4QMJA

The xmap215 family drives microtubule polymerization using a structurally diverse tog array
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
229
structure length
229
Chain Sequence
LPRTEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINDAKFIQPNIGELPTALKGRLNDSNKILVQQTLNILQQLAVAMGPNIKQHVKNLGIPIITVLGDSKNNVRAAALATVNAWAEQTGMKEWLEGEDLSEELKKENPFLRQELLGWLAEKLPTLRSTPTDLILCVPHLYSCLEDRNGDVRKKAQDALPFFMMHLGYEKMAKATGKLKPTSKDQVLAMLEKAKVNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cytoskeleton-associated protein 5
publication title The XMAP215 family drives microtubule polymerization using a structurally diverse TOG array.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 82
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12348 CLASP_N CLASP N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 4qmjA00
5SVZA 4E4VA 3K5QA 1QBKB 4MZ5E 3K64A 3Q0QA 1U6GC 2PKGA 4U5LA 4YI0C 4FFBC 1QZ7A 1PJNB 4EVTA 1O6PA 4DJSA 4FZDA 3UKZB 2F31A 4PVZA 1XQRA 3BSBA 1M1EA 5BZ1A 4FDDA 2NPPB 1M8WA 1GCJA 2JKRB 2YNRA 3NOWA 3BWTA 4H3HA 4WV6A 3EG5B 1Q1SC 4CB8A 3GVTA 3OUXA 3K5YA 3Q0OA 2IWHA 3DADA 4L7MA 1XQSA 1Z2CB 2NPPA 5J3VA 2JKRA 3BCTA 3QMLC 2Z5MA 3GVOA 5D5KC 3NMZA 3IBVA 2JAKA 5EKGA 4GMOA 3BTRC 4HTVA 5K9SA 2BCTA 3Q0SA 2Q5DA 1JPPA 3EA5B 4R0ZA 4BA3A 2IW3A 3L6XA 3KNDA 3UKYB 3A6PA 4B8JA 3LTJA 1EE4A 3OQSA 1HO8A 2Z6HA 2IAEB 1M5NS 3ZKVA 1IBRB 3UVUA 3ZIRA 4MZ6E 4RXHB 3FGAB 1UPKA 4IMIA 5HUWC 3UL0B 3OBVA 3K7VA 3WOZA 4GMNA 3QHEA 5E6QB 3DW8A 2X1GF 5KLAA 2IAEA 4UAFB 4D4EA 4ADYA 4EV9A 3NMWA 4YK6A 5KLRB 5FC8E 4KZGA 3RZ9A 3FGAA 5CTTA 3K49A 2BNXA 3BSXA 3H3DX 3QGBA 5SW9A 3WYFC 4RV1A 1UPLA 3FEYC 4MFUA 4U5OA 1O6OA 4DB8A 1G3JA 4CV5B 3IFQA 2BKUB 5EWPA 2XA7B 4MFVA 3C2GA 3K7WA 4UQIB 3EBBA 1QGRA 4R10A 5HUYC 2YNSA 5DN7A 4P6ZG 2QMRA 2FV2A 4EVPA 3WPTA 2X19B 3W3UA 5H2XA 2JDQA 4U5UA 3C5WA 1Y2AC 3V6YA 1BK6A 2XA7A 1B3UA 3OUWA 3LWWA 5LSWA 3ODRA 3GS3A 4UQIA 4DB6A 1IB2A 2BAPA 4EVAA 1EE5A 4CRVB 3OPBA 3QGCA 1LRVA 4I5NA 3ZINA 4U54A 1JDHA 1T08A 1WA5B 2QK1A 5KL1A 5SWFA 4NEEA 4OO6A 1TH1A 4JLQA 2DB0A 3O2TA 3UKWB 4ZDUA 3LTMA 4U3JC 2VGLB 3K4EA 3VE6A 4PLRA 1UKLA 4K6JA 2Z5JA 3GAEA 3Q5UA 2IE4A 3ZHPA 3Q0NA 3UKXB 3QG9A 5BZVA 4V3QA 4V3RA 2YJYA 4UAEA 1QGKA 2OF3A 3NMXA 4DB9A 4U5VA 3ZIPA 2VGLA 5H2WA 2IE3A 4BPLA 2JKTB 4U58A 2GL7A 4I2ZA 4XZRB 4OIHA 4FZFA 2QK2A 1M8XA 4QMIA 3ODSA 4YGXA 1IALA 3RZXA 1W63B 2NYLB 4A0CA 4HM9A 3GNIA 4CT7B 3AU3A 4IMJA 2C1MA 4U5NA 4B8OA 1XM9A 3T7UA 4FZAA 2JKTA 3BX3A 4V3OA 3GRLA 4K92A 2QNAA 3TT9A 3Q0PA 3TX7A 2H4MA 1EJLI 2RU4B 1V18A 4JW2B 1W63A 