3BX3A

Puf4 t650c/c724r mutant bound to cox17 rna 3' utr recognition sequence
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
325
structure length
325
Chain Sequence
DQYIGSIHSLCKDQHGCRFLQKQLDILGSKAADAIFEETKDYTVELMTDSFGNYLIQKLLEEVTTEQRIVLTKISSPHFVEISLNPHGCRALQKLIECIKTDEEAQIVVDSLRPYTVQLSKDLNGNHVIQKCLQRLKPENFQFIFDAISDSCIDIATHRHGCRVLQRCLDHGTTEQCDNLCDKLLALVDKLTLDPFGNYVVQYIITKEAEKNKYDYTHKIVHLLKPRAIELSIHKFGSNVIEKILKTAIVSEPMILEILNNGGETGIQSLLNDSYGNYVLQTALDISHKQNDYLYKRLSEIVAPLLVGPIRNTPHGKRIIGMLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COX17 RNA target sequence
publication title Basis of altered RNA-binding specificity by PUF proteins revealed by crystal structures of yeast Puf4p
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription, rna binding protein/rna
total genus 108
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00806 PUF Pumilio-family RNA binding repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 3bx3A00
3TJ3A 3GAEA 1M8XA 3NMXA 2Z5OA 4MZ6E 5KL1A 5KL8A 2Z6GA 5HHGE 4BQKA 3BSBA 4BA3A 2BAPA 2XA7A 4UAFB 4P6ZB 2IW3A 2Z5JA 4GMNA 3ND2A 4I2ZA 1U6GC 2XA7B 2QMRA 4YGXA 4H3HA 4FZAA 3QHEA 3C2GA 3L6XA 3BCTA 1QZ7A 3NMWA 4PVZA 4H3KA 3O2TA 4EVPA 2BCTA 3OPBA 3ZIRA 4I5LA 5DN7A 3Q0QA 1Q1TC 5KLTB 3PSPA 2IE3A 3QG9A 3Q0RA 4U3JC 1WA5B 3AU3A 3UKZB 2OF3A 5E6QB 3ZINA 1PJMB 3GNIA 3T7UA 4I2WA 2PF4A 1T08A 2NPPB 3FEYC 3NMZA 5D5KC 3O2QA 1JPPA 1EE5A 2NYMA 2JKRA 4D49A 4E4VA 4K92A 4U5VA 3ZIPA 1GCJA 3IBVA 1IB2A 1B3UA 4K6JA 3ODRA 3GQ2A 3Q5UA 2WTKA 5H2XA 3TJZB 4U5NA 1UN0A 3BX2A 3GRLA 4B8OA 5AEIA 1EJYI 3EG5B 3V74A 2YJYA 3DW8A 2RU4A 1TH1A 5LSWA 3BSXA 1QBKB 4QMIA 3K7WA 4LACA 1M5NS 5SWFA 1IQ1C 4EV9A 3V71A 3QGBA 2IX3A 3EBBA 2JAKA 4JLQA 4RZPA 4MFVA 4EV8A 3GS3A 3K4EA 4U5OA 2Z5KA 3UL0B 3IFQA 3BTRC 3K5YA 1XM9A 1W9CA 1I7WA 3Q0LA 3Q0OA 4YI0C 2JDQA 3Q0NA 5BZUA 3BWTA 1EE4A 2QK1A 4IMIA 4A0CA 3GVTA 4FDDA 4OO6A 3OUXA 4CB8A 4FZFA 1XQRA 4DBAA 1G3JA 1BK6A 3UKXB 1M1EA 1LRVA 1Z2CB 4WV6A 4DZSA 4DJSA 3LTMA 3K5ZA 4DB9A 4DVGB 1WA5C 1JPWA 1IALA 4UWXA 4O27A 4DB8A 2IWHA 4R11A 1JDHA 4QMJA 2F31A 4TNMA 2NPPA 4Y5JA 2H4MA 4OIHA 3EA5B 1UPLA 1W63B 3ZKVA 3W3UA 4CT6B 4RXHB 4PLSA 3TT9A 4CRVB 2GL7A 4RV1A 4R0ZA 2P8QA 4U5LA 1OYZA 4IMJA 3L3QA 1IBRB 3Q0SA 2VGLA 3K7VA 3O4XA 5K6SA 5CTTA 2JKTA 3V6YA 1F59A 4FFBC 4HM9A 3A6PA 4HTVA 4U58A 2IAEA 2VGLB 4U54A 4MZ5E 5FC8E 3FGAA 2JKTB 1QGKA 4QMHA 3OBVA 4EVTA 4CV5B 3GB8A 2BKUB 2Q5DA 4JW2B 2IAEB 2NYLB 3TPOA 3ZHPA 4YJEA 3K64A 3FGAB 3WYFC 1EJLI 4B8JA 4UAEA 4CB9A 1M8WA 4NEEA 2FV2A 4ADYA 4BPLA 5KLRB 4UQIB 2X19B 4PLQA 3UVUA 1M8ZA 