3K64A

Crystal structure of fbf-2/fem-3 pme complex
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
400
structure length
400
Chain Sequence
LPTWSLDSNGEMRSRLSLSEVLDSGDLMKFAVDKTGCQFLEKAVKGSLTSYQKFQLFEQVIGRKDDFLKLSTNIFGNYLVQSVIGISLATNDDGYTKRQEKLKNFISSQMTDMCLDKFACRVIQSSLQNMDLSLACKLVQALPRDARLIAICVDQNANHVIQKVVAVIPLKNWEFIVDFVATPEHLRQICSDKYGCRVVQTIIEKLTADSMNVDLTSAAQNLRERALQRLMTSVTNRCQELATNEYANYIIQHIVSNDDLAVYRECIIEKCLMRNLLSLSQEKFASHVVEKAFLHAPLELLAEMMDEIFDGYIPHPDTGKDALDIMMFHQFGNYVVQCMLTICCDAVSGRRQTKEGGYDHAISFQDWLKKLHSRVTKERHRLSRFSSGKKMIETLANLRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna/rna binding protein
molecule keywords Fem-3 mRNA-binding factor 2
publication title Structural basis for specific recognition of multiple mRNA targets by a PUF regulatory protein.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 152
structure length 400
sequence length 400
ec nomenclature
pdb deposition date 2009-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00806 PUF Pumilio-family RNA binding repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 3k64A00
2NPPA 3GAEA 3GRLA 3NMZA 4JW2B 3EA5B 5B56A 2IAEB 2BNXA 3BX3A 1JPWA 3Q0PA 1IB2A 2NYMB 4DJSA 5JJAA 2PKGA 3BSXA 4FQ3A 4YI0C 4V3RA 4KZGA 4P6ZG 2JKRA 3ZHPA 4H3HA 3GVOA 4RZPA 1LRVA 5SWFA 3IFQA 4UAEA 4QMJA 3WPTA 4CRUB 4CRVB 3BTRC 1U6GC 1IBRB 3UL0B 4O27A 4EVTA 2Z5KA 3C2GA 2C1TA 5AEIA 4HTVA 4ADYA 4H3KA 1UPLA 1EE5A 3IBVA 4I5NA 2H4MA 4UWXA 3ND2A 4FZFA 3AU3A 3VE6A 4B8PA 3K5QA 3NMWA 3K61A 5SVZA 2C1MA 3O2TA 3L6XA 3OQSA 1XQSA 5FC8E 2NYMA 3TX7A 1O6OA 4QMIA 5HUWC 1JPPA 3K7WA 4PLRA 2WTKA 5KLAA 5SW9A 2OT8A 4DB9A 3FGAA 3LTMA 4U5UA 4DZSA 3PSTA 2Z5MA 2VGLB 3H3DX 3ZIPA 4XZRB 1PJNB 4QMHA 5BZUA 4U3JC 1PJMB 2NYLB 1EE4A 3K64A 1OYZA 4BPLA 3QG9A 3O2QA 3FEXC 2IW3A 5BZVA 2QMRA 2Z6HA 3O4XA 5KL8A 1I7WA 3Q5UA 5BYMA 3TT9A 4DBAA 2XA7B 5EWPA 2X1GF 3T7UA 3NOWA 4U58A 3QGCA 4EV9A 3LTJA 3O2SA 4CV5B 4R10A 2OF3A 1QZ7A 4CT7B 5BZ5A 1GCJA 3VWAA 3WOZA 4MZ6E 1LUJA 4EVAA 3V74A 5DN7A 1BK6A 1G3JA 2IE4A 4JLQA 2Z6GA 4NZWA 3RZXA 3FEYC 3QGBA 4B8OA 3EBBA 4CB9A 1M8WA 4D49A 3WYFC 4PVZA 4RXHB 3BSBA 2IWHA 3TJ3A 3GVTA 4MFUA 3W3UA 1JDHA 1TH1A 3L6YA 1Q1TC 3OBVA 4LACA 5KLTB 3BWTA 2VGLA 4EV8A 2Z5JA 2FV2A 4BQKA 4FFBC 2NYLA 3ODSA 4HXTA 4U54A 3TPMA 1Y2AC 1W63A 4CBAA 3DW8A 4OIHA 4IMIA 4R0ZA 4UAFB 1Q1SC 4HM9A 4YJLA 3TJZB 1BK5A 1QGKA 4IMJA 2YNRA 3OUWA 2IAEA 5H2XA 2BKUB 2IE3A 3LWWA 3K62A 3Q0NA 2JKTB 4ZDUA 3DADA 3TPOA 4BA3A 5K6SA 4U5NA 1B3UA 3UKWB 1T08A 1UN0A 4HNMA 4DVGB 3RZ9A 3K49A 4NEEA 1Z2CB 3BX2A 3A6PA 1XM9A 4MFVA 4YGXA 4V3OA 2QK2A 5D5KC 3ODRA 