4UADA 2Z5OA 5K6SA 2NYLA 4YJLA 4I5LA 3C2HA 1I7XA 3Q0MA 4O27A 1BK5A 3O2SA 4B18A 3UL1B 3L3FX 5JJAA 4QMJA 3V71A 1M8ZA 3WOYA 4CT6B 3K5ZA 3L3QA 4CRUB 4DZSA 4EV8A 5BZUA 4U5SA 5BZ5A 4NZWA 4PLQA 3TJ3A 3TPMA 2P8QA 1W9CA 3GQ2A 2RU4A 2WTKA 2NYMB 4P6ZB 1EJYI 2IX3A 3BX2A 1F59A 3Q0RA 3PSPA 4DBAA 3VWAA 3TPOA 5KL8A 5EKFA 3Q0LA 4DVGB 2NYMA 1JPWA 4QMHA 5AEIA 1I7WA 1IQ1C 4YJEA 3FEXC 5KLTB 1LUJA 3V74A 4H3KA 5BYMA 4I2WA 4Y5JA 2Z5KA 3L6YA 4CBAA 4PLSA 4R11A 2PF4A 3GB8A 4RZPA 2OT8A 3O2QA 1M8YA 1PJMB 2Z5NA 2Z6GA 2C1TA 1Q1TC 4HNMA 4G3AA 4LACA 4FQ3A 3ZIQA 3K62A 3O4XA 1UN0A 4CB9A 1WA5C 3PSTA 3TJZB 5HHGE 5B56A 4D49A 4TNMA 4UWXA 1OYZA 3ZIOA 4HXTA 4BQKA 2W3CA 3K61A 4B8PA 3ND2A
chains in the Genus database with same CATH superfamily
5SVZA 4E4VA 3K5QA 1QBKB 4MZ5E 5CL3A 3K64A 3Q0QA 1U6GC 2PKGA 4U5LA 4YI0C 4FFBC 1QZ7A 1PJNB 4EVTA 1O6PA 4DJSA 4FZDA 3UKZB 2F31A 4PVZA 1XQRA 3BSBA 2XOAA 3ZILA 1M1EA 5BZ1A 3T8SA 4FDDA 2NPPB 1M8WA 1GCJA 3JX7A 2JKRB 2YNRA 3NOWA 3BWTA 4H3HA 4WV6A 3EG5B 1Q1SC 4CB8A 3GVTA 3OUXA 3K5YA 3Q0OA 4L4IA 2IWHA 3DADA 4L7MA 1XQSA 1Z2CB 2NPPA 5CL9A 5J3VA 2JKRA 3BCTA 3QMLC 2Z5MA 3GVOA 5D5KC 3NMZA 3IBVA 2JAKA 5EKGA 4GMOA 3BVSA 3VLDA 4I37A 3BTRC 4HTVA 5K9SA 2BCTA 3Q0SA 2Q5DA 1JPPA 3EA5B 4I1EA 4R0ZA 4BA3A 2IW3A 3L6XA 3KNDA 5CL7A 3UKYB 3A6PA 4B8JA 3LTJA 1EE4A 3OQSA 1HO8A 2Z6HA 2IAEB 4JW3C 1M5NS 3ZKVA 1IBRB 3UVUA 3ZIRA 4MZ6E 4RXHB 3FGAB 1UPKA 4IMIA 5CL8A 5CLBA 5HUWC 3UL0B 3OBVA 3K7VA 3WOZA 4GMNA 3QHEA 5E6QB 3DW8A 4JKQA 2X1GF 5KLAA 2IAEA 4UAFB 3JXZA 4D4EA 4ADYA 4EV9A 3NMWA 3UJ4A 4FP7A 4YK6A 5KLRB 5FC8E 4A3VA 4KZGA 3RZ9A 3FGAA 5CTTA 3K49A 2BNXA 3BSXA 3H3DX 3QGBA 5SW9A 3WYFC 4RV1A 5CLCA 1UPLA 3FEYC 4MFUA 4U5OA 1O6OA 4DB8A 1G3JA 4CV5B 3IFQA 2BKUB 4A3TA 5EWPA 2XA7B 4MFVA 3C2GA 3K7WA 4UQIB 4L4HA 3EBBA 1QGRA 4R10A 4I2SA 5HUYC 2YNSA 5DN7A 4P6ZG 2QMRA 2FV2A 4EVPA 3WPTA 2X19B 3W3UA 5H2XA 2JDQA 3SLAA 4U5UA 3C5WA 1Y2AC 3V6YA 1BK6A 2XA7A 1B3UA 3OUWA 3LWWA 5LSWA 3ODRA 3GS3A 4UQIA 4DB6A 1IB2A 3UJ0A 2BAPA 4EVAA 1EE5A 4CRVB 3OPBA 3QGCA 1LRVA 4I96A 4I5NA 3ZINA 4U54A 1JDHA 1T08A 1WA5B 2QK1A 5KL1A 5SWFA 4NEEA 4OO6A 1TH1A 4JLQA 2DB0A 3O2TA 3UKWB 4ZDUA 3LTMA 4U3JC 2VGLB 5CL6A 3K4EA 3VE6A 4PLRA 1UKLA 4K6JA 2Z5JA 3GAEA 3Q5UA 2IE4A 3ZHPA 4I7IA 4I0YA 3Q0NA 5CL4A 3UKXB 3QG9A 5BZVA 4V3QA 4V3RA 2YJYA 4UAEA 1QGKA 4I6IA 2OF3A 1TE4A 4I3NA 3NMXA 4DB9A 4U5VA 3ZIPA 2VGLA 5H2WA 2IE3A 4BPLA 3VLFA 2JKTB 4U58A 2GL7A 4I2ZA 4XZRB 4OIHA 4FZFA 5KUBA 2QK2A 1M8XA 4QMIA 3ODSA 4YGXA 1IALA 3RZXA 1W63B 2NYLB 4A0CA 4HM9A 5CLAA 3GNIA 4CT7B 3AU3A 4IMJA 2C1MA 1N4KA 4U5NA 4B8OA 1XM9A 