2YNSA 4B18A 1Q1SC 1O6PA 1V18A 2DB0A 4V3RA 3NOWA 3UL1B 4ZDUA 5HUWC 3RZ9A 3ZIQA 1HO8A 4U5SA 3QMLC 2YNRA 4XZRB 5K9SA 5SW9A 3Q0MA 4P6ZG 4NZWA 3LTJA 3K49A 2QK2A 3Q0PA 3KNDA 2IE4A 5H2WA 1PJNB 5EKGA 5JJAA 3LWWA 1UKLA 3C2HA 5BZVA 4MFUA 3K62A 3FEXC 5EWPA 3L6YA 3DADA 2C1TA 5EKFA 4KZGA 3WOZA 5KLAA 4V3OA 3C5WA 4I5NA 3TX7A 5HUYC 3UKYB 5SVZA 4D4EA 3K61A 3VE6A 4HNMA 4G3AA 2Z6HA 4EVAA 1LUJA 3OQSA 4HXTA 3RZXA 4DB6A 5BZ1A 1W63A 4PLRA 4CT7B 3O2SA 1XQSA 1UPKA 4R10A 3GVOA 3QGCA 3WOYA 2W3CA 5J3VA 2C1MA 1O6OA 1I7XA 3BX3A 3K5QA 2BNXA 3VWAA 1QGRA 3L3FX 2PKGA 4FZDA 3ZIOA 4CRUB 3OUWA 5B56A 2NYLA 4UADA 1Y2AC 4YK6A 2Z5NA 4GMOA 2NYMB 2JKRB 3PSTA 4V3QA 4L7MA 3WPTA 4U5UA 1BK5A 2X1GF 3UKWB 4UQIA 2OT8A 4CBAA 5BYMA 3TPMA 3H3DX 2QNAA 4B8PA 5BZ5A 4FQ3A 4YJLA 2Z5MA 3ODSA 2RU4B 1M8YA
chains in the Genus database with same CATH superfamily
3TJ3A 3GAEA 1M8XA 3NMXA 2Z5OA 4MZ6E 5KL1A 5KL8A 2Z6GA 5HHGE 4BQKA 3BSBA 4BA3A 2BAPA 2XA7A 5KUBA 4UAFB 1N4KA 4P6ZB 2IW3A 2Z5JA 4GMNA 3ND2A 4I2ZA 1U6GC 2XA7B 2QMRA 4YGXA 4H3HA 4FZAA 3QHEA 3C2GA 3L6XA 3BCTA 4I37A 1QZ7A 3NMWA 4PVZA 4H3KA 3O2TA 4EVPA 2BCTA 3OPBA 4I0YA 3ZIRA 4I5LA 3UJ4A 5DN7A 3Q0QA 1Q1TC 5KLTB 3PSPA 2IE3A 3QG9A 3Q0RA 4I1EA 1WA5B 4U3JC 3AU3A 3UKZB 2OF3A 5E6QB 3ZINA 1PJMB 3GNIA 3T7UA 4I2WA 2PF4A 1T08A 2NPPB 3FEYC 3NMZA 5D5KC 3O2QA 1JPPA 1EE5A 2NYMA 2JKRA 4I8MA 4D49A 4E4VA 4K92A 4U5VA 5CLDA 3ZIPA 1GCJA 5CLAA 3IBVA 1IB2A 1B3UA 4K6JA 3ODRA 3GQ2A 3Q5UA 2WTKA 5H2XA 3TJZB 4U5NA 1UN0A 3BX2A 3VLEA 3GRLA 4B8OA 5AEIA 1EJYI 3EG5B 3V74A 2YJYA 3DW8A 2RU4A 1TH1A 5LSWA 3BSXA 1QBKB 4QMIA 3K7WA 4LACA 1M5NS 5SWFA 3JX7A 1IQ1C 4EV9A 3V71A 3QGBA 2IX3A 3JXYA 3EBBA 2JAKA 4JLQA 4RZPA 4MFVA 4EV8A 3GS3A 3K4EA 4U5OA 3UL0B 2Z5KA 3IFQA 3BTRC 3K5YA 1XM9A 5CLCA 3SL9A 1W9CA 1I7WA 3Q0LA 3Q0OA 4YI0C 2JDQA 3Q0NA 5BZUA 3BWTA 5CL4A 1EE4A 2QK1A 4IMIA 4A0CA 3GVTA 4FDDA 4OO6A 3OUXA 4CB8A 4FZFA 1XQRA 4DBAA 1LSHA 1G3JA 1BK6A 3UKXB 1M1EA 4L4IA 4A3TA 1LRVA 1Z2CB 4WV6A 4DZSA 4DJSA 1TE4A 3LTMA 3K5ZA 4DB9A 4DVGB 1WA5C 4A3VA 1JPWA 5CL5A 1IALA 4UWXA 4O27A 4DB8A 2IWHA 4R11A 1JDHA 4QMJA 2F31A 4TNMA 2NPPA 4Y5JA 2H4MA 4OIHA 5CL7A 3EA5B 1UPLA 1W63B 3ZKVA 3W3UA 4CT6B 4RXHB 5CLEA 4PLSA 3TT9A 4CRVB 2GL7A 4RV1A 4R0ZA 2P8QA 4U5LA 1OYZA 4IMJA 3L3QA 1IBRB 3Q0SA 2VGLA 3K7VA 3O4XA 5K6SA 5CTTA 2JKTA 3V6YA 1F59A 4FFBC 4HM9A 3A6PA 4HTVA 4JW2A 4U58A 2IAEA 2VGLB 4U54A 4MZ5E 5FC8E 3FGAA 2JKTB 1QGKA 4I2SA 3OBVA 4QMHA 4CV5B 4EVTA 3GB8A 2BKUB 2Q5DA 4JW2B 2IAEB 2NYLB 3TPOA 3ZHPA 4YJEA 3K64A 3FGAB 3WYFC 1EJLI 4B8JA 4UAEA 4CB9A 1M8WA 4NEEA 2FV2A 4ADYA 4BPLA 5KLRB 4UQIB 2X19B 4PLQA 