2RU4B

Designed armadillo repeat protein self-assembled complex (yiim2-maii)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
84
structure length
84
Chain Sequence
GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags De novo protein
molecule keywords Armadillo Repeat Protein, N-terminal fragment, YIIM2
publication title Spontaneous self-assembly of engineered armadillo repeat protein fragments into a folded structure
pubmed doi rcsb
source organism Synthetic construct
total genus 32
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2013-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 2ru4B00
4BA3A 4K92A 5HUYC 5SVZA 3ZIOA 1I7XA 4GMOA 3WPTA 4XZRB 3WYFC 1U6GC 2NPPB 4CRVB 3UL0B 1Q1SC 3OUXA 4UAEA 3BCTA 2X1GF 1Q1TC 2BKUB 3W3UA 4FZDA 4CT7B 3LTMA 4V3QA 2BNXA 2Z5NA 3EA5B 4FDDA 2BAPA 3TPOA 3O2SA 4G3AA 1M8XA 1G3JA 1IB2A 3UKYB 3BWTA 1GCJA 5EKFA 3K49A 2JAKA 1QZ7A 4EV9A 2C1TA 1UPLA 3LWWA 4E4VA 3BX3A 4I5NA 1W63B 2F31A 3IFQA 4RXHB 3O2TA 3O2QA 3TT9A 2PF4A 1JPWA 4MFVA 4WV6A 4CRUB 2IW3A 2JKRA 4EV8A 3UKXB 4YK6A 5AEIA 2BCTA 4B18A 1Y2AC 4BQKA 3H3DX 3O4XA 5KL1A 4UQIA 2P8QA 2JKRB 2X19B 1M8WA 4HTVA 1WA5B 2QMRA 2GL7A 3IBVA 4NEEA 3A6PA 4YJEA 3TJ3A 2XA7B 1OYZA 1TH1A 1IQ1C 4YJLA 3UVUA 1JDHA 2QK2A 4ADYA 4FQ3A 1BK6A 3GVTA 1LUJA 1M5NS 1EE5A 4U5NA 4PLQA 2RU4A 4OO6A 4L7MA 3QGCA 2IX3A 4TNMA 4I2ZA 3C5WA 3NOWA 3GS3A 4I5LA 4A0CA 4EVTA 3OUWA 4B8PA 2NYLB 4ZDUA 3FGAA 4D4EA 5H2WA 3ZIRA 4R0ZA 5FC8E 5HUWC 1B3UA 3RZXA 4YGXA 2IAEA 1EJYI 1M8YA 4PLRA 2Z6HA 4IMIA 4OIHA 4CB8A 3TX7A 5D5KC 3PSTA 2JKTA 1JPPA 1Z2CB 4CV5B 3VE6A 4CB9A 5B56A 3BSBA 2OF3A 2FV2A 3BX2A 3L6YA 3ZIPA 3NMXA 3UL1B 3K5ZA 5BZ5A 3Q0RA 2H4MA 4QMHA 5BZUA 4FFBC 1WA5C 3FEXC 2YJYA 3T7UA 4D49A 2DB0A 5DN7A 3QGBA 3L3FX 3GQ2A 5SW9A 1M8ZA 1HO8A 4RZPA 5K6SA 3NMWA 2Z5KA 4EVAA 2YNSA 1QGRA 3GNIA 1QBKB 1PJMB 1UN0A 3NMZA 1M1EA 1QGKA 1XQSA 2NYMA 5KLAA 3K62A 4I2WA 4BPLA 1EJLI 4JLQA 5K9SA 5CTTA 2Z5JA 2YNRA 3OQSA 5KLRB 2W3CA 5E6QB 4H3HA 4PLSA 2QNAA 4UQIB 3K61A 4O27A 4Y5JA 3ZKVA 4DB9A 3Q0SA 3KNDA 1F59A 2QK1A 3FEYC 4R10A 2RU4B 2PKGA 4MZ5E 4QMJA 3VWAA 3WOZA 3TJZB 4CT6B 1EE4A 5KLTB 3FGAB 4MFUA 1W9CA 2IE4A 1O6OA 2IAEB 4MZ6E 4V3RA 3K5QA 3V6YA 4NZWA 5EKGA 5SWFA 3Q5UA 3QHEA 5J3VA 3QG9A 1IBRB 1I7WA 3GRLA 3ODRA 4PVZA 3Q0PA 2JKTB 1XQRA 3V74A 2JDQA 3ODSA 1UKLA 5BYMA 1UPKA 3WOYA 1LRVA 3K4EA 3BTRC 1W63A 3OPBA 3AU3A 3L6XA 4GMNA 3ZIQA 4JW2B 5LSWA 4EVPA 4U3JC 3ND2A 1BK5A 3OBVA 3GB8A 3V71A 4HXTA 4P6ZG 5HHGE 3Q0OA 4U5OA 4K6JA 3ZINA 4DZSA 4U5UA 4U5VA 4FZFA 3GVOA 3DADA 4DJSA 3UKZB 