3T7UA 3JXYA 4FZAA 3VLEA 2JKTA 3BX3A 4V3OA 3GRLA 4K92A 2QNAA 3TT9A 3Q0PA 3TX7A 2H4MA 1EJLI 2RU4B 1V18A 4JW2B 1W63A 3SL9A 4UADA 2Z5OA 5K6SA 2NYLA 3JY1A 4YJLA 4I5LA 3C2HA 1I7XA 3Q0MA 4O27A 1BK5A 3O2SA 4B18A 3UL1B 3L3FX 5JJAA 4QMJA 3V71A 1M8ZA 3WOYA 4CT6B 3K5ZA 3L3QA 3ZIKA 4CRUB 4DZSA 4EV8A 5BZUA 4U5SA 5BZ5A 4NZWA 4PLQA 3TJ3A 3TPMA 2P8QA 1W9CA 3GQ2A 2RU4A 4JW2A 2WTKA 2NYMB 4P6ZB 1EJYI 2IX3A 3BX2A 1F59A 3Q0RA 3PSPA 4DBAA 3VWAA 3TPOA 5KL8A 1LSHA 5EKFA 3Q0LA 4DVGB 2NYMA 5CLDA 1JPWA 4QMHA 5AEIA 1I7WA 1IQ1C 4YJEA 3FEXC 5KLTB 1LUJA 3V74A 4H3KA 5BYMA 4I2WA 4Y5JA 2Z5KA 3L6YA 4CBAA 4PLSA 4R11A 2PF4A 3GB8A 5CLEA 4RZPA 2OT8A 3O2QA 1M8YA 1PJMB 2Z5NA 2Z6GA 2C1TA 1Q1TC 4HNMA 4G3AA 4LACA 4FQ3A 3ZIQA 3K62A 3O4XA 4I8MA 1UN0A 4U2XD 4CB9A 1WA5C 3PSTA 3TJZB 5HHGE 5B56A 4D49A 4TNMA 4UWXA 1OYZA 3ZIOA 4HXTA 4BQKA 5CL5A 2W3CA 3K61A 4B8PA 3ND2A
chains in the Genus database with same CATH topology
5SVZA 4E4VA 3K5QA 1QBKB 4MZ5E 5CL3A 3K64A 3Q0QA 1U6GC 2PKGA 4U5LA 4YI0C 4FFBC 1QZ7A 1PJNB 4EVTA 1O6PA 4DJSA 4FZDA 3UKZB 2F31A 4PVZA 1XQRA 3BSBA 2XOAA 3ZILA 1M1EA 5BZ1A 4FDDA 2NPPB 1M8WA 1GCJA 3JX7A 2JKRB 2YNRA 3NOWA 3BWTA 4H3HA 4WV6A 3EG5B 1Q1SC 4CB8A 3GVTA 3OUXA 3K5YA 3Q0OA 4L4IA 2IWHA 3DADA 4L7MA 1XQSA 1Z2CB 2NPPA 5CL9A 5J3VA 2JKRA 3BCTA 3QMLC 2Z5MA 3GVOA 5D5KC 3NMZA 3IBVA 2JAKA 5EKGA 4GMOA 3BVSA 3VLDA 4I37A 3BTRC 4HTVA 5K9SA 2BCTA 3Q0SA 2Q5DA 1JPPA 3EA5B 4I1EA 4R0ZA 4BA3A 2IW3A 3L6XA 3KNDA 5CL7A 3UKYB 3A6PA 4B8JA 3LTJA 1EE4A 3OQSA 1HO8A 2Z6HA 2IAEB 4JW3C 1M5NS 3ZKVA 1IBRB 3UVUA 3ZIRA 4MZ6E 4RXHB 3FGAB 1UPKA 4IMIA 5CL8A 5CLBA 5HUWC 3UL0B 3OBVA 3K7VA 3WOZA 4GMNA 3QHEA 5E6QB 3DW8A 4JKQA 2X1GF 5KLAA 2IAEA 4UAFB 3JXZA 4D4EA 4ADYA 4EV9A 3NMWA 4FP7A 4YK6A 5KLRB 5FC8E 4A3VA 4KZGA 3RZ9A 3FGAA 5CTTA 3K49A 2BNXA 3BSXA 3H3DX 3QGBA 5SW9A 3WYFC 4RV1A 5CLCA 1UPLA 3FEYC 4MFUA 4U5OA 1O6OA 4DB8A 1G3JA 4CV5B 3IFQA 2BKUB 4A3TA 5EWPA 2XA7B 4MFVA 3C2GA 3K7WA 4UQIB 4L4HA 3EBBA 1QGRA 4R10A 4I2SA 5HUYC 2YNSA 5DN7A 4P6ZG 2QMRA 2FV2A 4EVPA 3WPTA 2X19B 3W3UA 5H2XA 2JDQA 3SLAA 4U5UA 3C5WA 1Y2AC 3V6YA 1BK6A 2XA7A 1B3UA 3OUWA 3LWWA 5LSWA 3ODRA 3GS3A 4UQIA 4DB6A 1IB2A 2BAPA 4EVAA 1EE5A 4CRVB 3OPBA 3QGCA 1LRVA 4I96A 4I5NA 3ZINA 4U54A 1JDHA 1T08A 1WA5B 2QK1A 5KL1A 5SWFA 4NEEA 4OO6A 1TH1A 4JLQA 2DB0A 3O2TA 3UKWB 4ZDUA 3LTMA 4U3JC 2VGLB 5CL6A 3K4EA 3VE6A 4PLRA 1UKLA 4K6JA 2Z5JA 3GAEA 3Q5UA 2IE4A 3ZHPA 4I7IA 4I0YA 3Q0NA 5CL4A 3UKXB 3QG9A 5BZVA 4V3QA 4V3RA 2YJYA 4UAEA 1QGKA 4I6IA 2OF3A 1TE4A 4I3NA 3NMXA 4DB9A 4U5VA 3ZIPA 2VGLA 5H2WA 2IE3A 4BPLA 3VLFA 2JKTB 4U58A 2GL7A 