3UVUA 1M8ZA 2YNSA 4B18A 1Q1SC 1O6PA 1V18A 2DB0A 4V3RA 3NOWA 3UL1B 4ZDUA 5HUWC 3RZ9A 3ZIQA 1HO8A 3BVSA 4U5SA 3QMLC 2YNRA 4XZRB 5K9SA 5SW9A 3Q0MA 4P6ZG 4NZWA 3LTJA 3K49A 2QK2A 4I3NA 3Q0PA 3KNDA 3T8SA 2IE4A 5H2WA 1PJNB 5EKGA 5JJAA 3LWWA 1UKLA 3C2HA 5BZVA 4MFUA 3K62A 4I96A 3FEXC 5EWPA 5CL9A 3L6YA 3DADA 2C1TA 5EKFA 4KZGA 3ZIKA 3WOZA 5KLAA 4V3OA 3C5WA 3JY1A 4U2XD 4I5NA 3TX7A 3UJ0A 5HUYC 3UKYB 5SVZA 4D4EA 3VLDA 3VLFA 3K61A 3VE6A 4HNMA 4G3AA 5CL6A 2Z6HA 4EVAA 2XOAA 1LUJA 3OQSA 5CLBA 4HXTA 3RZXA 4DB6A 5BZ1A 1W63A 4PLRA 4JW3C 4CT7B 3ZILA 3O2SA 1XQSA 1UPKA 4R10A 3GVOA 3SLAA 3QGCA 3WOYA 2W3CA 5J3VA 2C1MA 1O6OA 5CL3A 1I7XA 3BX3A 3K5QA 2BNXA 3VWAA 1QGRA 3L3FX 2PKGA 3JXZA 4FZDA 3ZIOA 4CRUB 3OUWA 5B56A 2NYLA 4UADA 1Y2AC 4YK6A 2Z5NA 4GMOA 2NYMB 2JKRB 3PSTA 4V3QA 4L7MA 4I7IA 5CL8A 3WPTA 4U5UA 1BK5A 2X1GF 3UKWB 4UQIA 2OT8A 4JKQA 4CBAA 4FP7A 5BYMA 3TPMA 3H3DX 2QNAA 4B8PA 4L4HA 5BZ5A 4FQ3A 4YJLA 2Z5MA 3ODSA 2RU4B 1M8YA 4I6IA
chains in the Genus database with same CATH topology
3TJ3A 3GAEA 1M8XA 3NMXA 2Z5OA 4MZ6E 5KL1A 5KL8A 2Z6GA 5HHGE 4BQKA 3BSBA 4BA3A 2BAPA 2XA7A 5KUBA 4UAFB 4P6ZB 2IW3A 2Z5JA 4GMNA 3ND2A 4I2ZA 1U6GC 2XA7B 2QMRA 4YGXA 4H3HA 4FZAA 3QHEA 3C2GA 3L6XA 3BCTA 4I37A 1QZ7A 3NMWA 4PVZA 4H3KA 3O2TA 4EVPA 2BCTA 3OPBA 4I0YA 3ZIRA 4I5LA 5DN7A 3Q0QA 1Q1TC 5KLTB 3PSPA 2IE3A 3QG9A 3Q0RA 4I1EA 1WA5B 4U3JC 3AU3A 3UKZB 2OF3A 5E6QB 3ZINA 1PJMB 3GNIA 3T7UA 4I2WA 2PF4A 1T08A 2NPPB 3FEYC 3NMZA 5D5KC 3O2QA 1JPPA 1EE5A 2NYMA 2JKRA 4I8MA 4D49A 4E4VA 4K92A 4U5VA 5CLDA 3ZIPA 1GCJA 5CLAA 3IBVA 1IB2A 1B3UA 4K6JA 3ODRA 3GQ2A 3Q5UA 2WTKA 5H2XA 3TJZB 4U5NA 1UN0A 3BX2A 3VLEA 3GRLA 4B8OA 5AEIA 1EJYI 3EG5B 3V74A 2YJYA 3DW8A 2RU4A 1TH1A 5LSWA 3BSXA 1QBKB 4QMIA 3K7WA 4LACA 1M5NS 5SWFA 3JX7A 1IQ1C 4EV9A 3V71A 3QGBA 2IX3A 3JXYA 3EBBA 2JAKA 4JLQA 4RZPA 4MFVA 4EV8A 3GS3A 3K4EA 4U5OA 3UL0B 2Z5KA 3IFQA 3BTRC 3K5YA 1XM9A 5CLCA 3SL9A 1W9CA 1I7WA 3Q0LA 3Q0OA 4YI0C 2JDQA 3Q0NA 5BZUA 3BWTA 5CL4A 1EE4A 2QK1A 4IMIA 4A0CA 3GVTA 4FDDA 4OO6A 3OUXA 4CB8A 4FZFA 1XQRA 4DBAA 1G3JA 1BK6A 3UKXB 1M1EA 4L4IA 4A3TA 1LRVA 1Z2CB 4WV6A 4DZSA 4DJSA 1TE4A 3LTMA 3K5ZA 4DB9A 4DVGB 1WA5C 4A3VA 1JPWA 5CL5A 1IALA 4UWXA 4O27A 4DB8A 2IWHA 4R11A 1JDHA 4QMJA 2F31A 4TNMA 2NPPA 4Y5JA 2H4MA 4OIHA 5CL7A 3EA5B 1UPLA 1W63B 3ZKVA 3W3UA 4CT6B 4RXHB 5CLEA 4PLSA 3TT9A 4CRVB 2GL7A 4RV1A 4R0ZA 2P8QA 4U5LA 1OYZA 4IMJA 3L3QA 1IBRB 3Q0SA 2VGLA 3K7VA 3O4XA 5K6SA 5CTTA 2JKTA 3V6YA 1F59A 4FFBC 4HM9A 3A6PA 4HTVA 4JW2A 4U58A 2IAEA 2VGLB 4U54A 4MZ5E 5FC8E 3FGAA 2JKTB 1QGKA 4I2SA 3OBVA 4QMHA 4CV5B 4EVTA 3GB8A 2BKUB 