3VWA A;  3RZ9 A;  2RU4 A;  4I2Z A;  5KL8 A;  3UL1 B;  4MFV A;  5SWF A;  3OBV A;  4B8J A;  5CL5 A;  3O4X A;  4A3T A;  5EKG A;  4ADY A;  1W63 B;  2VGL B;  4JW3 C;  1PJN B;  3L6X A;  1GCJ A;  1T08 A;  1N4K A;  1UPL A;  3FGA A;  2X1G F;  3EA5 B;  5CL9 A;  1QZ7 A;  2NPP A;  1LSH A;  3LTM A;  5KL1 A;  4PLS A;  3TPO A;  2YJY A;  5BZU A;  4BA3 A;  4I8M A;  4L4H A;  3Q0O A;  4A3V A;  4B18 A;  1Z2C B;  2JKT A;  4V3O A;  1EE4 A;  2Z5K A;  4RZP A;  2Q5D A;  4XZR B;  3GQ2 A;  3NMX A;  4YJL A;  1QGR A;  4I3N A;  5JJA A;  1Y2A C;  4U5U A;  4OO6 A;  1OYZ A;  2IW3 A;  2NYM B;  3K5Z A;  4I37 A;  2C1T A;  3UKW B;  3K7W A;  2F31 A;  3C2G A;  3ODR A;  4UWX A;  1IQ1 C;  4FZF A;  4UAE A;  1LRV A;  2BKU B;  4MZ6 E;  1UN0 A;  3Q0S A;  3OUW A;  4K6J A;  3UKX B;  3VLE A;  3H3D X;  2QK2 A;  5AEI A;  3PSP A;  2Z6H A;  3TT9 A;  2JAK A;  4CBA A;  3Q5U A;  4U5V A;  3JXY A;  4KZG A;  1G3J A;  4OIH A;  1PJM B;  4GMO A;  4FQ3 A;  1U6G C;  4QMJ A;  1IBR B;  3BWT A;  1QGK A;  4MZ5 E;  5HHG E;  3T7U A;  5BZ1 A;  1EJY I;  2WTK A;  1JPP A;  5CL4 A;  3EBB A;  3V71 A;  3SLA A;  3V6Y A;  3WPT A;  2JKR B;  5CL7 A;  4FZD A;  1M8Z A;  4PLQ A;  3C5W A;  1M8X A;  1XQS A;  2IAE B;  4HXT A;  3BSB A;  3UKZ B;  3OQS A;  4YK6 A;  1IAL A;  1QBK B;  2XA7 B;  2PF4 A;  3JY1 A;  4DVG B;  5KLA A;  4O27 A;  3ZIP A;  5CL3 A;  3W3U A;  5B56 A;  2Z5N A;  4DB8 A;  4U54 A;  4QMH A;  4EVT A;  3O2T A;  3UJ4 A;  3LWW A;  3ZIO A;  2NYM A;  2Z6G A;  3Q0P A;  4YJE A;  1M1E A;  3BX2 A;  4RV1 A;  2IX3 A;  4RXH B;  3UL0 B;  2IE4 A;  3NOW A;  3TJZ B;  3BVS A;  4U58 A;  2YNR A;  4PLR A;  4U3J C;  4V3Q A;  2NYL A;  3GS3 A;  3TPM A;  4DB6 A;  1EE5 A;  1V18 A;  1UPK A;  4JW2 A; 
#chains in the Genus database with same CATH homology
 2YNS A;  1BK5 A;  1M8Y A;  3L3Q A;  3OUX A;  5EWP A;  3GRL A;  3QG9 A;  3QGC A;  4UAD A;  4UQI A;  4I2S A;  2IE3 A;  3GVO A;  1M8W A;  1I7W A;  1O6P A;  4I6I A;  2W3C A;  5HUY C;  1I7X A;  4P6Z G;  1XQR A;  4L7M A;  5CL8 A;  5K9S A;  3BX3 A;  4FZA A;  3K62 A;  1XM9 A;  2RU4 B;  2QMR A;  2IAE A;  4FP7 A;  3O2Q A;  3WOY A;  4B8P A;  1O6O A;  2BNX A;  3UKY B;  2PKG A;  4R10 A;  3K49 A;  3BSX A;  3FGA B;  2NPP B;  3LTJ A;  3VLD A;  4CB9 A;  1TH1 A;  5BZV A;  2GL7 A;  4U2X D;  3NMW A;  4CV5 B;  4HTV A;  4U5L A;  5LSW A;  4IMI A;  3WOZ A;  5SVZ A;  3IBV A;  1W63 A;  2VGL A;  3BCT A;  4D4E A;  3WYF C;  4HM9 A;  1HO8 A;  3JXZ A;  4G3A A;  4R11 A;  3ZIN A;  4U5S A;  4R0Z A;  2JDQ A;  4YGX A;  2XOA A;  1JPW A;  4I2W A;  3K61 A;  5KUB A;  3ZHP A;  1Q1S C;  4QMI A;  4EVP A;  3QGB A;  4FFB C;  4I7I A;  4CT7 B;  1TE4 A;  1M5N S;  1EJL I;  4D49 A;  5CLA A;  5CLD A;  3ZIL A;  4DZS A;  4WV6 A;  3DW8 A;  1F59 A;  3NMZ A;  3ND2 A;  4EVA A;  4E4V A;  3ZIK A;  5H2X A;  3VE6 A;  1UKL A;  5HUW C;  3Q0N A;  4LAC A;  3ZKV A;  4U5N A;  5E6Q B;  3L6Y A;  4B8O A;  3Q0Q A;  3JX7 A;  1JDH A;  