1M8XA 1V18A 2GL7A 2BAPA 2X19B 5BZ1A 4PLQA 3L3QA 1I7XA 1IQ1C 3QMLC 5KL1A 1M1EA 1O6PA 4GMOA 3ZKVA 3OUXA 3ZIQA 4A0CA 3ZIOA 4TNMA 1HO8A 1EJLI 4GMNA 3V71A 3UL1B 3UKXB 1WA5B 4UQIB 4U5VA 3GS3A 3UKZB 4WV6A 1UPKA 2Q5DA 2JKTA 3Q0LA 4OO6A 5J3VA 4D4EA 2JAKA 5E6QB 4FDDA 3OPBA 1XQRA 3L3FX 5HHGE 4I5LA 1IALA 2JDQA 3Q0SA 4L7MA 4Y5JA 5CTTA 4P6ZB 1WA5C 3FGAB 1M8ZA 3KNDA 3QHEA 5EKGA 5K9SA 4YJEA 4V3QA 2F31A 3UKYB 4U5SA 3V6YA 2RU4B 4CT6B 2IX3A 2XA7A 3PSPA 4U5OA 1M8YA 3K4EA 3Q0MA 3Q0RA 5LSWA 2Z5OA 1QGRA 3Q0OA 4U5LA 4FZAA 5H2WA 2NPPB 4UQIA 3ZINA 3WOYA 5HUYC 3GNIA 3C5WA 4G3AA 4K92A 2PF4A 4I2WA 2JKRB 4R11A 3UVUA 3EG5B 3GQ2A 3GB8A 2QK1A 3ZIRA 4PLSA 3C2HA 1F59A 4E4VA 1EJYI 2P8QA 4FZDA 1W9CA 2W3CA 5EKFA 5KLRB 4DB8A 2YNSA 4K6JA 4DB6A 4YK6A 3Q0QA 2RU4A 3NMXA 2QNAA 3BCTA 1UKLA 4I2ZA 4MZ5E 3K5YA 4CB8A 3K5ZA 1W63B 4UADA 4B8JA 2YJYA 4B18A 2DB0A 4EVPA 1M5NS 1QBKB 4RV1A 3K7VA 2Z5NA 2BCTA
chains in the Genus database with same CATH superfamily
2NPPA 3GAEA 3GRLA 5CLCA 3NMZA 4JW2B 3EA5B 5B56A 2IAEB 5CLAA 2BNXA 3BX3A 1JPWA 3Q0PA 3JXZA 1IB2A 2NYMB 4DJSA 5JJAA 2PKGA 3BSXA 4FQ3A 4YI0C 4V3RA 4KZGA 4P6ZG 2JKRA 3ZHPA 4H3HA 3GVOA 4RZPA 1LRVA 5SWFA 3IFQA 4UAEA 4QMJA 3WPTA 4CRUB 4CRVB 3BTRC 1U6GC 1N4KA 1IBRB 3UL0B 3JX7A 4O27A 4EVTA 2Z5KA 3C2GA 4L4IA 2C1TA 5AEIA 4HTVA 4A3VA 5CL5A 4ADYA 4H3KA 1UPLA 1EE5A 3JXYA 3IBVA 4I5NA 2H4MA 4UWXA 3ND2A 4FZFA 3AU3A 3VE6A 4B8PA 3K5QA 3NMWA 3K61A 5SVZA 2C1MA 3O2TA 3L6XA 3OQSA 1XQSA 5FC8E 2NYMA 3TX7A 1O6OA 4QMIA 5HUWC 1JPPA 3K7WA 4PLRA 2WTKA 5KLAA 5SW9A 4JKQA 2OT8A 4DB9A 4I6IA 3FGAA 3LTMA 4U5UA 4DZSA 3JY1A 3PSTA 2Z5MA 2VGLB 3H3DX 3ZIPA 4XZRB 5CLDA 1PJNB 4QMHA 5BZUA 4U3JC 1PJMB 2NYLB 1EE4A 3K64A 1OYZA 4BPLA 3QG9A 3O2QA 3FEXC 2IW3A 5BZVA 2QMRA 2Z6HA 3O4XA 5KL8A 1I7WA 3Q5UA 5BYMA 3TT9A 4DBAA 2XA7B 5EWPA 2X1GF 4FP7A 3T7UA 3NOWA 4U58A 3QGCA 4EV9A 3LTJA 3O2SA 4CV5B 4R10A 2OF3A 1QZ7A 4CT7B 5BZ5A 4I96A 1GCJA 3VWAA 3WOZA 4MZ6E 1LUJA 4EVAA 3V74A 5DN7A 1BK6A 1G3JA 2IE4A 4JLQA 2Z6GA 4NZWA 3RZXA 3FEYC 3QGBA 4B8OA 3EBBA 4CB9A 1M8WA 4D49A 3WYFC 4I0YA 4PVZA 4RXHB 3BSBA 3VLDA 4I2SA 2IWHA 3TJ3A 3GVTA 4MFUA 3W3UA 1JDHA 1TH1A 5CL7A 3L6YA 1Q1TC 3OBVA 4LACA 5KLTB 3BWTA 2VGLA 4EV8A 2Z5JA 2FV2A 4BQKA 4FFBC 2NYLA 3ODSA 4HXTA 4U54A 3TPMA 1Y2AC 3SLAA 1W63A 4CBAA 3DW8A 4OIHA 4IMIA 5CL8A 4R0ZA 4UAFB 4JW3C 1Q1SC 4HM9A 4YJLA 3TJZB 1BK5A 1QGKA 4IMJA 2YNRA 5CLBA 4JW2A 3OUWA 3BVSA 3VLFA 2IAEA 5H2XA 2BKUB 4A3TA 2IE3A 3LWWA 3K62A 3Q0NA 2JKTB 4ZDUA 3DADA 3TPOA 4BA3A 4I1EA 5K6SA 4U5NA 1B3UA 3UKWB 1T08A 1UN0A 4HNMA 4DVGB 3RZ9A 3K49A 4NEEA 5CL3A 1Z2CB 4I7IA 3BX2A 3A6PA 3T8SA 1XM9A 4MFVA 