2Q5DA 4JW2B 2IAEB 2NYLB 3TPOA 3ZHPA 4YJEA 3K64A 3FGAB 3WYFC 1EJLI 4B8JA 4UAEA 4CB9A 1M8WA 4NEEA 2FV2A 4ADYA 4BPLA 5KLRB 4UQIB 2X19B 4PLQA 3UVUA 1M8ZA 2YNSA 4B18A 1Q1SC 1O6PA 1V18A 2DB0A 4V3RA 3NOWA 3UL1B 4ZDUA 5HUWC 3RZ9A 3ZIQA 1HO8A 3BVSA 4U5SA 3QMLC 2YNRA 4XZRB 5K9SA 5SW9A 3Q0MA 4P6ZG 4NZWA 3LTJA 3K49A 2QK2A 4I3NA 3Q0PA 3KNDA 2IE4A 5H2WA 1PJNB 5EKGA 5JJAA 3LWWA 1UKLA 3C2HA 5BZVA 4MFUA 3K62A 4I96A 3FEXC 5EWPA 5CL9A 3L6YA 3DADA 2C1TA 5EKFA 4KZGA 3ZIKA 3WOZA 5KLAA 4V3OA 3C5WA 3JY1A 4U2XD 4I5NA 3TX7A 5HUYC 3UKYB 5SVZA 4D4EA 3VLDA 3VLFA 3K61A 3VE6A 4HNMA 4G3AA 5CL6A 2Z6HA 4EVAA 2XOAA 1LUJA 3OQSA 5CLBA 4HXTA 3RZXA 4DB6A 5BZ1A 1W63A 4PLRA 4JW3C 4CT7B 3ZILA 3O2SA 1XQSA 1UPKA 4R10A 3GVOA 3SLAA 3QGCA 3WOYA 2W3CA 5J3VA 2C1MA 1O6OA 5CL3A 1I7XA 3BX3A 3K5QA 2BNXA 3VWAA 1QGRA 3L3FX 2PKGA 3JXZA 4FZDA 3ZIOA 4CRUB 3OUWA 5B56A 2NYLA 4UADA 1Y2AC 4YK6A 2Z5NA 4GMOA 2NYMB 2JKRB 3PSTA 4V3QA 4L7MA 4I7IA 5CL8A 3WPTA 4U5UA 1BK5A 2X1GF 3UKWB 4UQIA 2OT8A 4JKQA 4CBAA 4FP7A 5BYMA 3TPMA 3H3DX 2QNAA 4B8PA 4L4HA 5BZ5A 4FQ3A 4YJLA 2Z5MA 3ODSA 2RU4B 1M8YA 4I6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJ3 A;  3GAE A;  1M8X A;  3NMX A;  2Z5O A;  4MZ6 E;  5KL1 A;  5KL8 A;  2Z6G A;  5HHG E;  4BQK A;  3BSB A;  4BA3 A;  2BAP A;  2XA7 A;  4UAF B;  4P6Z B;  2IW3 A;  2Z5J A;  4GMN A;  3ND2 A;  4I2Z A;  1U6G C;  2XA7 B;  2QMR A;  4YGX A;  4H3H A;  4FZA A;  3QHE A;  3C2G A;  3L6X A;  3BCT A;  1QZ7 A;  3NMW A;  4PVZ A;  4H3K A;  3O2T A;  4EVP A;  2BCT A;  3OPB A;  3ZIR A;  4I5L A;  5DN7 A;  3Q0Q A;  1Q1T C;  5KLT B;  3PSP A;  2IE3 A;  3QG9 A;  3Q0R A;  4U3J C;  1WA5 B;  3AU3 A;  3UKZ B;  2OF3 A;  5E6Q B;  3ZIN A;  1PJM B;  3GNI A;  3T7U A;  4I2W A;  2PF4 A;  1T08 A;  2NPP B;  3FEY C;  3NMZ A;  5D5K C;  3O2Q A;  1JPP A;  1EE5 A;  2NYM A;  2JKR A;  4D49 A;  4E4V A;  4K92 A;  4U5V A;  3ZIP A;  1GCJ A;  3IBV A;  1IB2 A;  1B3U A;  4K6J A;  3ODR A;  3GQ2 A;  3Q5U A;  2WTK A;  5H2X A;  3TJZ B;  4U5N A;  1UN0 A;  3BX2 A;  3GRL A;  4B8O A;  5AEI A;  1EJY I;  3EG5 B;  3V74 A;  2YJY A;  3DW8 A;  2RU4 A;  1TH1 A;  5LSW A;  3BSX A;  1QBK B;  4QMI A;  3K7W A;  4LAC A;  1M5N S;  5SWF A;  1IQ1 C;  4EV9 A;  3V71 A;  3QGB A;  2IX3 A;  3EBB A;  2JAK A;  4JLQ A;  4RZP A;  4MFV A;  4EV8 A;  3GS3 A;  3K4E A;  4U5O A;  2Z5K A;  3UL0 B;  3IFQ A;  3BTR C;  3K5Y A;  1XM9 A;  1W9C A;  1I7W A;  3Q0L A;  3Q0O A;  4YI0 C;  2JDQ A;  3Q0N A;  5BZU A;  3BWT A;  1EE4 A;  2QK1 A;  4IMI A;  4A0C A;  3GVT A;  4FDD A;  4OO6 A;  3OUX A;  4CB8 A;  4FZF A;  1XQR A;  4DBA A;  1G3J A;  1BK6 