4I2ZA 4XZRB 4OIHA 4FZFA 5KUBA 2QK2A 1M8XA 4QMIA 3ODSA 4YGXA 1IALA 3RZXA 1W63B 2NYLB 4A0CA 4HM9A 5CLAA 3GNIA 4CT7B 3AU3A 4IMJA 2C1MA 4U5NA 4B8OA 1XM9A 3T7UA 3JXYA 4FZAA 3VLEA 2JKTA 3BX3A 4V3OA 3GRLA 4K92A 2QNAA 3TT9A 3Q0PA 3TX7A 2H4MA 1EJLI 2RU4B 1V18A 4JW2B 1W63A 3SL9A 4UADA 2Z5OA 5K6SA 2NYLA 3JY1A 4YJLA 4I5LA 3C2HA 1I7XA 3Q0MA 4O27A 1BK5A 3O2SA 4B18A 3UL1B 3L3FX 5JJAA 4QMJA 3V71A 1M8ZA 3WOYA 4CT6B 3K5ZA 3L3QA 3ZIKA 4CRUB 4DZSA 4EV8A 5BZUA 4U5SA 5BZ5A 4NZWA 4PLQA 3TJ3A 3TPMA 2P8QA 1W9CA 3GQ2A 2RU4A 4JW2A 2WTKA 2NYMB 4P6ZB 1EJYI 2IX3A 3BX2A 1F59A 3Q0RA 3PSPA 4DBAA 3VWAA 3TPOA 5KL8A 5EKFA 3Q0LA 4DVGB 2NYMA 5CLDA 1JPWA 4QMHA 5AEIA 1I7WA 1IQ1C 4YJEA 3FEXC 5KLTB 1LUJA 3V74A 4H3KA 5BYMA 4I2WA 4Y5JA 2Z5KA 3L6YA 4CBAA 4PLSA 4R11A 2PF4A 3GB8A 5CLEA 4RZPA 2OT8A 3O2QA 1M8YA 1PJMB 2Z5NA 2Z6GA 2C1TA 1Q1TC 4HNMA 4G3AA 4LACA 4FQ3A 3ZIQA 3K62A 3O4XA 4I8MA 1UN0A 4U2XD 4CB9A 1WA5C 3PSTA 3TJZB 5HHGE 5B56A 4D49A 4TNMA 4UWXA 1OYZA 3ZIOA 4HXTA 4BQKA 5CL5A 2W3CA 3K61A 4B8PA 3ND2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5SVZ A;  4E4V A;  3K5Q A;  1QBK B;  4MZ5 E;  3K64 A;  3Q0Q A;  1U6G C;  2PKG A;  4U5L A;  4YI0 C;  4FFB C;  1QZ7 A;  1PJN B;  4EVT A;  1O6P A;  4DJS A;  4FZD A;  3UKZ B;  2F31 A;  4PVZ A;  1XQR A;  3BSB A;  1M1E A;  5BZ1 A;  4FDD A;  2NPP B;  1M8W A;  1GCJ A;  2JKR B;  2YNR A;  3NOW A;  3BWT A;  4H3H A;  4WV6 A;  3EG5 B;  1Q1S C;  4CB8 A;  3GVT A;  3OUX A;  3K5Y A;  3Q0O A;  2IWH A;  3DAD A;  4L7M A;  1XQS A;  1Z2C B;  2NPP A;  5J3V A;  2JKR A;  3BCT A;  3QML C;  2Z5M A;  3GVO A;  5D5K C;  3NMZ A;  3IBV A;  2JAK A;  5EKG A;  4GMO A;  3BTR C;  4HTV A;  5K9S A;  2BCT A;  3Q0S A;  2Q5D A;  1JPP A;  3EA5 B;  4R0Z A;  4BA3 A;  2IW3 A;  3L6X A;  3KND A;  3UKY B;  3A6P A;  4B8J A;  3LTJ A;  1EE4 A;  3OQS A;  1HO8 A;  2Z6H A;  2IAE B;  1M5N S;  3ZKV A;  1IBR B;  3UVU A;  3ZIR A;  4MZ6 E;  4RXH B;  3FGA B;  1UPK A;  4IMI A;  5HUW C;  3UL0 B;  3OBV A;  3K7V A;  3WOZ A;  4GMN A;  3QHE A;  5E6Q B;  3DW8 A;  2X1G F;  5KLA A;  2IAE A;  4UAF B;  4D4E A;  4ADY A;  4EV9 A;  3NMW A;  4YK6 A;  5KLR B;  5FC8 E;  4KZG A;  3RZ9 A;  3FGA A;  5CTT A;  3K49 A;  2BNX A;  3BSX A;  3H3D X;  3QGB A;  5SW9 A;  3WYF C;  4RV1 A;  1UPL A;  3FEY C;  4MFU A;  4U5O A;  1O6O A;  4DB8 A;  1G3J A;  4CV5 B;  3IFQ A;  2BKU B;  5EWP A;  2XA7 B;  4MFV A;  3C2G A;  3K7W A;  4UQI B;  3EBB A;  1QGR A;  4R10 A;  5HUY C;  2YNS A;  5DN7 A;  4P6Z G;  2QMR A;  2FV2 A;  4EVP A;  3WPT A;  2X19 B;  3W3U A;  5H2X A;  2JDQ A;  4U5U A;  3C5W A;  1Y2A C;  