4YGXA 4V3OA 2QK2A 5D5KC 3ODRA 4U2XD 1M8XA 1V18A 2GL7A 2BAPA 2X19B 5BZ1A 5CLEA 4PLQA 3L3QA 1I7XA 3UJ0A 1IQ1C 3QMLC 5KL1A 1M1EA 1O6PA 4GMOA 3ZKVA 3OUXA 3ZIQA 4A0CA 3ZIOA 4TNMA 1HO8A 1EJLI 4GMNA 3V71A 3UL1B 3UKXB 1WA5B 4UQIB 4U5VA 3GS3A 3ZIKA 3UKZB 4WV6A 1UPKA 2Q5DA 2JKTA 3Q0LA 4OO6A 5J3VA 4D4EA 2JAKA 5E6QB 4FDDA 3OPBA 1XQRA 3L3FX 5HHGE 4I5LA 1IALA 2JDQA 3Q0SA 5CL4A 4L7MA 3SL9A 4Y5JA 5CTTA 4P6ZB 1WA5C 3FGAB 1M8ZA 3KNDA 3ZILA 3QHEA 5EKGA 5K9SA 4L4HA 4YJEA 5CL6A 4V3QA 1LSHA 2F31A 3UKYB 4U5SA 3V6YA 2RU4B 4CT6B 2IX3A 3UJ4A 2XA7A 3PSPA 4U5OA 1M8YA 3K4EA 3Q0MA 3Q0RA 4I3NA 5LSWA 2Z5OA 1QGRA 3VLEA 3Q0OA 4U5LA 4FZAA 5H2WA 2NPPB 4UQIA 5CL9A 3ZINA 3WOYA 2XOAA 5HUYC 3GNIA 3C5WA 4G3AA 4K92A 2PF4A 4I2WA 2JKRB 4R11A 3UVUA 1TE4A 3EG5B 3GQ2A 3GB8A 2QK1A 3ZIRA 4PLSA 3C2HA 1F59A 4E4VA 1EJYI 2P8QA 4FZDA 1W9CA 2W3CA 5EKFA 5KLRB 4DB8A 2YNSA 4K6JA 4DB6A 4YK6A 3Q0QA 2RU4A 3NMXA 2QNAA 4MZ5E 3BCTA 1UKLA 4I37A 4I2ZA 3K5YA 4I8MA 4CB8A 3K5ZA 1W63B 4UADA 4B8JA 2YJYA 4B18A 2DB0A 4EVPA 1M5NS 1QBKB 4RV1A 3K7VA 5KUBA 2Z5NA 2BCTA
chains in the Genus database with same CATH topology
2NPPA 3GAEA 3GRLA 5CLCA 3NMZA 4JW2B 3EA5B 5B56A 2IAEB 5CLAA 2BNXA 3BX3A 1JPWA 3Q0PA 3JXZA 1IB2A 2NYMB 4DJSA 5JJAA 2PKGA 3BSXA 4FQ3A 4YI0C 4V3RA 4KZGA 4P6ZG 2JKRA 3ZHPA 4H3HA 3GVOA 4RZPA 1LRVA 5SWFA 3IFQA 4UAEA 4QMJA 3WPTA 4CRUB 4CRVB 3BTRC 1U6GC 1IBRB 3UL0B 3JX7A 4O27A 4EVTA 2Z5KA 3C2GA 4L4IA 2C1TA 5AEIA 4HTVA 4A3VA 5CL5A 4ADYA 4H3KA 1UPLA 1EE5A 3JXYA 3IBVA 4I5NA 2H4MA 4UWXA 3ND2A 4FZFA 3AU3A 3VE6A 4B8PA 3K5QA 3NMWA 3K61A 5SVZA 2C1MA 3O2TA 3L6XA 3OQSA 1XQSA 5FC8E 2NYMA 3TX7A 1O6OA 4QMIA 5HUWC 1JPPA 3K7WA 4PLRA 2WTKA 5KLAA 5SW9A 4JKQA 2OT8A 4DB9A 4I6IA 3FGAA 3LTMA 4U5UA 4DZSA 3JY1A 3PSTA 2Z5MA 2VGLB 3H3DX 3ZIPA 4XZRB 5CLDA 1PJNB 4QMHA 5BZUA 4U3JC 1PJMB 2NYLB 1EE4A 3K64A 1OYZA 4BPLA 3QG9A 3O2QA 3FEXC 2IW3A 5BZVA 2QMRA 2Z6HA 3O4XA 5KL8A 1I7WA 3Q5UA 5BYMA 3TT9A 4DBAA 2XA7B 5EWPA 2X1GF 4FP7A 3T7UA 3NOWA 4U58A 3QGCA 4EV9A 3LTJA 3O2SA 4CV5B 4R10A 2OF3A 1QZ7A 4CT7B 5BZ5A 4I96A 1GCJA 3VWAA 3WOZA 4MZ6E 1LUJA 4EVAA 3V74A 5DN7A 1BK6A 1G3JA 2IE4A 4JLQA 2Z6GA 4NZWA 3RZXA 3FEYC 3QGBA 4B8OA 3EBBA 4CB9A 1M8WA 4D49A 3WYFC 4I0YA 4PVZA 4RXHB 3BSBA 3VLDA 4I2SA 2IWHA 3TJ3A 3GVTA 4MFUA 3W3UA 1JDHA 1TH1A 5CL7A 3L6YA 1Q1TC 3OBVA 4LACA 5KLTB 3BWTA 2VGLA 4EV8A 2Z5JA 2FV2A 4BQKA 4FFBC 2NYLA 3ODSA 4HXTA 4U54A 3TPMA 1Y2AC 3SLAA 1W63A 4CBAA 3DW8A 4OIHA 4IMIA 5CL8A 4R0ZA 4UAFB 4JW3C 1Q1SC 4HM9A 4YJLA 3TJZB 1BK5A 1QGKA 4IMJA 2YNRA 5CLBA 4JW2A 3OUWA 3BVSA 3VLFA 2IAEA 5H2XA 2BKUB 4A3TA 2IE3A 3LWWA 3K62A 3Q0NA 2JKTB 4ZDUA 