A;  3UKX B;  1M1E A;  1LRV A;  1Z2C B;  4WV6 A;  4DZS A;  4DJS A;  3LTM A;  3K5Z A;  4DB9 A;  4DVG B;  1WA5 C;  1JPW A;  1IAL A;  4UWX A;  4O27 A;  4DB8 A;  2IWH A;  4R11 A;  1JDH A;  4QMJ A;  2F31 A;  4TNM A;  2NPP A;  4Y5J A;  2H4M A;  4OIH A;  3EA5 B;  1UPL A;  1W63 B;  3ZKV A;  3W3U A;  4CT6 B;  4RXH B;  4PLS A;  3TT9 A;  4CRV B;  2GL7 A;  4RV1 A;  4R0Z A;  2P8Q A;  4U5L A;  1OYZ A;  4IMJ A;  3L3Q A;  1IBR B;  3Q0S A;  2VGL A;  3K7V A;  3O4X A;  5K6S A;  5CTT A;  2JKT A;  3V6Y A;  1F59 A;  4FFB C;  4HM9 A;  3A6P A;  4HTV A;  4U58 A;  2IAE A;  2VGL B;  4U54 A;  4MZ5 E;  5FC8 E;  3FGA A;  2JKT B;  1QGK A;  4QMH A;  3OBV A;  4EVT A;  4CV5 B;  3GB8 A;  2BKU B;  2Q5D A;  4JW2 B;  2IAE B;  2NYL B;  3TPO A;  3ZHP A;  4YJE A;  3K64 A;  3FGA B;  3WYF C;  1EJL I;  4B8J A;  4UAE A;  4CB9 A;  1M8W A;  4NEE A;  2FV2 A;  4ADY A;  4BPL A;  5KLR B;  4UQI B;  2X19 B;  4PLQ A;  3UVU A;  1M8Z A;  2YNS A;  4B18 A;  1Q1S C;  1O6P A;  1V18 A;  2DB0 A;  4V3R A;  3NOW A;  3UL1 B;  4ZDU A;  5HUW C;  3RZ9 A;  3ZIQ A;  1HO8 A;  4U5S A;  3QML C;  2YNR A;  4XZR B;  5K9S A;  5SW9 A;  3Q0M A;  4P6Z G;  4NZW A;  3LTJ A;  3K49 A;  2QK2 A;  3Q0P A;  3KND A;  2IE4 A;  5H2W A;  1PJN B;  5EKG A;  5JJA A;  3LWW A;  1UKL A;  3C2H A;  5BZV A;  4MFU A;  3K62 A;  3FEX C;  5EWP A;  3L6Y A;  3DAD A;  2C1T A;  5EKF A;  4KZG A;  3WOZ A;  5KLA A;  4V3O A;  3C5W A;  4I5N A;  3TX7 A;  5HUY C;  3UKY B;  5SVZ A;  4D4E A;  3K61 A;  3VE6 A;  4HNM A;  4G3A A;  2Z6H A;  4EVA A;  1LUJ A;  3OQS A;  4HXT A;  3RZX A;  4DB6 A;  5BZ1 A;  1W63 A;  4PLR A;  4CT7 B;  3O2S A;  1XQS A;  1UPK A;  4R10 A;  3GVO A;  3QGC A;  3WOY A;  2W3C A;  5J3V A;  2C1M A;  1O6O A;  1I7X A;  3BX3 A;  3K5Q A;  2BNX A;  3VWA A;  1QGR A;  3L3F X;  2PKG A;  4FZD A;  3ZIO A;  4CRU B;  3OUW A;  5B56 A;  2NYL A;  4UAD A;  1Y2A C;  4YK6 A;  2Z5N A;  4GMO A;  2NYM B;  2JKR B;  3PST A;  4V3Q A;  4L7M A;  3WPT A;  4U5U A;  1BK5 A;  2X1G F;  3UKW B;  4UQI A;  2OT8 A;  4CBA A;  5BYM A;  3TPM A;  3H3D X;  2QNA A;  4B8P A;  5BZ5 A;  4FQ3 A;  4YJL A;  2Z5M A;  3ODS A;  2RU4 B;  1M8Y A; 
#chains in the Genus database with same CATH topology
 3TJ3 A;  3GAE A;  1M8X A;  3NMX A;  2Z5O A;  4MZ6 E;  5KL1 A;  5KL8 A;  2Z6G A;  5HHG E;  4BQK A;  3BSB A;  4BA3 A;  2BAP A;  2XA7 A;  5KUB A;  4UAF B;  1N4K A;  4P6Z B;  2IW3 A;  2Z5J A;  4GMN A;  3ND2 A;  4I2Z A;  1U6G C;  2XA7 B;  2QMR A;  4YGX A;  4H3H A;  4FZA A;  3QHE A;  3C2G A;  3L6X A;  3BCT A;  4I37 A;  1QZ7 A;  3NMW A;  4PVZ A;  4H3K A;  3O2T A;  4EVP A;  2BCT