5BZ1A 2Z6GA 3RZ9A 2IWHA 3C2GA 3Q0QA 4CBAA 2C1MA 3Q0LA 5KL8A 4B8OA 2WTKA 2XA7A 4DB8A 1O6PA 2NYMB 4UAFB 3K5YA 3K64A 4RV1A 3GAEA 3UKWB 4QMIA 3K7WA 4HNMA 5JJAA 2IE3A 5BZVA 3EG5B 3L3QA 3TPMA 2VGLA 4U58A 4YI0C 4KZGA 5H2XA 1PJNB 4DVGB 4P6ZB 3LTJA 4U54A 4DBAA 3K7VA 4DB6A 2Z5OA 2Q5DA 4FZAA 2NYLA 5EWPA 4V3OA 3Q0NA 3ZHPA 1XM9A 4LACA 4UADA 2VGLB 4UWXA 3C2HA 4R11A 4U5SA 4IMJA 1V18A 3DW8A 2NPPA 4HM9A 3PSPA 3EBBA 4U5LA 2Z5MA 1IALA 2OT8A 4B8JA 3BSXA 1T08A 4H3KA 3QMLC 3Q0MA
chains in the Genus database with same CATH superfamily
4BA3A 4K92A 5HUYC 5SVZA 3ZIOA 1I7XA 4GMOA 3WPTA 4XZRB 3WYFC 1U6GC 2NPPB 4CRVB 3UL0B 1Q1SC 3OUXA 4UAEA 3BCTA 2X1GF 1Q1TC 2BKUB 3W3UA 4FZDA 4CT7B 3LTMA 4V3QA 2BNXA 2Z5NA 3EA5B 5CLCA 4FDDA 2BAPA 3TPOA 3O2SA 4G3AA 1M8XA 1G3JA 1IB2A 3UKYB 3BWTA 1GCJA 5EKFA 3K49A 2JAKA 1QZ7A 4EV9A 2C1TA 1UPLA 3LWWA 4E4VA 3BX3A 2XOAA 4I5NA 1W63B 2F31A 5CLEA 4JKQA 3IFQA 4RXHB 3O2TA 3O2QA 3VLEA 3TT9A 2PF4A 1JPWA 4MFVA 4WV6A 5CL6A 4CRUB 2IW3A 2JKRA 4EV8A 3UKXB 4YK6A 5AEIA 2BCTA 4B18A 1Y2AC 4I0YA 3JXZA 4BQKA 3H3DX 3O4XA 5KL1A 4UQIA 2P8QA 2JKRB 2X19B 1M8WA 4HTVA 1WA5B 2QMRA 2GL7A 3IBVA 4NEEA 4A3TA 3A6PA 4YJEA 3TJ3A 2XA7B 1OYZA 1TH1A 1IQ1C 4YJLA 5CL9A 3ZILA 4I1EA 3UVUA 1JDHA 2QK2A 4ADYA 4FQ3A 1BK6A 3GVTA 1LUJA 1M5NS 1EE5A 4U5NA 4PLQA 2RU4A 4OO6A 4L7MA 3QGCA 2IX3A 4TNMA 4I2ZA 3C5WA 3NOWA 3GS3A 4I5LA 4A0CA 4EVTA 3OUWA 5CL3A 4B8PA 2NYLB 4ZDUA 4FP7A 3FGAA 4D4EA 5H2WA 3ZIRA 4R0ZA 5FC8E 5HUWC 1B3UA 3RZXA 4YGXA 2IAEA 1EJYI 3T8SA 1M8YA 4PLRA 2Z6HA 4IMIA 4OIHA 4CB8A 3TX7A 5D5KC 3PSTA 2JKTA 1JPPA 1Z2CB 4CV5B 3VE6A 4CB9A 5B56A 5CL8A 3BSBA 2OF3A 2FV2A 3BX2A 3L6YA 3ZIPA 3NMXA 3UL1B 3K5ZA 4JW2A 5BZ5A 3Q0RA 2H4MA 4QMHA 5BZUA 4FFBC 1WA5C 3FEXC 2YJYA 4U2XD 3T7UA 4D49A 2DB0A 5DN7A 3QGBA 3L3FX 3GQ2A 3VLFA 5SW9A 1M8ZA 1HO8A 4RZPA 3JX7A 5K6SA 4I3NA 3NMWA 2Z5KA 4EVAA 2YNSA 1QGRA 4I7IA 3GNIA 1QBKB 1PJMB 1UN0A 3NMZA 1M1EA 1QGKA 1XQSA 2NYMA 5KLAA 3K62A 4L4IA 4I2WA 4BPLA 1EJLI 1N4KA 4JLQA 5K9SA 5CTTA 1LSHA 2Z5JA 2YNRA 3OQSA 5KLRB 3SL9A 2W3CA 5E6QB 4H3HA 4PLSA 2QNAA 4UQIB 3K61A 4O27A 4Y5JA 4I37A 4I96A 3ZKVA 4I2SA 4DB9A 4I6IA 3Q0SA 3KNDA 1F59A 2QK1A 3FEYC 4R10A 2RU4B 2PKGA 5CL7A 4MZ5E 4QMJA 3VWAA 1TE4A 3WOZA 3ZIKA 3TJZB 4CT6B 1EE4A 5KLTB 3FGAB 4MFUA 1W9CA 5CL5A 3VLDA 2IE4A 1O6OA 2IAEB 4MZ6E 4V3RA 3K5QA 5CLAA 3V6YA 4NZWA 5EKGA 5SWFA 3Q5UA 3QHEA 5CLDA 4I8MA 5J3VA 3QG9A 1IBRB 1I7WA 3GRLA 3ODRA 4PVZA 3Q0PA 2JKTB 1XQRA 3V74A 2JDQA 3ODSA 1UKLA 5BYMA 1UPKA 4L4HA 3UJ0A 3WOYA 1LRVA 3K4EA 3BTRC 1W63A 3OPBA 3AU3A 3L6XA 4GMNA 3ZIQA 4JW2B 5LSWA 4EVPA 4U3JC 3ND2A 1BK5A 3OBVA 3GB8A 3V71A 4HXTA 4P6ZG 5HHGE 3Q0OA 4U5OA 4K6JA 3ZINA 4DZSA 4U5UA 4U5VA 4FZFA 5CL4A 3GVOA 3DADA 4DJSA 3UKZB 5BZ1A 2Z6GA 3RZ9A 2IWHA 3C2GA 3Q0QA 4CBAA 2C1MA 3Q0LA 3SLAA 5KL8A 3JY1A 4B8OA 2WTKA 2XA7A 4DB8A 1O6PA 2NYMB 4UAFB 3UJ4A 3K5YA 3K64A 4RV1A 3GAEA 3UKWB 4QMIA 3K7WA 5KUBA 4HNMA 5JJAA 2IE3A 3BVSA 5BZVA 4JW3C 3EG5B 3L3QA 3TPMA 3JXYA 2VGLA 4U58A 4YI0C 4KZGA 5H2XA 1PJNB 4DVGB 4P6ZB 3LTJA 4U54A 4DBAA 3K7VA 4DB6A 2Z5OA 2Q5DA 4FZAA 2NYLA 5EWPA 4V3OA 3Q0NA 3ZHPA 1XM9A 4LACA 4UADA 5CLBA 2VGLB 4UWXA 3C2HA 4R11A 4U5SA 4IMJA 1V18A 3DW8A 2NPPA 4HM9A 3PSPA 3EBBA 4U5LA 2Z5MA 1IALA 2OT8A 4B8JA 4A3VA 3BSXA 1T08A 4H3KA 3QMLC 3Q0MA
chains in the Genus database with same CATH topology
4BA3A 4K92A 5HUYC 5SVZA 3ZIOA 1I7XA 4GMOA 3WPTA 4XZRB 3WYFC 1U6GC 2NPPB 4CRVB 3UL0B 1Q1SC 3OUXA 4UAEA 3BCTA 2X1GF 1Q1TC 2BKUB 3W3UA 4FZDA 4CT7B 3LTMA 4V3QA 2BNXA 2Z5NA 3EA5B 5CLCA 4FDDA 2BAPA 3TPOA 3O2SA 4G3AA 1M8XA 1G3JA 1IB2A 3UKYB 3BWTA 1GCJA 5EKFA 3K49A 2JAKA 1QZ7A 4EV9A 2C1TA 1UPLA 3LWWA 4E4VA 3BX3A 2XOAA 4I5NA 1W63B 2F31A 5CLEA 4JKQA 3IFQA 4RXHB 3O2TA 3O2QA 3VLEA 3TT9A 2PF4A 1JPWA 4MFVA 4WV6A 5CL6A 4CRUB 2IW3A 2JKRA 4EV8A 3UKXB 4YK6A 5AEIA 2BCTA 4B18A 1Y2AC 4I0YA 3JXZA 4BQKA 3H3DX 3O4XA 5KL1A 4UQIA 2P8QA 2JKRB 2X19B 1M8WA 4HTVA 1WA5B 2QMRA 2GL7A 3IBVA 4NEEA 4A3TA 3A6PA 4YJEA 3TJ3A 2XA7B 1OYZA 1TH1A 1IQ1C 4YJLA 5CL9A 3ZILA 4I1EA 3UVUA 1JDHA 2QK2A 4ADYA 4FQ3A 1BK6A 3GVTA 1LUJA 1M5NS 1EE5A 4U5NA 4PLQA 2RU4A 4OO6A 4L7MA 3QGCA 2IX3A 4TNMA 4I2ZA 3C5WA 3NOWA 3GS3A 4I5LA 4A0CA 4EVTA 3OUWA 5CL3A 4B8PA 2NYLB 4ZDUA 4FP7A 3FGAA 4D4EA 5H2WA 3ZIRA 4R0ZA 5FC8E 5HUWC 1B3UA 3RZXA 4YGXA 2IAEA 1EJYI 1M8YA 4PLRA 2Z6HA 4IMIA 4OIHA 4CB8A 3TX7A 5D5KC 3PSTA 2JKTA 1JPPA 1Z2CB 4CV5B 3VE6A 4CB9A 5B56A 5CL8A 3BSBA 2OF3A 2FV2A 3BX2A 3L6YA 3ZIPA 3NMXA 3UL1B 3K5ZA 4JW2A 5BZ5A 3Q0RA 2H4MA 4QMHA 5BZUA 4FFBC 1WA5C 3FEXC 2YJYA 4U2XD 3T7UA 4D49A 2DB0A 5DN7A 3QGBA 3L3FX 3GQ2A 3VLFA 5SW9A 1M8ZA 1HO8A 4RZPA 3JX7A 5K6SA 4I3NA 3NMWA 2Z5KA 4EVAA 2YNSA 1QGRA 4I7IA 3GNIA 1QBKB 1PJMB 1UN0A 3NMZA 1M1EA 1QGKA 1XQSA 2NYMA 5KLAA 3K62A 4L4IA 4I2WA 4BPLA 1EJLI 4JLQA 5K9SA 5CTTA 2Z5JA 2YNRA 3OQSA 5KLRB 3SL9A 2W3CA 5E6QB 4H3HA 4PLSA 2QNAA 4UQIB 3K61A 4O27A 4Y5JA 4I37A 4I96A 3ZKVA 4I2SA 4DB9A 4I6IA 3Q0SA 3KNDA 1F59A 2QK1A 3FEYC 4R10A 2RU4B 2PKGA 5CL7A 4MZ5E 4QMJA 3VWAA 1TE4A 3WOZA 3ZIKA 3TJZB 4CT6B 1EE4A 5KLTB 3FGAB 4MFUA 1W9CA 5CL5A 3VLDA 2IE4A 1O6OA 2IAEB 4MZ6E 4V3RA 3K5QA 5CLAA 3V6YA 4NZWA 5EKGA 5SWFA 3Q5UA 3QHEA 