3DADA 3TPOA 4BA3A 4I1EA 5K6SA 4U5NA 1B3UA 3UKWB 1T08A 1UN0A 4HNMA 4DVGB 3RZ9A 3K49A 4NEEA 5CL3A 1Z2CB 4I7IA 3BX2A 3A6PA 1XM9A 4MFVA 4YGXA 4V3OA 2QK2A 5D5KC 3ODRA 4U2XD 1M8XA 1V18A 2GL7A 2BAPA 2X19B 5BZ1A 5CLEA 4PLQA 3L3QA 1I7XA 1IQ1C 3QMLC 5KL1A 1M1EA 1O6PA 4GMOA 3ZKVA 3OUXA 3ZIQA 4A0CA 3ZIOA 4TNMA 1HO8A 1EJLI 4GMNA 3V71A 3UL1B 3UKXB 1WA5B 4UQIB 4U5VA 3GS3A 3ZIKA 3UKZB 4WV6A 1UPKA 2Q5DA 2JKTA 3Q0LA 4OO6A 5J3VA 4D4EA 2JAKA 5E6QB 4FDDA 3OPBA 1XQRA 3L3FX 5HHGE 4I5LA 1IALA 2JDQA 3Q0SA 5CL4A 4L7MA 3SL9A 4Y5JA 5CTTA 4P6ZB 1WA5C 3FGAB 1M8ZA 3KNDA 3ZILA 3QHEA 5EKGA 5K9SA 4L4HA 4YJEA 5CL6A 4V3QA 2F31A 3UKYB 4U5SA 3V6YA 2RU4B 4CT6B 2IX3A 2XA7A 3PSPA 4U5OA 1M8YA 3K4EA 3Q0MA 3Q0RA 4I3NA 5LSWA 2Z5OA 1QGRA 3VLEA 3Q0OA 4U5LA 4FZAA 5H2WA 2NPPB 4UQIA 5CL9A 3ZINA 3WOYA 2XOAA 5HUYC 3GNIA 3C5WA 4G3AA 4K92A 2PF4A 4I2WA 2JKRB 4R11A 3UVUA 1TE4A 3EG5B 3GQ2A 3GB8A 2QK1A 3ZIRA 4PLSA 3C2HA 1F59A 4E4VA 1EJYI 2P8QA 4FZDA 1W9CA 2W3CA 5EKFA 5KLRB 4DB8A 2YNSA 4K6JA 4DB6A 4YK6A 3Q0QA 2RU4A 3NMXA 2QNAA 4MZ5E 3BCTA 1UKLA 4I37A 4I2ZA 3K5YA 4I8MA 4CB8A 3K5ZA 1W63B 4UADA 4B8JA 2YJYA 4B18A 2DB0A 4EVPA 1M5NS 1QBKB 4RV1A 3K7VA 5KUBA 2Z5NA 2BCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPP A;  3GAE A;  3GRL A;  3NMZ A;  4JW2 B;  3EA5 B;  5B56 A;  2IAE B;  2BNX A;  3BX3 A;  1JPW A;  3Q0P A;  1IB2 A;  2NYM B;  4DJS A;  5JJA A;  2PKG A;  3BSX A;  4FQ3 A;  4YI0 C;  4V3R A;  4KZG A;  4P6Z G;  2JKR A;  3ZHP A;  4H3H A;  3GVO A;  4RZP A;  1LRV A;  5SWF A;  3IFQ A;  4UAE A;  4QMJ A;  3WPT A;  4CRU B;  4CRV B;  3BTR C;  1U6G C;  1IBR B;  3UL0 B;  4O27 A;  4EVT A;  2Z5K A;  3C2G A;  2C1T A;  5AEI A;  4HTV A;  4ADY A;  4H3K A;  1UPL A;  1EE5 A;  3IBV A;  4I5N A;  2H4M A;  4UWX A;  3ND2 A;  4FZF A;  3AU3 A;  3VE6 A;  4B8P A;  3K5Q A;  3NMW A;  3K61 A;  5SVZ A;  2C1M A;  3O2T A;  3L6X A;  3OQS A;  1XQS A;  5FC8 E;  2NYM A;  3TX7 A;  1O6O A;  4QMI A;  5HUW C;  1JPP A;  3K7W A;  4PLR A;  2WTK A;  5KLA A;  5SW9 A;  2OT8 A;  4DB9 A;  3FGA A;  3LTM A;  4U5U A;  4DZS A;  3PST A;  2Z5M A;  2VGL B;  3H3D X;  3ZIP A;  4XZR B;  1PJN B;  4QMH A;  5BZU A;  4U3J C;  1PJM B;  2NYL B;  1EE4 A;  3K64 A;  1OYZ A;  4BPL A;  3QG9 A;  3O2Q A;  3FEX C;  2IW3 A;  5BZV A;  2QMR A;  2Z6H A;  3O4X A;  5KL8 A;  1I7W A;  3Q5U A;  5BYM A;  3TT9 A;  4DBA A;  2XA7 B;  5EWP A;  2X1G F;  3T7U A;  3NOW A;  4U58 A;  3QGC A;  4EV9 A;  3LTJ A;  3O2S A;  4CV5 B;  4R10 A;  2OF3 A;  1QZ7 A;  4CT7 B;  5BZ5 A;  1GCJ A;  3VWA A;  3WOZ A;  4MZ6 E;  1LUJ A;  4EVA A;  3V74 A;  5DN7 A;  1BK6 A;  1G3J A;  2IE4 A;  4JLQ A;  2Z6G A;  4NZW A;  3RZX A;  3FEY C;  3QGB A;  4B8O A;  3EBB A;  4CB9 A;  1M8W A;  4D49 A;  3WYF C;  4PVZ A;  4RXH B;  3BSB A;  2IWH A;  3TJ3 A;  3GVT A;  4MFU A;  3W3U A;  1JDH A;  1TH1 A;  3L6Y A;  1Q1T C;  3OBV A;  4LAC A;  5KLT B;  3BWT A;  2VGL A;  4EV8 A;  2Z5J A;  2FV2 A;  4BQK A;  4FFB C;  2NYL A;  3ODS A;  4HXT A;  4U54 A;  3TPM A;  1Y2A C;  1W63 A;  4CBA A;  3DW8 A;  4OIH A;  4IMI A;  4R0Z A;  4UAF B;  1Q1S C;  4HM9 A;  4YJL A;  3TJZ B;  1BK5 A;  1QGK A;  4IMJ A;  2YNR A;  3OUW A;  2IAE A;  5H2X A;  2BKU B;  2IE3 A;  3LWW A;  3K62 A;  3Q0N A;  2JKT B;  4ZDU A;  3DAD A;  3TPO A;  4BA3 A;  5K6S A;  4U5N A;  1B3U A;  3UKW B;  1T08 A;  1UN0 A;  4HNM A;  4DVG B;  3RZ9 A;  3K49 A;  4NEE A;  1Z2C B;  3BX2 A;  3A6P A;  1XM9 A;  4MFV A;  4YGX A;  4V3O A;  2QK2 A;  5D5K C;  3ODR A;  1M8X A;  1V18 A;  2GL7 A;  2BAP A;  2X19 B;  5BZ1 A;  4PLQ A;  3L3Q A;  1I7X A;  1IQ1 C;  3QML C;  5KL1 A;  1M1E A;  1O6P A;  4GMO A;  3ZKV A;  3OUX A;  3ZIQ A;  4A0C A;  3ZIO A;  4TNM A;  1HO8 A;  1EJL I;  4GMN A;  3V71 A;  3UL1 B;  3UKX B;  1WA5 B;  4UQI B;  4U5V A;  3GS3 A;  3UKZ B;  4WV6 A;  1UPK A;  2Q5D A;  2JKT A;  3Q0L A;  4OO6 A;  5J3V A;  4D4E A;  2JAK A;  5E6Q B;  4FDD A;  3OPB A;  1XQR A;  3L3F X;  5HHG E;  4I5L A;  1IAL A;  2JDQ A;  3Q0S A;  4L7M A;  4Y5J A;  5CTT A;  4P6Z B;  1WA5 C;  3FGA B;  1M8Z A;  3KND A;  3QHE A;  5EKG A;  5K9S A;  4YJE A;  4V3Q A;  2F31 A;  3UKY B;  4U5S A;  3V6Y A;  2RU4 B;  4CT6 B;  2IX3 A;  2XA7 A;  3PSP A;  4U5O A;  1M8Y A;  3K4E A;  3Q0M A;  3Q0R A;  5LSW A;  2Z5O A;  1QGR A;  3Q0O A;  4U5L A;  4FZA A;  5H2W A;  2NPP B;  4UQI A;  3ZIN A;  3WOY A;  5HUY C;  3GNI A;  3C5W A;  4G3A A;  4K92 A;  2PF4 A;  4I2W A;  2JKR B;  4R11 A;  3UVU A;  3EG5 B;  3GQ2 A;  3GB8 A;  2QK1 A;  3ZIR A;  4PLS A;  3C2H A;  1F59 A;  4E4V A;  1EJY I;  2P8Q A;  4FZD A;  1W9C A;  2W3C A;  5EKF A;  5KLR B;  4DB8 A;  2YNS A;  4K6J A;  4DB6 A;  4YK6 A;  3Q0Q A;  2RU4 A;  3NMX A;  2QNA A;  3BCT A;  1UKL A;  4I2Z A;  4MZ5 E;  3K5Y A;  4CB8 A;  3K5Z A;  1W63 B;  4UAD A;  4B8J A;  2YJY A;  4B18 A;  2DB0 A;  4EVP A;  1M5N S;  1QBK B;  4RV1 A;  3K7V A;  2Z5N A;  2BCT A; 
#chains in the Genus database with same CATH topology