4BQK A;  5CL6 A;  4HNM A;  2P8Q A;  3PST A;  3QML C;  4CT6 B;  3GAE A;  1Q1T C;  5BZ5 A;  4CB8 A;  1IB2 A;  1B3U A;  3L3F X;  3OPB A;  4EV9 A;  3TJ3 A;  4TNM A;  2C1M A;  3GB8 A;  4NEE A;  1WA5 B;  3ODS A;  4CRV B;  3AU3 A;  5CTT A;  2H4M A;  3K5Y A;  3V74 A;  1BK6 A;  4GMN A;  4I1E A;  4IMJ A;  4I0Y A;  3KND A;  2FV2 A;  3UVU A;  1W9C A;  4K92 A;  3EG5 B;  3QHE A;  3FEX C;  3IFQ A;  4MFU A;  2JKR A;  3O2S A;  4EV8 A;  3FEY C;  3GVT A;  3C2H A;  5SW9 A;  3K7V A;  5BYM A;  3K4E A;  3A6P A;  3Q0M A;  2XA7 A;  2QK1 A;  2Z5O A;  5K6S A;  3ZIQ A;  2Z5M A;  5D5K C;  4H3K A;  4ZDU A;  1WA5 C;  4BPL A;  5CLC A;  3DAD A;  5KLR B;  5CLE A;  4YI0 C;  2JKT B;  2Z5J A;  4I5L A;  5KLT B;  4DBA A;  3ZIR A;  2NYL B;  4I5N A;  2DB0 A;  4I96 A;  4FDD A;  2OT8 A;  4JW2 B;  4P6Z B;  5FC8 E;  2BCT A;  4CRU B;  4U5O A;  3BTR C;  5J3V A;  4JKQ A;  4UQI B;  4DJS A;  2BAP A;  4UAF B;  1LUJ A;  4NZW A;  3VLF A;  3RZX A;  4PVZ A;  5DN7 A;  3GNI A;  5CLB A;  3SL9 A;  4Y5J A;  5H2W A;  4H3H A;  4L4I A;  4DB9 A;  3Q0R A;  4V3R A;  2QNA A;  4JLQ A;  3TX7 A;  2X19 B;  3K64 A;  3Q0L A;  4A0C A;  2OF3 A;  2IWH A;  5EKF A;  3K5Q A;  3VWA A;  3RZ9 A;  2RU4 A;  4I2Z A;  5KL8 A;  3UL1 B;  4MFV A;  5SWF A;  3OBV A;  4B8J A;  5CL5 A;  3O4X A;  4A3T A;  5EKG A;  4ADY A;  1W63 B;  2VGL B;  4JW3 C;  1PJN B;  3L6X A;  1GCJ A;  1T08 A;  1UPL A;  3FGA A;  2X1G F;  3EA5 B;  5CL9 A;  1QZ7 A;  2NPP A;  3LTM A;  5KL1 A;  4PLS A;  3TPO A;  2YJY A;  5BZU A;  4BA3 A;  4I8M A;  4L4H A;  3Q0O A;  4A3V A;  4B18 A;  1Z2C B;  2JKT A;  4V3O A;  1EE4 A;  2Z5K A;  4RZP A;  2Q5D A;  4XZR B;  3GQ2 A;  3NMX A;  4YJL A;  1QGR A;  4I3N A;  5JJA A;  1Y2A C;  4U5U A;  4OO6 A;  1OYZ A;  2IW3 A;  2NYM B;  3K5Z A;  4I37 A;  2C1T A;  3UKW B;  3K7W A;  2F31 A;  3C2G A;  3ODR A;  4UWX A;  1IQ1 C;  4FZF A;  4UAE A;  1LRV A;  2BKU B;  4MZ6 E;  1UN0 A;  3Q0S A;  3OUW A;  4K6J A;  3UKX B;  3VLE A;  3H3D X;  2QK2 A;  5AEI A;  3PSP A;  2Z6H A;  3TT9 A;  2JAK A;  4CBA A;  3Q5U A;  4U5V A;  3JXY A;  4KZG A;  1G3J A;  4OIH A;  1PJM B;  4GMO A;  4FQ3 A;  1U6G C;  4QMJ A;  1IBR B;  3BWT A;  1QGK A;  4MZ5 E;  5HHG E;  3T7U A;  5BZ1 A;  1EJY I;  2WTK A;  1JPP A;  5CL4 A;  3EBB A;  3V71 A;  3SLA A;  3V6Y A;  3WPT A;  2JKR B;  5CL7 A;  4FZD A;  1M8Z A;  4PLQ A;  3C5W A;  1M8X A;  1XQS A;  2IAE B;  4HXT A;  3BSB A;  3UKZ B;  3OQS A;  4YK6 A;  1IAL A;  1QBK B;  2XA7 B;  2PF4 A;  3JY1 A;  4DVG B;  5KLA A;  4O27 A;  3ZIP A;  5CL3 A;  3W3U A;  5B56 A;  2Z5N A;  4DB8 A;  4U54 A;  4QMH A;  4EVT A;  3O2T A;  3LWW A;  3ZIO A;  2NYM A;  2Z6G A;  3Q0P A;  4YJE A;  1M1E A;  3BX2 A;  4RV1 A;  2IX3 A;  4RXH B;  3UL0 B;  2IE4 A;  3NOW A;  3TJZ B;  3BVS A;  4U58 A;  2YNR A;  4PLR A;  4U3J C;  4V3Q A;  2NYL A;  3GS3 A;  3TPM A;  4DB6 A;  1EE5 A;  1V18 A;  1UPK A;  4JW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...