3V6Y A;  1BK6 A;  2XA7 A;  1B3U A;  3OUW A;  3LWW A;  5LSW A;  3ODR A;  3GS3 A;  4UQI A;  4DB6 A;  1IB2 A;  2BAP A;  4EVA A;  1EE5 A;  4CRV B;  3OPB A;  3QGC A;  1LRV A;  4I5N A;  3ZIN A;  4U54 A;  1JDH A;  1T08 A;  1WA5 B;  2QK1 A;  5KL1 A;  5SWF A;  4NEE A;  4OO6 A;  1TH1 A;  4JLQ A;  2DB0 A;  3O2T A;  3UKW B;  4ZDU A;  3LTM A;  4U3J C;  2VGL B;  3K4E A;  3VE6 A;  4PLR A;  1UKL A;  4K6J A;  2Z5J A;  3GAE A;  3Q5U A;  2IE4 A;  3ZHP A;  3Q0N A;  3UKX B;  3QG9 A;  5BZV A;  4V3Q A;  4V3R A;  2YJY A;  4UAE A;  1QGK A;  2OF3 A;  3NMX A;  4DB9 A;  4U5V A;  3ZIP A;  2VGL A;  5H2W A;  2IE3 A;  4BPL A;  2JKT B;  4U58 A;  2GL7 A;  4I2Z A;  4XZR B;  4OIH A;  4FZF A;  2QK2 A;  1M8X A;  4QMI A;  3ODS A;  4YGX A;  1IAL A;  3RZX A;  1W63 B;  2NYL B;  4A0C A;  4HM9 A;  3GNI A;  4CT7 B;  3AU3 A;  4IMJ A;  2C1M A;  4U5N A;  4B8O A;  1XM9 A;  3T7U A;  4FZA A;  2JKT A;  3BX3 A;  4V3O A;  3GRL A;  4K92 A;  2QNA A;  3TT9 A;  3Q0P A;  3TX7 A;  2H4M A;  1EJL I;  2RU4 B;  1V18 A;  4JW2 B;  1W63 A;  4UAD A;  2Z5O A;  5K6S A;  2NYL A;  4YJL A;  4I5L A;  3C2H A;  1I7X A;  3Q0M A;  4O27 A;  1BK5 A;  3O2S A;  4B18 A;  3UL1 B;  3L3F X;  5JJA A;  4QMJ A;  3V71 A;  1M8Z A;  3WOY A;  4CT6 B;  3K5Z A;  3L3Q A;  4CRU B;  4DZS A;  4EV8 A;  5BZU A;  4U5S A;  5BZ5 A;  4NZW A;  4PLQ A;  3TJ3 A;  3TPM A;  2P8Q A;  1W9C A;  3GQ2 A;  2RU4 A;  2WTK A;  2NYM B;  4P6Z B;  1EJY I;  2IX3 A;  3BX2 A;  1F59 A;  3Q0R A;  3PSP A;  4DBA A;  3VWA A;  3TPO A;  5KL8 A;  5EKF A;  3Q0L A;  4DVG B;  2NYM A;  1JPW A;  4QMH A;  5AEI A;  1I7W A;  1IQ1 C;  4YJE A;  3FEX C;  5KLT B;  1LUJ A;  3V74 A;  4H3K A;  5BYM A;  4I2W A;  4Y5J A;  2Z5K A;  3L6Y A;  4CBA A;  4PLS A;  4R11 A;  2PF4 A;  3GB8 A;  4RZP A;  2OT8 A;  3O2Q A;  1M8Y A;  1PJM B;  2Z5N A;  2Z6G A;  2C1T A;  1Q1T C;  4HNM A;  4G3A A;  4LAC A;  4FQ3 A;  3ZIQ A;  3K62 A;  3O4X A;  1UN0 A;  4CB9 A;  1WA5 C;  3PST A;  3TJZ B;  5HHG E;  5B56 A;  4D49 A;  4TNM A;  4UWX A;  1OYZ A;  3ZIO A;  4HXT A;  4BQK A;  2W3C A;  3K61 A;  4B8P A;  3ND2 A; 
#chains in the Genus database with same CATH topology
 5SVZ A;  4E4V A;  3K5Q A;  1QBK B;  4MZ5 E;  5CL3 A;  3K64 A;  3Q0Q A;  1U6G C;  2PKG A;  4U5L A;  4YI0 C;  4FFB C;  1QZ7 A;  1PJN B;  4EVT A;  1O6P A;  4DJS A;  4FZD A;  3UKZ B;  2F31 A;  4PVZ A;  1XQR A;  3BSB A;  2XOA A;  3ZIL A;  1M1E A;  5BZ1 A;  3T8S A;  4FDD A;  2NPP B;  1M8W A;  1GCJ A;  3JX7 A;  2JKR B;  2YNR A;  3NOW A;  3BWT A;  4H3H A;  4WV6 A;  3EG5 B;  1Q1S C;  4CB8 A;  3GVT A;  3OUX A;  3K5Y A;  3Q0O