5CLDA 4I8MA 5J3VA 3QG9A 1IBRB 1I7WA 3GRLA 3ODRA 4PVZA 3Q0PA 2JKTB 1XQRA 3V74A 2JDQA 3ODSA 1UKLA 5BYMA 1UPKA 4L4HA 3WOYA 1LRVA 3K4EA 3BTRC 1W63A 3OPBA 3AU3A 3L6XA 4GMNA 3ZIQA 4JW2B 5LSWA 4EVPA 4U3JC 3ND2A 1BK5A 3OBVA 3GB8A 3V71A 4HXTA 4P6ZG 5HHGE 3Q0OA 4U5OA 4K6JA 3ZINA 4DZSA 4U5UA 4U5VA 4FZFA 5CL4A 3GVOA 3DADA 4DJSA 3UKZB 5BZ1A 2Z6GA 3RZ9A 2IWHA 3C2GA 3Q0QA 4CBAA 2C1MA 3Q0LA 3SLAA 5KL8A 3JY1A 4B8OA 2WTKA 2XA7A 4DB8A 1O6PA 2NYMB 4UAFB 3K5YA 3K64A 4RV1A 3GAEA 3UKWB 4QMIA 3K7WA 5KUBA 4HNMA 5JJAA 2IE3A 3BVSA 5BZVA 4JW3C 3EG5B 3L3QA 3TPMA 3JXYA 2VGLA 4U58A 4YI0C 4KZGA 5H2XA 1PJNB 4DVGB 4P6ZB 3LTJA 4U54A 4DBAA 3K7VA 4DB6A 2Z5OA 2Q5DA 4FZAA 2NYLA 5EWPA 4V3OA 3Q0NA 3ZHPA 1XM9A 4LACA 4UADA 5CLBA 2VGLB 4UWXA 3C2HA 4R11A 4U5SA 4IMJA 1V18A 3DW8A 2NPPA 4HM9A 3PSPA 3EBBA 4U5LA 2Z5MA 1IALA 2OT8A 4B8JA 4A3VA 3BSXA 1T08A 4H3KA 3QMLC 3Q0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BA3 A;  4K92 A;  5HUY C;  5SVZ A;  3ZIO A;  1I7X A;  4GMO A;  3WPT A;  4XZR B;  3WYF C;  1U6G C;  2NPP B;  4CRV B;  3UL0 B;  1Q1S C;  3OUX A;  4UAE A;  3BCT A;  2X1G F;  1Q1T C;  2BKU B;  3W3U A;  4FZD A;  4CT7 B;  3LTM A;  4V3Q A;  2BNX A;  2Z5N A;  3EA5 B;  4FDD A;  2BAP A;  3TPO A;  3O2S A;  4G3A A;  1M8X A;  1G3J A;  1IB2 A;  3UKY B;  3BWT A;  1GCJ A;  5EKF A;  3K49 A;  2JAK A;  1QZ7 A;  4EV9 A;  2C1T A;  1UPL A;  3LWW A;  4E4V A;  3BX3 A;  4I5N A;  1W63 B;  2F31 A;  3IFQ A;  4RXH B;  3O2T A;  3O2Q A;  3TT9 A;  2PF4 A;  1JPW A;  4MFV A;  4WV6 A;  4CRU B;  2IW3 A;  2JKR A;  4EV8 A;  3UKX B;  4YK6 A;  5AEI A;  2BCT A;  4B18 A;  1Y2A C;  4BQK A;  3H3D X;  3O4X A;  5KL1 A;  4UQI A;  2P8Q A;  2JKR B;  2X19 B;  1M8W A;  4HTV A;  1WA5 B;  2QMR A;  2GL7 A;  3IBV A;  4NEE A;  3A6P A;  4YJE A;  3TJ3 A;  2XA7 B;  1OYZ A;  1TH1 A;  1IQ1 C;  4YJL A;  3UVU A;  1JDH A;  2QK2 A;  4ADY A;  4FQ3 A;  1BK6 A;  3GVT A;  1LUJ A;  1M5N S;  1EE5 A;  4U5N A;  4PLQ A;  2RU4 A;  4OO6 A;  4L7M A;  3QGC A;  2IX3 A;  4TNM A;  4I2Z A;  3C5W A;  3NOW A;  3GS3 A;  4I5L A;  4A0C A;  4EVT A;  3OUW A;  4B8P A;  2NYL B;  4ZDU A;  3FGA A;  4D4E A;  5H2W A;  3ZIR A;  4R0Z A;  5FC8 E;  5HUW C;  1B3U A;  3RZX A;  4YGX A;  2IAE A;  1EJY I;  1M8Y A;  4PLR A;  2Z6H A;  4IMI A;  4OIH A;  4CB8 A;  3TX7 A;  5D5K C;  3PST A;  2JKT A;  1JPP A;  1Z2C B;  4CV5 B;  3VE6 A;  4CB9 A;  5B56 A;  3BSB A;  2OF3 A;  2FV2 A;  3BX2 A;  3L6Y A;  3ZIP A;  3NMX A;  3UL1 B;  3K5Z A;  5BZ5 A;  3Q0R A;  2H4M A;  4QMH A;  5BZU A;  4FFB C;  1WA5 C;  3FEX C;  2YJY A;  