A;  3OPB A;  4I0Y A;  3ZIR A;  4I5L A;  3UJ4 A;  5DN7 A;  3Q0Q A;  1Q1T C;  5KLT B;  3PSP A;  2IE3 A;  3QG9 A;  3Q0R A;  4I1E A;  1WA5 B;  4U3J C;  3AU3 A;  3UKZ B;  2OF3 A;  5E6Q B;  3ZIN A;  1PJM B;  3GNI A;  3T7U A;  4I2W A;  2PF4 A;  1T08 A;  2NPP B;  3FEY C;  3NMZ A;  5D5K C;  3O2Q A;  1JPP A;  1EE5 A;  2NYM A;  2JKR A;  4I8M A;  4D49 A;  4E4V A;  4K92 A;  4U5V A;  5CLD A;  3ZIP A;  1GCJ A;  5CLA A;  3IBV A;  1IB2 A;  1B3U A;  4K6J A;  3ODR A;  3GQ2 A;  3Q5U A;  2WTK A;  5H2X A;  3TJZ B;  4U5N A;  1UN0 A;  3BX2 A;  3VLE A;  3GRL A;  4B8O A;  5AEI A;  1EJY I;  3EG5 B;  3V74 A;  2YJY A;  3DW8 A;  2RU4 A;  1TH1 A;  5LSW A;  3BSX A;  1QBK B;  4QMI A;  3K7W A;  4LAC A;  1M5N S;  5SWF A;  3JX7 A;  1IQ1 C;  4EV9 A;  3V71 A;  3QGB A;  2IX3 A;  3JXY A;  3EBB A;  2JAK A;  4JLQ A;  4RZP A;  4MFV A;  4EV8 A;  3GS3 A;  3K4E A;  4U5O A;  3UL0 B;  2Z5K A;  3IFQ A;  3BTR C;  3K5Y A;  1XM9 A;  5CLC A;  3SL9 A;  1W9C A;  1I7W A;  3Q0L A;  3Q0O A;  4YI0 C;  2JDQ A;  3Q0N A;  5BZU A;  3BWT A;  5CL4 A;  1EE4 A;  2QK1 A;  4IMI A;  4A0C A;  3GVT A;  4FDD A;  4OO6 A;  3OUX A;  4CB8 A;  4FZF A;  1XQR A;  4DBA A;  1LSH A;  1G3J A;  1BK6 A;  3UKX B;  1M1E A;  4L4I A;  4A3T A;  1LRV A;  1Z2C B;  4WV6 A;  4DZS A;  4DJS A;  1TE4 A;  3LTM A;  3K5Z A;  4DB9 A;  4DVG B;  1WA5 C;  4A3V A;  1JPW A;  5CL5 A;  1IAL A;  4UWX A;  4O27 A;  4DB8 A;  2IWH A;  4R11 A;  1JDH A;  4QMJ A;  2F31 A;  4TNM A;  2NPP A;  4Y5J A;  2H4M A;  4OIH A;  5CL7 A;  3EA5 B;  1UPL A;  1W63 B;  3ZKV A;  3W3U A;  4CT6 B;  4RXH B;  5CLE A;  4PLS A;  3TT9 A;  4CRV B;  2GL7 A;  4RV1 A;  4R0Z A;  2P8Q A;  4U5L A;  1OYZ A;  4IMJ A;  3L3Q A;  1IBR B;  3Q0S A;  2VGL A;  3K7V A;  3O4X A;  5K6S A;  5CTT A;  2JKT A;  3V6Y A;  1F59 A;  4FFB C;  4HM9 A;  3A6P A;  4HTV A;  4JW2 A;  4U58 A;  2IAE A;  2VGL B;  4U54 A;  4MZ5 E;  5FC8 E;  3FGA A;  2JKT B;  1QGK A;  4I2S A;  3OBV A;  4QMH A;  4CV5 B;  4EVT A;  3GB8 A;  2BKU B;  2Q5D A;  4JW2 B;  2IAE B;  2NYL B;  3TPO A;  3ZHP A;  4YJE A;  3K64 A;  3FGA B;  3WYF C;  1EJL I;  4B8J A;  4UAE A;  4CB9 A;  1M8W A;  4NEE A;  2FV2 A;  4ADY A;  4BPL A;  5KLR B;  4UQI B;  2X19 B;  4PLQ A;  3UVU A;  1M8Z A;  2YNS A;  4B18 A;  1Q1S C;  1O6P A;  1V18 A;  2DB0 A;  4V3R A;  3NOW A;  3UL1 B;  4ZDU A;  5HUW C;  3RZ9 A;  3ZIQ A;  1HO8 A;  3BVS A;  4U5S A;  3QML C;  2YNR A;  4XZR B;  5K9S A;  5SW9 A;  3Q0M A;  4P6Z G;  4NZW A;  3LTJ A;  3K49 A;  2QK2 A;  4I3N A;  3Q0P A;  3KND A;  3T8S A;  2IE4 A;  5H2W A;  1PJN B;  5EKG A;  5JJA A;  3LWW A;  1UKL A;  3C2H