 2NPP A;  3GAE A;  3GRL A;  5CLC A;  3NMZ A;  4JW2 B;  3EA5 B;  5B56 A;  2IAE B;  5CLA A;  2BNX A;  3BX3 A;  1JPW A;  3Q0P A;  3JXZ A;  1IB2 A;  2NYM B;  4DJS A;  5JJA A;  2PKG A;  3BSX A;  4FQ3 A;  4YI0 C;  4V3R A;  4KZG A;  4P6Z G;  2JKR A;  3ZHP A;  4H3H A;  3GVO A;  4RZP A;  1LRV A;  5SWF A;  3IFQ A;  4UAE A;  4QMJ A;  3WPT A;  4CRU B;  4CRV B;  3BTR C;  1U6G C;  1N4K A;  1IBR B;  3UL0 B;  3JX7 A;  4O27 A;  4EVT A;  2Z5K A;  3C2G A;  4L4I A;  2C1T A;  5AEI A;  4HTV A;  4A3V A;  5CL5 A;  4ADY A;  4H3K A;  1UPL A;  1EE5 A;  3JXY A;  3IBV A;  4I5N A;  2H4M A;  4UWX A;  3ND2 A;  4FZF A;  3AU3 A;  3VE6 A;  4B8P A;  3K5Q A;  3NMW A;  3K61 A;  5SVZ A;  2C1M A;  3O2T A;  3L6X A;  3OQS A;  1XQS A;  5FC8 E;  2NYM A;  3TX7 A;  1O6O A;  4QMI A;  5HUW C;  1JPP A;  3K7W A;  4PLR A;  2WTK A;  5KLA A;  5SW9 A;  4JKQ A;  2OT8 A;  4DB9 A;  4I6I A;  3FGA A;  3LTM A;  4U5U A;  4DZS A;  3JY1 A;  3PST A;  2Z5M A;  2VGL B;  3H3D X;  3ZIP A;  4XZR B;  5CLD A;  1PJN B;  4QMH A;  5BZU A;  4U3J C;  1PJM B;  2NYL B;  1EE4 A;  3K64 A;  1OYZ A;  4BPL A;  3QG9 A;  3O2Q A;  3FEX C;  2IW3 A;  5BZV A;  2QMR A;  2Z6H A;  3O4X A;  5KL8 A;  1I7W A;  3Q5U A;  5BYM A;  3TT9 A;  4DBA A;  2XA7 B;  5EWP A;  2X1G F;  4FP7 A;  3T7U A;  3NOW A;  4U58 A;  3QGC A;  4EV9 A;  3LTJ A;  3O2S A;  4CV5 B;  4R10 A;  2OF3 A;  1QZ7 A;  4CT7 B;  5BZ5 A;  4I96 A;  1GCJ A;  3VWA A;  3WOZ A;  4MZ6 E;  1LUJ A;  4EVA A;  3V74 A;  5DN7 A;  1BK6 A;  1G3J A;  2IE4 A;  4JLQ A;  2Z6G A;  4NZW A;  3RZX A;  3FEY C;  3QGB A;  4B8O A;  3EBB A;  4CB9 A;  1M8W A;  4D49 A;  3WYF C;  4I0Y A;  4PVZ A;  4RXH B;  3BSB A;  3VLD A;  4I2S A;  2IWH A;  3TJ3 A;  3GVT A;  4MFU A;  3W3U A;  1JDH A;  1TH1 A;  5CL7 A;  3L6Y A;  1Q1T C;  3OBV A;  4LAC A;  5KLT B;  3BWT A;  2VGL A;  4EV8 A;  2Z5J A;  2FV2 A;  4BQK A;  4FFB C;  2NYL A;  3ODS A;  4HXT A;  4U54 A;  3TPM A;  1Y2A C;  3SLA A;  1W63 A;  4CBA A;  3DW8 A;  4OIH A;  4IMI A;  5CL8 A;  4R0Z A;  4UAF B;  4JW3 C;  1Q1S C;  4HM9 A;  4YJL A;  3TJZ B;  1BK5 A;  1QGK A;  4IMJ A;  2YNR A;  5CLB A;  4JW2 A;  3OUW A;  3BVS A;  3VLF A;  2IAE A;  5H2X A;  2BKU B;  4A3T A;  2IE3 A;  3LWW A;  3K62 A;  3Q0N A;  2JKT B;  4ZDU A;  3DAD A;  3TPO A;  4BA3 A;  4I1E A;  5K6S A;  4U5N A;  1B3U A;  3UKW B;  1T08 A;  1UN0 A;  4HNM A;  4DVG B;  3RZ9 A;  3K49 A;  4NEE A;  5CL3 A;  1Z2C B;  4I7I A;  3BX2 A;  3A6P A;  3T8S A;  1XM9 A;  4MFV A;  4YGX A;  4V3O A;  2QK2 A;  5D5K C;  3ODR A;  4U2X D;  1M8X A;  1V18 A;  2GL7 A;  2BAP A;  2X19 B;  5BZ1 A;  5CLE A;  4PLQ A;  3L3Q A;  1I7X A;  3UJ0 A;  1IQ1 C;  3QML C;  5KL1 A;  1M1E A;  1O6P A;  4GMO A;  3ZKV A;  3OUX A;  3ZIQ A;  4A0C A;  3ZIO A;  4TNM A;  1HO8 A;  1EJL I;  4GMN A;  3V71 A;  3UL1 B;  3UKX B;  1WA5 B;  4UQI B;  4U5V A;  3GS3 A;  3ZIK A;  3UKZ B;  4WV6 A;  1UPK A;  2Q5D A;  2JKT A;  3Q0L A;  4OO6 A;  5J3V A;  4D4E A;  2JAK A;  5E6Q B;  4FDD A;  