3T7U A;  4D49 A;  2DB0 A;  5DN7 A;  3QGB A;  3L3F X;  3GQ2 A;  5SW9 A;  1M8Z A;  1HO8 A;  4RZP A;  5K6S A;  3NMW A;  2Z5K A;  4EVA A;  2YNS A;  1QGR A;  3GNI A;  1QBK B;  1PJM B;  1UN0 A;  3NMZ A;  1M1E A;  1QGK A;  1XQS A;  2NYM A;  5KLA A;  3K62 A;  4I2W A;  4BPL A;  1EJL I;  4JLQ A;  5K9S A;  5CTT A;  2Z5J A;  2YNR A;  3OQS A;  5KLR B;  2W3C A;  5E6Q B;  4H3H A;  4PLS A;  2QNA A;  4UQI B;  3K61 A;  4O27 A;  4Y5J A;  3ZKV A;  4DB9 A;  3Q0S A;  3KND A;  1F59 A;  2QK1 A;  3FEY C;  4R10 A;  2RU4 B;  2PKG A;  4MZ5 E;  4QMJ A;  3VWA A;  3WOZ A;  3TJZ B;  4CT6 B;  1EE4 A;  5KLT B;  3FGA B;  4MFU A;  1W9C A;  2IE4 A;  1O6O A;  2IAE B;  4MZ6 E;  4V3R A;  3K5Q A;  3V6Y A;  4NZW A;  5EKG A;  5SWF A;  3Q5U A;  3QHE A;  5J3V A;  3QG9 A;  1IBR B;  1I7W A;  3GRL A;  3ODR A;  4PVZ A;  3Q0P A;  2JKT B;  1XQR A;  3V74 A;  2JDQ A;  3ODS A;  1UKL A;  5BYM A;  1UPK A;  3WOY A;  1LRV A;  3K4E A;  3BTR C;  1W63 A;  3OPB A;  3AU3 A;  3L6X A;  4GMN A;  3ZIQ A;  4JW2 B;  5LSW A;  4EVP A;  4U3J C;  3ND2 A;  1BK5 A;  3OBV A;  3GB8 A;  3V71 A;  4HXT A;  4P6Z G;  5HHG E;  3Q0O A;  4U5O A;  4K6J A;  3ZIN A;  4DZS A;  4U5U A;  4U5V A;  4FZF A;  3GVO A;  3DAD A;  4DJS A;  3UKZ B;  5BZ1 A;  2Z6G A;  3RZ9 A;  2IWH A;  3C2G A;  3Q0Q A;  4CBA A;  2C1M A;  3Q0L A;  5KL8 A;  4B8O A;  2WTK A;  2XA7 A;  4DB8 A;  1O6P A;  2NYM B;  4UAF B;  3K5Y A;  3K64 A;  4RV1 A;  3GAE A;  3UKW B;  4QMI A;  3K7W A;  4HNM A;  5JJA A;  2IE3 A;  5BZV A;  3EG5 B;  3L3Q A;  3TPM A;  2VGL A;  4U58 A;  4YI0 C;  4KZG A;  5H2X A;  1PJN B;  4DVG B;  4P6Z B;  3LTJ A;  4U54 A;  4DBA A;  3K7V A;  4DB6 A;  2Z5O A;  2Q5D A;  4FZA A;  2NYL A;  5EWP A;  4V3O A;  3Q0N A;  3ZHP A;  1XM9 A;  4LAC A;  4UAD A;  2VGL B;  4UWX A;  3C2H A;  4R11 A;  4U5S A;  4IMJ A;  1V18 A;  3DW8 A;  2NPP A;  4HM9 A;  3PSP A;  3EBB A;  4U5L A;  2Z5M A;  1IAL A;  2OT8 A;  4B8J A;  3BSX A;  1T08 A;  4H3K A;  3QML C;  3Q0M A; 
#chains in the Genus database with same CATH topology
 4BA3 A;  4K92 A;  5HUY C;  5SVZ A;  3ZIO A;  1I7X A;  4GMO A;  3WPT A;  4XZR B;  3WYF C;  1U6G C;  2NPP B;  4CRV B;  3UL0 B;  1Q1S C;  3OUX A;  4UAE A;  3BCT A;  2X1G F;  1Q1T C;  2BKU B;  3W3U A;  4FZD A;  4CT7 B;  3LTM A;  4V3Q A;  2BNX A;  2Z5N A;  3EA5 B;  5CLC A;  4FDD A;  2BAP A;  3TPO A;  3O2S A;  4G3A A;  1M8X A;  1G3J A;  1IB2 A;  3UKY B;  3BWT A;  1GCJ A;  5EKF A;  3K49 A;  2JAK A;  1QZ7 A;  4EV9 A;  2C1T A;  1UPL A;  3LWW A;  4E4V A;  3BX3 A;  2XOA A;  4I5N A;  1W63 B;  2F31 A;  5CLE