A;  5BZV A;  4MFU A;  3K62 A;  4I96 A;  3FEX C;  5EWP A;  5CL9 A;  3L6Y A;  3DAD A;  2C1T A;  5EKF A;  4KZG A;  3ZIK A;  3WOZ A;  5KLA A;  4V3O A;  3C5W A;  3JY1 A;  4U2X D;  4I5N A;  3TX7 A;  3UJ0 A;  5HUY C;  3UKY B;  5SVZ A;  4D4E A;  3VLD A;  3VLF A;  3K61 A;  3VE6 A;  4HNM A;  4G3A A;  5CL6 A;  2Z6H A;  4EVA A;  2XOA A;  1LUJ A;  3OQS A;  5CLB A;  4HXT A;  3RZX A;  4DB6 A;  5BZ1 A;  1W63 A;  4PLR A;  4JW3 C;  4CT7 B;  3ZIL A;  3O2S A;  1XQS A;  1UPK A;  4R10 A;  3GVO A;  3SLA A;  3QGC A;  3WOY A;  2W3C A;  5J3V A;  2C1M A;  1O6O A;  5CL3 A;  1I7X A;  3BX3 A;  3K5Q A;  2BNX A;  3VWA A;  1QGR A;  3L3F X;  2PKG A;  3JXZ A;  4FZD A;  3ZIO A;  4CRU B;  3OUW A;  5B56 A;  2NYL A;  4UAD A;  1Y2A C;  4YK6 A;  2Z5N A;  4GMO A;  2NYM B;  2JKR B;  3PST A;  4V3Q A;  4L7M A;  4I7I A;  5CL8 A;  3WPT A;  4U5U A;  1BK5 A;  2X1G F;  3UKW B;  4UQI A;  2OT8 A;  4JKQ A;  4CBA A;  4FP7 A;  5BYM A;  3TPM A;  3H3D X;  2QNA A;  4B8P A;  4L4H A;  5BZ5 A;  4FQ3 A;  4YJL A;  2Z5M A;  3ODS A;  2RU4 B;  1M8Y A;  4I6I A; 
#chains in the Genus database with same CATH homology
 3TJ3 A;  3GAE A;  1M8X A;  3NMX A;  2Z5O A;  4MZ6 E;  5KL1 A;  5KL8 A;  2Z6G A;  5HHG E;  4BQK A;  3BSB A;  4BA3 A;  2BAP A;  2XA7 A;  5KUB A;  4UAF B;  4P6Z B;  2IW3 A;  2Z5J A;  4GMN A;  3ND2 A;  4I2Z A;  1U6G C;  2XA7 B;  2QMR A;  4YGX A;  4H3H A;  4FZA A;  3QHE A;  3C2G A;  3L6X A;  3BCT A;  4I37 A;  1QZ7 A;  3NMW A;  4PVZ A;  4H3K A;  3O2T A;  4EVP A;  2BCT A;  3OPB A;  4I0Y A;  3ZIR A;  4I5L A;  5DN7 A;  3Q0Q A;  1Q1T C;  5KLT B;  3PSP A;  2IE3 A;  3QG9 A;  3Q0R A;  4I1E A;  1WA5 B;  4U3J C;  3AU3 A;  3UKZ B;  2OF3 A;  5E6Q B;  3ZIN A;  1PJM B;  3GNI A;  3T7U A;  4I2W A;  2PF4 A;  1T08 A;  2NPP B;  3FEY C;  3NMZ A;  5D5K C;  3O2Q A;  1JPP A;  1EE5 A;  2NYM A;  2JKR A;  4I8M A;  4D49 A;  4E4V A;  4K92 A;  4U5V A;  5CLD A;  3ZIP A;  1GCJ A;  5CLA A;  3IBV A;  1IB2 A;  1B3U A;  4K6J A;  3ODR A;  3GQ2 A;  3Q5U A;  2WTK A;  5H2X A;  3TJZ B;  4U5N A;  1UN0 A;  3BX2 A;  3VLE A;  3GRL A;  4B8O A;  5AEI A;  1EJY I;  3EG5 B;  3V74 A;  2YJY A;  3DW8 A;  2RU4 A;  1TH1 A;  5LSW A;  3BSX A;  1QBK B;  4QMI A;  3K7W A;  4LAC A;  1M5N S;  5SWF A;  3JX7 A;  1IQ1 C;  4EV9 A;  3V71 A;  3QGB A;  2IX3 A;  3JXY A;  3EBB A;  2JAK A;  4JLQ A;  4RZP A;  4MFV A;  4EV8 A;  3GS3 A;  3K4E A;  4U5O A;  3UL0 B;  2Z5K A;  3IFQ A;  3BTR C;  3K5Y A;  1XM9 A;  5CLC A;  3SL9 A;  1W9C A;  1I7W A;  3Q0L A;  3Q0O A;  4YI0 C;  2JDQ A;  3Q0N A;  5BZU A;  3BWT A;  5CL4 A;  1EE4 A;  2QK1 A;  4IMI A;  4A0C