A;  4L4I A;  2IWH A;  3DAD A;  4L7M A;  1XQS A;  1Z2C B;  2NPP A;  5CL9 A;  5J3V A;  2JKR A;  3BCT A;  3QML C;  2Z5M A;  3GVO A;  5D5K C;  3NMZ A;  3IBV A;  2JAK A;  5EKG A;  4GMO A;  3BVS A;  3VLD A;  4I37 A;  3BTR C;  4HTV A;  5K9S A;  2BCT A;  3Q0S A;  2Q5D A;  1JPP A;  3EA5 B;  4I1E A;  4R0Z A;  4BA3 A;  2IW3 A;  3L6X A;  3KND A;  5CL7 A;  3UKY B;  3A6P A;  4B8J A;  3LTJ A;  1EE4 A;  3OQS A;  1HO8 A;  2Z6H A;  2IAE B;  4JW3 C;  1M5N S;  3ZKV A;  1IBR B;  3UVU A;  3ZIR A;  4MZ6 E;  4RXH B;  3FGA B;  1UPK A;  4IMI A;  5CL8 A;  5CLB A;  5HUW C;  3UL0 B;  3OBV A;  3K7V A;  3WOZ A;  4GMN A;  3QHE A;  5E6Q B;  3DW8 A;  4JKQ A;  2X1G F;  5KLA A;  2IAE A;  4UAF B;  3JXZ A;  4D4E A;  4ADY A;  4EV9 A;  3NMW A;  3UJ4 A;  4FP7 A;  4YK6 A;  5KLR B;  5FC8 E;  4A3V A;  4KZG A;  3RZ9 A;  3FGA A;  5CTT A;  3K49 A;  2BNX A;  3BSX A;  3H3D X;  3QGB A;  5SW9 A;  3WYF C;  4RV1 A;  5CLC A;  1UPL A;  3FEY C;  4MFU A;  4U5O A;  1O6O A;  4DB8 A;  1G3J A;  4CV5 B;  3IFQ A;  2BKU B;  4A3T A;  5EWP A;  2XA7 B;  4MFV A;  3C2G A;  3K7W A;  4UQI B;  4L4H A;  3EBB A;  1QGR A;  4R10 A;  4I2S A;  5HUY C;  2YNS A;  5DN7 A;  4P6Z G;  2QMR A;  2FV2 A;  4EVP A;  3WPT A;  2X19 B;  3W3U A;  5H2X A;  2JDQ A;  3SLA A;  4U5U A;  3C5W A;  1Y2A C;  3V6Y A;  1BK6 A;  2XA7 A;  1B3U A;  3OUW A;  3LWW A;  5LSW A;  3ODR A;  3GS3 A;  4UQI A;  4DB6 A;  1IB2 A;  3UJ0 A;  2BAP A;  4EVA A;  1EE5 A;  4CRV B;  3OPB A;  3QGC A;  1LRV A;  4I96 A;  4I5N A;  3ZIN A;  4U54 A;  1JDH A;  1T08 A;  1WA5 B;  2QK1 A;  5KL1 A;  5SWF A;  4NEE A;  4OO6 A;  1TH1 A;  4JLQ A;  2DB0 A;  3O2T A;  3UKW B;  4ZDU A;  3LTM A;  4U3J C;  2VGL B;  5CL6 A;  3K4E A;  3VE6 A;  4PLR A;  1UKL A;  4K6J A;  2Z5J A;  3GAE A;  3Q5U A;  2IE4 A;  3ZHP A;  4I7I A;  4I0Y A;  3Q0N A;  5CL4 A;  3UKX B;  3QG9 A;  5BZV A;  4V3Q A;  4V3R A;  2YJY A;  4UAE A;  1QGK A;  4I6I A;  2OF3 A;  1TE4 A;  4I3N A;  3NMX A;  4DB9 A;  4U5V A;  3ZIP A;  2VGL A;  5H2W A;  2IE3 A;  4BPL A;  3VLF A;  2JKT B;  4U58 A;  2GL7 A;  4I2Z A;  4XZR B;  4OIH A;  4FZF A;  5KUB A;  2QK2 A;  1M8X A;  4QMI A;  3ODS A;  4YGX A;  1IAL A;  3RZX A;  1W63 B;  2NYL B;  4A0C A;  4HM9 A;  5CLA A;  3GNI A;  4CT7 B;  3AU3 A;  4IMJ A;  2C1M A;  1N4K A;  4U5N A;  4B8O A;  1XM9 A;  3T7U A;  3JXY A;  4FZA A;  3VLE A;  2JKT A;  3BX3 A;  4V3O A;  3GRL A;  4K92 A;  2QNA A;  3TT9 A;  3Q0P A;  3TX7 A;  2H4M A;  1EJL I;  2RU4 B;  1V18 A;  4JW2 B;  1W63 A;  3SL9 A;  4UAD A;  2Z5O A;  5K6S A;  2NYL A;  3JY1 A;  4YJL A;  4I5L A;  3C2H A;  1I7X A;  