A;  4JKQ A;  3IFQ A;  4RXH B;  3O2T A;  3O2Q A;  3VLE A;  3TT9 A;  2PF4 A;  1JPW A;  4MFV A;  4WV6 A;  5CL6 A;  4CRU B;  2IW3 A;  2JKR A;  4EV8 A;  3UKX B;  4YK6 A;  5AEI A;  2BCT A;  4B18 A;  1Y2A C;  4I0Y A;  3JXZ A;  4BQK A;  3H3D X;  3O4X A;  5KL1 A;  4UQI A;  2P8Q A;  2JKR B;  2X19 B;  1M8W A;  4HTV A;  1WA5 B;  2QMR A;  2GL7 A;  3IBV A;  4NEE A;  4A3T A;  3A6P A;  4YJE A;  3TJ3 A;  2XA7 B;  1OYZ A;  1TH1 A;  1IQ1 C;  4YJL A;  5CL9 A;  3ZIL A;  4I1E A;  3UVU A;  1JDH A;  2QK2 A;  4ADY A;  4FQ3 A;  1BK6 A;  3GVT A;  1LUJ A;  1M5N S;  1EE5 A;  4U5N A;  4PLQ A;  2RU4 A;  4OO6 A;  4L7M A;  3QGC A;  2IX3 A;  4TNM A;  4I2Z A;  3C5W A;  3NOW A;  3GS3 A;  4I5L A;  4A0C A;  4EVT A;  3OUW A;  5CL3 A;  4B8P A;  2NYL B;  4ZDU A;  4FP7 A;  3FGA A;  4D4E A;  5H2W A;  3ZIR A;  4R0Z A;  5FC8 E;  5HUW C;  1B3U A;  3RZX A;  4YGX A;  2IAE A;  1EJY I;  3T8S A;  1M8Y A;  4PLR A;  2Z6H A;  4IMI A;  4OIH A;  4CB8 A;  3TX7 A;  5D5K C;  3PST A;  2JKT A;  1JPP A;  1Z2C B;  4CV5 B;  3VE6 A;  4CB9 A;  5B56 A;  5CL8 A;  3BSB A;  2OF3 A;  2FV2 A;  3BX2 A;  3L6Y A;  3ZIP A;  3NMX A;  3UL1 B;  3K5Z A;  4JW2 A;  5BZ5 A;  3Q0R A;  2H4M A;  4QMH A;  5BZU A;  4FFB C;  1WA5 C;  3FEX C;  2YJY A;  4U2X D;  3T7U A;  4D49 A;  2DB0 A;  5DN7 A;  3QGB A;  3L3F X;  3GQ2 A;  3VLF A;  5SW9 A;  1M8Z A;  1HO8 A;  4RZP A;  3JX7 A;  5K6S A;  4I3N A;  3NMW A;  2Z5K A;  4EVA A;  2YNS A;  1QGR A;  4I7I A;  3GNI A;  1QBK B;  1PJM B;  1UN0 A;  3NMZ A;  1M1E A;  1QGK A;  1XQS A;  2NYM A;  5KLA A;  3K62 A;  4L4I A;  4I2W A;  4BPL A;  1EJL I;  1N4K A;  4JLQ A;  5K9S A;  5CTT A;  1LSH A;  2Z5J A;  2YNR A;  3OQS A;  5KLR B;  3SL9 A;  2W3C A;  5E6Q B;  4H3H A;  4PLS A;  2QNA A;  4UQI B;  3K61 A;  4O27 A;  4Y5J A;  4I37 A;  4I96 A;  3ZKV A;  4I2S A;  4DB9 A;  4I6I A;  3Q0S A;  3KND A;  1F59 A;  2QK1 A;  3FEY C;  4R10 A;  2RU4 B;  2PKG A;  5CL7 A;  4MZ5 E;  4QMJ A;  3VWA A;  1TE4 A;  3WOZ A;  3ZIK A;  3TJZ B;  4CT6 B;  1EE4 A;  5KLT B;  3FGA B;  4MFU A;  1W9C A;  5CL5 A;  3VLD A;  2IE4 A;  1O6O A;  2IAE B;  4MZ6 E;  4V3R A;  3K5Q A;  5CLA A;  3V6Y A;  4NZW A;  5EKG A;  5SWF A;  3Q5U A;  3QHE A;  5CLD A;  4I8M A;  5J3V A;  3QG9 A;  1IBR B;  1I7W A;  3GRL A;  3ODR A;  4PVZ A;  3Q0P A;  2JKT B;  1XQR A;  3V74 A;  2JDQ A;  3ODS A;  1UKL A;  5BYM A;  1UPK A;  4L4H A;  3UJ0 A;  3WOY A;  1LRV A;  3K4E A;  3BTR C;  1W63 A;  3OPB A;  3AU3 A;  3L6X A;  4GMN A;  3ZIQ A;  4JW2 B;  5LSW A;  4EVP A;  4U3J C;  3ND2 A;  1BK5 A;  3OBV A;  3GB8 A;  