A;  3GVT A;  4FDD A;  4OO6 A;  3OUX A;  4CB8 A;  4FZF A;  1XQR A;  4DBA A;  1G3J A;  1BK6 A;  3UKX B;  1M1E A;  4L4I A;  4A3T A;  1LRV A;  1Z2C B;  4WV6 A;  4DZS A;  4DJS A;  1TE4 A;  3LTM A;  3K5Z A;  4DB9 A;  4DVG B;  1WA5 C;  4A3V A;  1JPW A;  5CL5 A;  1IAL A;  4UWX A;  4O27 A;  4DB8 A;  2IWH A;  4R11 A;  1JDH A;  4QMJ A;  2F31 A;  4TNM A;  2NPP A;  4Y5J A;  2H4M A;  4OIH A;  5CL7 A;  3EA5 B;  1UPL A;  1W63 B;  3ZKV A;  3W3U A;  4CT6 B;  4RXH B;  5CLE A;  4PLS A;  3TT9 A;  4CRV B;  2GL7 A;  4RV1 A;  4R0Z A;  2P8Q A;  4U5L A;  1OYZ A;  4IMJ A;  3L3Q A;  1IBR B;  3Q0S A;  2VGL A;  3K7V A;  3O4X A;  5K6S A;  5CTT A;  2JKT A;  3V6Y A;  1F59 A;  4FFB C;  4HM9 A;  3A6P A;  4HTV A;  4JW2 A;  4U58 A;  2IAE A;  2VGL B;  4U54 A;  4MZ5 E;  5FC8 E;  3FGA A;  2JKT B;  1QGK A;  4I2S A;  3OBV A;  4QMH A;  4CV5 B;  4EVT A;  3GB8 A;  2BKU B;  2Q5D A;  4JW2 B;  2IAE B;  2NYL B;  3TPO A;  3ZHP A;  4YJE A;  3K64 A;  3FGA B;  3WYF C;  1EJL I;  4B8J A;  4UAE A;  4CB9 A;  1M8W A;  4NEE A;  2FV2 A;  4ADY A;  4BPL A;  5KLR B;  4UQI B;  2X19 B;  4PLQ A;  3UVU A;  1M8Z A;  2YNS A;  4B18 A;  1Q1S C;  1O6P A;  1V18 A;  2DB0 A;  4V3R A;  3NOW A;  3UL1 B;  4ZDU A;  5HUW C;  3RZ9 A;  3ZIQ A;  1HO8 A;  3BVS A;  4U5S A;  3QML C;  2YNR A;  4XZR B;  5K9S A;  5SW9 A;  3Q0M A;  4P6Z G;  4NZW A;  3LTJ A;  3K49 A;  2QK2 A;  4I3N A;  3Q0P A;  3KND A;  2IE4 A;  5H2W A;  1PJN B;  5EKG A;  5JJA A;  3LWW A;  1UKL A;  3C2H A;  5BZV A;  4MFU A;  3K62 A;  4I96 A;  3FEX C;  5EWP A;  5CL9 A;  3L6Y A;  3DAD A;  2C1T A;  5EKF A;  4KZG A;  3ZIK A;  3WOZ A;  5KLA A;  4V3O A;  3C5W A;  3JY1 A;  4U2X D;  4I5N A;  3TX7 A;  5HUY C;  3UKY B;  5SVZ A;  4D4E A;  3VLD A;  3VLF A;  3K61 A;  3VE6 A;  4HNM A;  4G3A A;  5CL6 A;  2Z6H A;  4EVA A;  2XOA A;  1LUJ A;  3OQS A;  5CLB A;  4HXT A;  3RZX A;  4DB6 A;  5BZ1 A;  1W63 A;  4PLR A;  4JW3 C;  4CT7 B;  3ZIL A;  3O2S A;  1XQS A;  1UPK A;  4R10 A;  3GVO A;  3SLA A;  3QGC A;  3WOY A;  2W3C A;  5J3V A;  2C1M A;  1O6O A;  5CL3 A;  1I7X A;  3BX3 A;  3K5Q A;  2BNX A;  3VWA A;  1QGR A;  3L3F X;  2PKG A;  3JXZ A;  4FZD A;  3ZIO A;  4CRU B;  3OUW A;  5B56 A;  2NYL A;  4UAD A;  1Y2A C;  4YK6 A;  2Z5N A;  4GMO A;  2NYM B;  2JKR B;  3PST A;  4V3Q A;  4L7M A;  4I7I A;  5CL8 A;  3WPT A;  4U5U A;  1BK5 A;  2X1G F;  3UKW B;  4UQI A;  2OT8 A;  4JKQ A;  4CBA A;  4FP7 A;  5BYM A;  3TPM A;  3H3D X;  2QNA A;  4B8P A;  4L4H A;  5BZ5 A;  4FQ3 A;  4YJL A;  2Z5M A;  3ODS A;  2RU4 B;  1M8Y A;  4I6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...