3Q0M A;  4O27 A;  1BK5 A;  3O2S A;  4B18 A;  3UL1 B;  3L3F X;  5JJA A;  4QMJ A;  3V71 A;  1M8Z A;  3WOY A;  4CT6 B;  3K5Z A;  3L3Q A;  3ZIK A;  4CRU B;  4DZS A;  4EV8 A;  5BZU A;  4U5S A;  5BZ5 A;  4NZW A;  4PLQ A;  3TJ3 A;  3TPM A;  2P8Q A;  1W9C A;  3GQ2 A;  2RU4 A;  4JW2 A;  2WTK A;  2NYM B;  4P6Z B;  1EJY I;  2IX3 A;  3BX2 A;  1F59 A;  3Q0R A;  3PSP A;  4DBA A;  3VWA A;  3TPO A;  5KL8 A;  1LSH A;  5EKF A;  3Q0L A;  4DVG B;  2NYM A;  5CLD A;  1JPW A;  4QMH A;  5AEI A;  1I7W A;  1IQ1 C;  4YJE A;  3FEX C;  5KLT B;  1LUJ A;  3V74 A;  4H3K A;  5BYM A;  4I2W A;  4Y5J A;  2Z5K A;  3L6Y A;  4CBA A;  4PLS A;  4R11 A;  2PF4 A;  3GB8 A;  5CLE A;  4RZP A;  2OT8 A;  3O2Q A;  1M8Y A;  1PJM B;  2Z5N A;  2Z6G A;  2C1T A;  1Q1T C;  4HNM A;  4G3A A;  4LAC A;  4FQ3 A;  3ZIQ A;  3K62 A;  3O4X A;  4I8M A;  1UN0 A;  4U2X D;  4CB9 A;  1WA5 C;  3PST A;  3TJZ B;  5HHG E;  5B56 A;  4D49 A;  4TNM A;  4UWX A;  1OYZ A;  3ZIO A;  4HXT A;  4BQK A;  5CL5 A;  2W3C A;  3K61 A;  4B8P A;  3ND2 A; 
#chains in the Genus database with same CATH homology
 5SVZ A;  4E4V A;  3K5Q A;  1QBK B;  4MZ5 E;  5CL3 A;  3K64 A;  3Q0Q A;  1U6G C;  2PKG A;  4U5L A;  4YI0 C;  4FFB C;  1QZ7 A;  1PJN B;  4EVT A;  1O6P A;  4DJS A;  4FZD A;  3UKZ B;  2F31 A;  4PVZ A;  1XQR A;  3BSB A;  2XOA A;  3ZIL A;  1M1E A;  5BZ1 A;  4FDD A;  2NPP B;  1M8W A;  1GCJ A;  3JX7 A;  2JKR B;  2YNR A;  3NOW A;  3BWT A;  4H3H A;  4WV6 A;  3EG5 B;  1Q1S C;  4CB8 A;  3GVT A;  3OUX A;  3K5Y A;  3Q0O A;  4L4I A;  2IWH A;  3DAD A;  4L7M A;  1XQS A;  1Z2C B;  2NPP A;  5CL9 A;  5J3V A;  2JKR A;  3BCT A;  3QML C;  2Z5M A;  3GVO A;  5D5K C;  3NMZ A;  3IBV A;  2JAK A;  5EKG A;  4GMO A;  3BVS A;  3VLD A;  4I37 A;  3BTR C;  4HTV A;  5K9S A;  2BCT A;  3Q0S A;  2Q5D A;  1JPP A;  3EA5 B;  4I1E A;  4R0Z A;  4BA3 A;  2IW3 A;  3L6X A;  3KND A;  5CL7 A;  3UKY B;  3A6P A;  4B8J A;  3LTJ A;  1EE4 A;  3OQS A;  1HO8 A;  2Z6H A;  2IAE B;  4JW3 C;  1M5N S;  3ZKV A;  1IBR B;  3UVU A;  3ZIR A;  4MZ6 E;  4RXH B;  3FGA B;  1UPK A;  4IMI A;  5CL8 A;  5CLB A;  5HUW C;  3UL0 B;  3OBV A;  3K7V A;  3WOZ A;  4GMN A;  3QHE A;  5E6Q B;  3DW8 A;  4JKQ A;  2X1G F;  5KLA A;  2IAE A;  4UAF B;  3JXZ A;  4D4E A;  4ADY A;  4EV9 A;  3NMW A;  4FP7 A;  4YK6 A;  5KLR B;  5FC8 E;  4A3V A;  4KZG A;  3RZ9 A;  3FGA A;  5CTT A;  3K49 A;  2BNX A;  3BSX A;  3H3D X;  3QGB A;  5SW9 A;  3WYF C;  4RV1 A;  5CLC A;  1UPL A;  3FEY C;  4MFU A;  4U5O A;  1O6O A;  4DB8 A;  1G3J A;  4CV5 B;  3IFQ A;  2BKU B;  4A3T A;  5EWP A;  2XA7 B;  