3V71 A;  4HXT A;  4P6Z G;  5HHG E;  3Q0O A;  4U5O A;  4K6J A;  3ZIN A;  4DZS A;  4U5U A;  4U5V A;  4FZF A;  5CL4 A;  3GVO A;  3DAD A;  4DJS A;  3UKZ B;  5BZ1 A;  2Z6G A;  3RZ9 A;  2IWH A;  3C2G A;  3Q0Q A;  4CBA A;  2C1M A;  3Q0L A;  3SLA A;  5KL8 A;  3JY1 A;  4B8O A;  2WTK A;  2XA7 A;  4DB8 A;  1O6P A;  2NYM B;  4UAF B;  3UJ4 A;  3K5Y A;  3K64 A;  4RV1 A;  3GAE A;  3UKW B;  4QMI A;  3K7W A;  5KUB A;  4HNM A;  5JJA A;  2IE3 A;  3BVS A;  5BZV A;  4JW3 C;  3EG5 B;  3L3Q A;  3TPM A;  3JXY A;  2VGL A;  4U58 A;  4YI0 C;  4KZG A;  5H2X A;  1PJN B;  4DVG B;  4P6Z B;  3LTJ A;  4U54 A;  4DBA A;  3K7V A;  4DB6 A;  2Z5O A;  2Q5D A;  4FZA A;  2NYL A;  5EWP A;  4V3O A;  3Q0N A;  3ZHP A;  1XM9 A;  4LAC A;  4UAD A;  5CLB A;  2VGL B;  4UWX A;  3C2H A;  4R11 A;  4U5S A;  4IMJ A;  1V18 A;  3DW8 A;  2NPP A;  4HM9 A;  3PSP A;  3EBB A;  4U5L A;  2Z5M A;  1IAL A;  2OT8 A;  4B8J A;  4A3V A;  3BSX A;  1T08 A;  4H3K A;  3QML C;  3Q0M A; 
#chains in the Genus database with same CATH homology
 4BA3 A;  4K92 A;  5HUY C;  5SVZ A;  3ZIO A;  1I7X A;  4GMO A;  3WPT A;  4XZR B;  3WYF C;  1U6G C;  2NPP B;  4CRV B;  3UL0 B;  1Q1S C;  3OUX A;  4UAE A;  3BCT A;  2X1G F;  1Q1T C;  2BKU B;  3W3U A;  4FZD A;  4CT7 B;  3LTM A;  4V3Q A;  2BNX A;  2Z5N A;  3EA5 B;  5CLC A;  4FDD A;  2BAP A;  3TPO A;  3O2S A;  4G3A A;  1M8X A;  1G3J A;  1IB2 A;  3UKY B;  3BWT A;  1GCJ A;  5EKF A;  3K49 A;  2JAK A;  1QZ7 A;  4EV9 A;  2C1T A;  1UPL A;  3LWW A;  4E4V A;  3BX3 A;  2XOA A;  4I5N A;  1W63 B;  2F31 A;  5CLE A;  4JKQ A;  3IFQ A;  4RXH B;  3O2T A;  3O2Q A;  3VLE A;  3TT9 A;  2PF4 A;  1JPW A;  4MFV A;  4WV6 A;  5CL6 A;  4CRU B;  2IW3 A;  2JKR A;  4EV8 A;  3UKX B;  4YK6 A;  5AEI A;  2BCT A;  4B18 A;  1Y2A C;  4I0Y A;  3JXZ A;  4BQK A;  3H3D X;  3O4X A;  5KL1 A;  4UQI A;  2P8Q A;  2JKR B;  2X19 B;  1M8W A;  4HTV A;  1WA5 B;  2QMR A;  2GL7 A;  3IBV A;  4NEE A;  4A3T A;  3A6P A;  4YJE A;  3TJ3 A;  2XA7 B;  1OYZ A;  1TH1 A;  1IQ1 C;  4YJL A;  5CL9 A;  3ZIL A;  4I1E A;  3UVU A;  1JDH A;  2QK2 A;  4ADY A;  4FQ3 A;  1BK6 A;  3GVT A;  1LUJ A;  1M5N S;  1EE5 A;  4U5N A;  4PLQ A;  2RU4 A;  4OO6 A;  4L7M A;  3QGC A;  2IX3 A;  4TNM A;  4I2Z A;  3C5W A;  3NOW A;  3GS3 A;  4I5L A;  4A0C A;  4EVT A;  3OUW A;  5CL3 A;  4B8P A;  2NYL B;  4ZDU A;  4FP7 A;  3FGA A;  4D4E A;  5H2W A;  3ZIR A;  4R0Z A;  5FC8 E;  5HUW C;  1B3U A;  3RZX A;  4YGX A;  2IAE A;  1EJY I;  1M8Y A;  4PLR A;  2Z6H A;  4IMI A;  4OIH A;  4CB8 A;  3TX7 A;  5D5K C;  3PST A;  