3OPB A;  1XQR A;  3L3F X;  5HHG E;  4I5L A;  1IAL A;  2JDQ A;  3Q0S A;  5CL4 A;  4L7M A;  3SL9 A;  4Y5J A;  5CTT A;  4P6Z B;  1WA5 C;  3FGA B;  1M8Z A;  3KND A;  3ZIL A;  3QHE A;  5EKG A;  5K9S A;  4L4H A;  4YJE A;  5CL6 A;  4V3Q A;  1LSH A;  2F31 A;  3UKY B;  4U5S A;  3V6Y A;  2RU4 B;  4CT6 B;  2IX3 A;  3UJ4 A;  2XA7 A;  3PSP A;  4U5O A;  1M8Y A;  3K4E A;  3Q0M A;  3Q0R A;  4I3N A;  5LSW A;  2Z5O A;  1QGR A;  3VLE A;  3Q0O A;  4U5L A;  4FZA A;  5H2W A;  2NPP B;  4UQI A;  5CL9 A;  3ZIN A;  3WOY A;  2XOA A;  5HUY C;  3GNI A;  3C5W A;  4G3A A;  4K92 A;  2PF4 A;  4I2W A;  2JKR B;  4R11 A;  3UVU A;  1TE4 A;  3EG5 B;  3GQ2 A;  3GB8 A;  2QK1 A;  3ZIR A;  4PLS A;  3C2H A;  1F59 A;  4E4V A;  1EJY I;  2P8Q A;  4FZD A;  1W9C A;  2W3C A;  5EKF A;  5KLR B;  4DB8 A;  2YNS A;  4K6J A;  4DB6 A;  4YK6 A;  3Q0Q A;  2RU4 A;  3NMX A;  2QNA A;  4MZ5 E;  3BCT A;  1UKL A;  4I37 A;  4I2Z A;  3K5Y A;  4I8M A;  4CB8 A;  3K5Z A;  1W63 B;  4UAD A;  4B8J A;  2YJY A;  4B18 A;  2DB0 A;  4EVP A;  1M5N S;  1QBK B;  4RV1 A;  3K7V A;  5KUB A;  2Z5N A;  2BCT A; 
#chains in the Genus database with same CATH homology
 2NPP A;  3GAE A;  3GRL A;  5CLC A;  3NMZ A;  4JW2 B;  3EA5 B;  5B56 A;  2IAE B;  5CLA A;  2BNX A;  3BX3 A;  1JPW A;  3Q0P A;  3JXZ A;  1IB2 A;  2NYM B;  4DJS A;  5JJA A;  2PKG A;  3BSX A;  4FQ3 A;  4YI0 C;  4V3R A;  4KZG A;  4P6Z G;  2JKR A;  3ZHP A;  4H3H A;  3GVO A;  4RZP A;  1LRV A;  5SWF A;  3IFQ A;  4UAE A;  4QMJ A;  3WPT A;  4CRU B;  4CRV B;  3BTR C;  1U6G C;  1IBR B;  3UL0 B;  3JX7 A;  4O27 A;  4EVT A;  2Z5K A;  3C2G A;  4L4I A;  2C1T A;  5AEI A;  4HTV A;  4A3V A;  5CL5 A;  4ADY A;  4H3K A;  1UPL A;  1EE5 A;  3JXY A;  3IBV A;  4I5N A;  2H4M A;  4UWX A;  3ND2 A;  4FZF A;  3AU3 A;  3VE6 A;  4B8P A;  3K5Q A;  3NMW A;  3K61 A;  5SVZ A;  2C1M A;  3O2T A;  3L6X A;  3OQS A;  1XQS A;  5FC8 E;  2NYM A;  3TX7 A;  1O6O A;  4QMI A;  5HUW C;  1JPP A;  3K7W A;  4PLR A;  2WTK A;  5KLA A;  5SW9 A;  4JKQ A;  2OT8 A;  4DB9 A;  4I6I A;  3FGA A;  3LTM A;  4U5U A;  4DZS A;  3JY1 A;  3PST A;  2Z5M A;  2VGL B;  3H3D X;  3ZIP A;  4XZR B;  5CLD A;  1PJN B;  4QMH A;  5BZU A;  4U3J C;  1PJM B;  2NYL B;  1EE4 A;  3K64 A;  1OYZ A;  4BPL A;  3QG9 A;  3O2Q A;  3FEX C;  2IW3 A;  5BZV A;  2QMR A;  2Z6H A;  3O4X A;  5KL8 A;  1I7W A;  3Q5U A;  5BYM A;  3TT9 A;  4DBA A;  2XA7 B;  5EWP A;  2X1G F;  4FP7 A;  3T7U A;  3NOW A;  4U58 A;  3QGC A;  4EV9 A;  3LTJ A;  3O2S A;  4CV5 B;  4R10 A;  2OF3 A;  1QZ7 A;  4CT7 B;  5BZ5 A;  4I96 A;  1GCJ A;  3VWA A;  3WOZ A;  4MZ6 E;  1LUJ A;  4EVA A;  