4MFV A;  3C2G A;  3K7W A;  4UQI B;  4L4H A;  3EBB A;  1QGR A;  4R10 A;  4I2S A;  5HUY C;  2YNS A;  5DN7 A;  4P6Z G;  2QMR A;  2FV2 A;  4EVP A;  3WPT A;  2X19 B;  3W3U A;  5H2X A;  2JDQ A;  3SLA A;  4U5U A;  3C5W A;  1Y2A C;  3V6Y A;  1BK6 A;  2XA7 A;  1B3U A;  3OUW A;  3LWW A;  5LSW A;  3ODR A;  3GS3 A;  4UQI A;  4DB6 A;  1IB2 A;  2BAP A;  4EVA A;  1EE5 A;  4CRV B;  3OPB A;  3QGC A;  1LRV A;  4I96 A;  4I5N A;  3ZIN A;  4U54 A;  1JDH A;  1T08 A;  1WA5 B;  2QK1 A;  5KL1 A;  5SWF A;  4NEE A;  4OO6 A;  1TH1 A;  4JLQ A;  2DB0 A;  3O2T A;  3UKW B;  4ZDU A;  3LTM A;  4U3J C;  2VGL B;  5CL6 A;  3K4E A;  3VE6 A;  4PLR A;  1UKL A;  4K6J A;  2Z5J A;  3GAE A;  3Q5U A;  2IE4 A;  3ZHP A;  4I7I A;  4I0Y A;  3Q0N A;  5CL4 A;  3UKX B;  3QG9 A;  5BZV A;  4V3Q A;  4V3R A;  2YJY A;  4UAE A;  1QGK A;  4I6I A;  2OF3 A;  1TE4 A;  4I3N A;  3NMX A;  4DB9 A;  4U5V A;  3ZIP A;  2VGL A;  5H2W A;  2IE3 A;  4BPL A;  3VLF A;  2JKT B;  4U58 A;  2GL7 A;  4I2Z A;  4XZR B;  4OIH A;  4FZF A;  5KUB A;  2QK2 A;  1M8X A;  4QMI A;  3ODS A;  4YGX A;  1IAL A;  3RZX A;  1W63 B;  2NYL B;  4A0C A;  4HM9 A;  5CLA A;  3GNI A;  4CT7 B;  3AU3 A;  4IMJ A;  2C1M A;  4U5N A;  4B8O A;  1XM9 A;  3T7U A;  3JXY A;  4FZA A;  3VLE A;  2JKT A;  3BX3 A;  4V3O A;  3GRL A;  4K92 A;  2QNA A;  3TT9 A;  3Q0P A;  3TX7 A;  2H4M A;  1EJL I;  2RU4 B;  1V18 A;  4JW2 B;  1W63 A;  3SL9 A;  4UAD A;  2Z5O A;  5K6S A;  2NYL A;  3JY1 A;  4YJL A;  4I5L A;  3C2H A;  1I7X A;  3Q0M A;  4O27 A;  1BK5 A;  3O2S A;  4B18 A;  3UL1 B;  3L3F X;  5JJA A;  4QMJ A;  3V71 A;  1M8Z A;  3WOY A;  4CT6 B;  3K5Z A;  3L3Q A;  3ZIK A;  4CRU B;  4DZS A;  4EV8 A;  5BZU A;  4U5S A;  5BZ5 A;  4NZW A;  4PLQ A;  3TJ3 A;  3TPM A;  2P8Q A;  1W9C A;  3GQ2 A;  2RU4 A;  4JW2 A;  2WTK A;  2NYM B;  4P6Z B;  1EJY I;  2IX3 A;  3BX2 A;  1F59 A;  3Q0R A;  3PSP A;  4DBA A;  3VWA A;  3TPO A;  5KL8 A;  5EKF A;  3Q0L A;  4DVG B;  2NYM A;  5CLD A;  1JPW A;  4QMH A;  5AEI A;  1I7W A;  1IQ1 C;  4YJE A;  3FEX C;  5KLT B;  1LUJ A;  3V74 A;  4H3K A;  5BYM A;  4I2W A;  4Y5J A;  2Z5K A;  3L6Y A;  4CBA A;  4PLS A;  4R11 A;  2PF4 A;  3GB8 A;  5CLE A;  4RZP A;  2OT8 A;  3O2Q A;  1M8Y A;  1PJM B;  2Z5N A;  2Z6G A;  2C1T A;  1Q1T C;  4HNM A;  4G3A A;  4LAC A;  4FQ3 A;  3ZIQ A;  3K62 A;  3O4X A;  4I8M A;  1UN0 A;  4U2X D;  4CB9 A;  1WA5 C;  3PST A;  3TJZ B;  5HHG E;  5B56 A;  4D49 A;  4TNM A;  4UWX A;  1OYZ A;  3ZIO A;  4HXT A;  4BQK A;  5CL5 A;  2W3C A;  3K61 A;  4B8P A;  3ND2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...