2JKT A;  1JPP A;  1Z2C B;  4CV5 B;  3VE6 A;  4CB9 A;  5B56 A;  5CL8 A;  3BSB A;  2OF3 A;  2FV2 A;  3BX2 A;  3L6Y A;  3ZIP A;  3NMX A;  3UL1 B;  3K5Z A;  4JW2 A;  5BZ5 A;  3Q0R A;  2H4M A;  4QMH A;  5BZU A;  4FFB C;  1WA5 C;  3FEX C;  2YJY A;  4U2X D;  3T7U A;  4D49 A;  2DB0 A;  5DN7 A;  3QGB A;  3L3F X;  3GQ2 A;  3VLF A;  5SW9 A;  1M8Z A;  1HO8 A;  4RZP A;  3JX7 A;  5K6S A;  4I3N A;  3NMW A;  2Z5K A;  4EVA A;  2YNS A;  1QGR A;  4I7I A;  3GNI A;  1QBK B;  1PJM B;  1UN0 A;  3NMZ A;  1M1E A;  1QGK A;  1XQS A;  2NYM A;  5KLA A;  3K62 A;  4L4I A;  4I2W A;  4BPL A;  1EJL I;  4JLQ A;  5K9S A;  5CTT A;  2Z5J A;  2YNR A;  3OQS A;  5KLR B;  3SL9 A;  2W3C A;  5E6Q B;  4H3H A;  4PLS A;  2QNA A;  4UQI B;  3K61 A;  4O27 A;  4Y5J A;  4I37 A;  4I96 A;  3ZKV A;  4I2S A;  4DB9 A;  4I6I A;  3Q0S A;  3KND A;  1F59 A;  2QK1 A;  3FEY C;  4R10 A;  2RU4 B;  2PKG A;  5CL7 A;  4MZ5 E;  4QMJ A;  3VWA A;  1TE4 A;  3WOZ A;  3ZIK A;  3TJZ B;  4CT6 B;  1EE4 A;  5KLT B;  3FGA B;  4MFU A;  1W9C A;  5CL5 A;  3VLD A;  2IE4 A;  1O6O A;  2IAE B;  4MZ6 E;  4V3R A;  3K5Q A;  5CLA A;  3V6Y A;  4NZW A;  5EKG A;  5SWF A;  3Q5U A;  3QHE A;  5CLD A;  4I8M A;  5J3V A;  3QG9 A;  1IBR B;  1I7W A;  3GRL A;  3ODR A;  4PVZ A;  3Q0P A;  2JKT B;  1XQR A;  3V74 A;  2JDQ A;  3ODS A;  1UKL A;  5BYM A;  1UPK A;  4L4H A;  3WOY A;  1LRV A;  3K4E A;  3BTR C;  1W63 A;  3OPB A;  3AU3 A;  3L6X A;  4GMN A;  3ZIQ A;  4JW2 B;  5LSW A;  4EVP A;  4U3J C;  3ND2 A;  1BK5 A;  3OBV A;  3GB8 A;  3V71 A;  4HXT A;  4P6Z G;  5HHG E;  3Q0O A;  4U5O A;  4K6J A;  3ZIN A;  4DZS A;  4U5U A;  4U5V A;  4FZF A;  5CL4 A;  3GVO A;  3DAD A;  4DJS A;  3UKZ B;  5BZ1 A;  2Z6G A;  3RZ9 A;  2IWH A;  3C2G A;  3Q0Q A;  4CBA A;  2C1M A;  3Q0L A;  3SLA A;  5KL8 A;  3JY1 A;  4B8O A;  2WTK A;  2XA7 A;  4DB8 A;  1O6P A;  2NYM B;  4UAF B;  3K5Y A;  3K64 A;  4RV1 A;  3GAE A;  3UKW B;  4QMI A;  3K7W A;  5KUB A;  4HNM A;  5JJA A;  2IE3 A;  3BVS A;  5BZV A;  4JW3 C;  3EG5 B;  3L3Q A;  3TPM A;  3JXY A;  2VGL A;  4U58 A;  4YI0 C;  4KZG A;  5H2X A;  1PJN B;  4DVG B;  4P6Z B;  3LTJ A;  4U54 A;  4DBA A;  3K7V A;  4DB6 A;  2Z5O A;  2Q5D A;  4FZA A;  2NYL A;  5EWP A;  4V3O A;  3Q0N A;  3ZHP A;  1XM9 A;  4LAC A;  4UAD A;  5CLB A;  2VGL B;  4UWX A;  3C2H A;  4R11 A;  4U5S A;  4IMJ A;  1V18 A;  3DW8 A;  2NPP A;  4HM9 A;  3PSP A;  3EBB A;  4U5L A;  2Z5M A;  1IAL A;  2OT8 A;  4B8J A;  4A3V A;  3BSX A;  1T08 A;  4H3K A;  3QML C;  3Q0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...