3V74 A;  5DN7 A;  1BK6 A;  1G3J A;  2IE4 A;  4JLQ A;  2Z6G A;  4NZW A;  3RZX A;  3FEY C;  3QGB A;  4B8O A;  3EBB A;  4CB9 A;  1M8W A;  4D49 A;  3WYF C;  4I0Y A;  4PVZ A;  4RXH B;  3BSB A;  3VLD A;  4I2S A;  2IWH A;  3TJ3 A;  3GVT A;  4MFU A;  3W3U A;  1JDH A;  1TH1 A;  5CL7 A;  3L6Y A;  1Q1T C;  3OBV A;  4LAC A;  5KLT B;  3BWT A;  2VGL A;  4EV8 A;  2Z5J A;  2FV2 A;  4BQK A;  4FFB C;  2NYL A;  3ODS A;  4HXT A;  4U54 A;  3TPM A;  1Y2A C;  3SLA A;  1W63 A;  4CBA A;  3DW8 A;  4OIH A;  4IMI A;  5CL8 A;  4R0Z A;  4UAF B;  4JW3 C;  1Q1S C;  4HM9 A;  4YJL A;  3TJZ B;  1BK5 A;  1QGK A;  4IMJ A;  2YNR A;  5CLB A;  4JW2 A;  3OUW A;  3BVS A;  3VLF A;  2IAE A;  5H2X A;  2BKU B;  4A3T A;  2IE3 A;  3LWW A;  3K62 A;  3Q0N A;  2JKT B;  4ZDU A;  3DAD A;  3TPO A;  4BA3 A;  4I1E A;  5K6S A;  4U5N A;  1B3U A;  3UKW B;  1T08 A;  1UN0 A;  4HNM A;  4DVG B;  3RZ9 A;  3K49 A;  4NEE A;  5CL3 A;  1Z2C B;  4I7I A;  3BX2 A;  3A6P A;  1XM9 A;  4MFV A;  4YGX A;  4V3O A;  2QK2 A;  5D5K C;  3ODR A;  4U2X D;  1M8X A;  1V18 A;  2GL7 A;  2BAP A;  2X19 B;  5BZ1 A;  5CLE A;  4PLQ A;  3L3Q A;  1I7X A;  1IQ1 C;  3QML C;  5KL1 A;  1M1E A;  1O6P A;  4GMO A;  3ZKV A;  3OUX A;  3ZIQ A;  4A0C A;  3ZIO A;  4TNM A;  1HO8 A;  1EJL I;  4GMN A;  3V71 A;  3UL1 B;  3UKX B;  1WA5 B;  4UQI B;  4U5V A;  3GS3 A;  3ZIK A;  3UKZ B;  4WV6 A;  1UPK A;  2Q5D A;  2JKT A;  3Q0L A;  4OO6 A;  5J3V A;  4D4E A;  2JAK A;  5E6Q B;  4FDD A;  3OPB A;  1XQR A;  3L3F X;  5HHG E;  4I5L A;  1IAL A;  2JDQ A;  3Q0S A;  5CL4 A;  4L7M A;  3SL9 A;  4Y5J A;  5CTT A;  4P6Z B;  1WA5 C;  3FGA B;  1M8Z A;  3KND A;  3ZIL A;  3QHE A;  5EKG A;  5K9S A;  4L4H A;  4YJE A;  5CL6 A;  4V3Q A;  2F31 A;  3UKY B;  4U5S A;  3V6Y A;  2RU4 B;  4CT6 B;  2IX3 A;  2XA7 A;  3PSP A;  4U5O A;  1M8Y A;  3K4E A;  3Q0M A;  3Q0R A;  4I3N A;  5LSW A;  2Z5O A;  1QGR A;  3VLE A;  3Q0O A;  4U5L A;  4FZA A;  5H2W A;  2NPP B;  4UQI A;  5CL9 A;  3ZIN A;  3WOY A;  2XOA A;  5HUY C;  3GNI A;  3C5W A;  4G3A A;  4K92 A;  2PF4 A;  4I2W A;  2JKR B;  4R11 A;  3UVU A;  1TE4 A;  3EG5 B;  3GQ2 A;  3GB8 A;  2QK1 A;  3ZIR A;  4PLS A;  3C2H A;  1F59 A;  4E4V A;  1EJY I;  2P8Q A;  4FZD A;  1W9C A;  2W3C A;  5EKF A;  5KLR B;  4DB8 A;  2YNS A;  4K6J A;  4DB6 A;  4YK6 A;  3Q0Q A;  2RU4 A;  3NMX A;  2QNA A;  4MZ5 E;  3BCT A;  1UKL A;  4I37 A;  4I2Z A;  3K5Y A;  4I8M A;  4CB8 A;  3K5Z A;  1W63 B;  4UAD A;  4B8J A;  2YJY A;  4B18 A;  2DB0 A;  4EVP A;  1M5N S;  1QBK B;  4RV1 A;  3K7V A;  5KUB A;  2Z5N A;  2BCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...