3K64A

Crystal structure of fbf-2/fem-3 pme complex
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
400
structure length
400
Chain Sequence
LPTWSLDSNGEMRSRLSLSEVLDSGDLMKFAVDKTGCQFLEKAVKGSLTSYQKFQLFEQVIGRKDDFLKLSTNIFGNYLVQSVIGISLATNDDGYTKRQEKLKNFISSQMTDMCLDKFACRVIQSSLQNMDLSLACKLVQALPRDARLIAICVDQNANHVIQKVVAVIPLKNWEFIVDFVATPEHLRQICSDKYGCRVVQTIIEKLTADSMNVDLTSAAQNLRERALQRLMTSVTNRCQELATNEYANYIIQHIVSNDDLAVYRECIIEKCLMRNLLSLSQEKFASHVVEKAFLHAPLELLAEMMDEIFDGYIPHPDTGKDALDIMMFHQFGNYVVQCMLTICCDAVSGRRQTKEGGYDHAISFQDWLKKLHSRVTKERHRLSRFSSGKKMIETLANLRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fem-3 mRNA-binding factor 2
publication title Structural basis for specific recognition of multiple mRNA targets by a PUF regulatory protein.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Rna/rna binding protein
total genus 152
structure length 400
sequence length 400
ec nomenclature
pdb deposition date 2009-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00806 PUF Pumilio-family RNA binding repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 3k64A00
4FZFA 1U6GC 3K49A 5BZ5A 5KL1A 4QMHA 3GQ2A 2OT8A 3O2TA 3UL1B 1JPWA 3IBVA 3QHEA 3K4EA 4CRVB 3O4XA 4H3KA 5BYMA 3K7VA 3K64A 4HNMA 1M1EA 3Q0LA 4ZDUA 2PF4A 3TPOA 3GVOA 1W9CA 2JKRB 5J3VA 3GS3A 3QGCA 5LSWA 1UPKA 4L7MA 4PVZA 3C2GA 3UKXB 1F59A 5HUWC 2RU4B 2XA7A 4TNMA 1EE4A 3K7WA 3LWWA 4B8PA 4ADYA 4U54A 3GB8A 5BZUA 2IAEB 3EA5B 4B18A 3VE6A 3L6XA 3NOWA 5SWFA 2C1MA 2QNAA 3PSTA 2Z5KA 5SVZA 1B3UA 4NEEA 1XM9A 4DB8A 4LACA 2Z5OA 4RXHB 3ZINA 5KL8A 3DADA 3UL0B 4GMNA 2VGLB 1W63A 3BCTA 5BZ1A 4WV6A 4K92A 3GVTA 1QZ7A 4XZRB 5KLAA 3K5QA 4UAFB 2JKRA 3ZKVA 1UKLA 5H2XA 1O6PA 5CTTA 4V3QA 2IW3A 2NYMB 2Q5DA 3QMLC 1EJLI 4RZPA 2RU4A 3Q0OA 4OO6A 3W3UA 3OBVA 2NPPA 4K6JA 2DB0A 3C5WA 4FQ3A 2OF3A 4B8JA 4I5LA 2YNSA 3UKYB 1UN0A 1LUJA 2IAEA 2PKGA 3RZXA 2X19B 1V18A 4U3JC 1Q1TC 4I5NA 4EVPA 1BK5A 1TH1A 1W63B 4V3OA 3GAEA 1QGKA 4O27A 2VGLA 3WOZA 4H3HA 4CB9A 3OUXA 2IE4A 4CV5B 4D49A 4PLSA 4NZWA 1M8WA 1M5NS 1WA5C 2JKTB 3Q0NA 3NMXA 4GMOA 4U5OA 4A0CA 3ZIPA 3GNIA 3ZIOA 2GL7A 1M8XA 2P8QA 3Q5UA 3A6PA 4FFBC 4QMJA 2NPPB 4HM9A 2YNRA 3UVUA 4YJEA 2QK1A 2NYMA 1O6OA 2W3CA 3T7UA 4BPLA 3L3QA 3LTJA 3ZHPA 1G3JA 1I7WA 4MZ6E 5HUYC 5JJAA 3KNDA 2Z5NA 5FC8E 3UKWB 1IBRB 4BQKA 3OUWA 1IQ1C 1T08A 3FGAB 3OPBA 4EV8A 4U5SA 4YJLA 3BSXA 1XQRA 4QMIA 4E4VA 2YJYA 3WOYA 4CT6B 4MFVA 1HO8A 3AU3A 3FEXC 4JLQA 1IB2A 4MFUA 3ODSA 4CT7B 4V3RA 3Q0PA 4KZGA 3BTRC 3Q0MA 4DB6A 3IFQA 1IALA 3O2SA 4MZ5E 4FZDA 3UKZB 2Z6HA 5SW9A 4JW2B 2JKTA 3WYFC 4HTVA 4OIHA 1OYZA 3V6YA 3GRLA 1LRVA 4DB9A 4DVGB 2Z6GA 3OQSA 4U5UA 2X1GF 3K61A 4EVAA 4UWXA 2IX3A 4Y5JA 3QG9A 2F31A 4BA3A 4R0ZA 5KLTB 1UPLA 1WA5B 2NYLA 3FGAA 3Q0QA 4U5VA 2QMRA 5DN7A 4YK6A 4CRUB 4HXTA 4EVTA 3H3DX 4IMIA 4UAEA 4PLQA 3K5ZA 3RZ9A 4R10A 1QGRA 4DBAA 3NMWA 5EWPA 3VWAA 1XQSA 5EKGA 3EBBA 3TPMA 4R11A 3K62A 1M8ZA 5EKFA 2BKUB 3QGBA 1Q1SC 5D5KC 2BNXA 3ZIRA 3ZIQA 4D4EA 3DW8A 4FDDA 3BWTA 5AEIA 4UADA 3V71A 3TJ3A 1I7XA 4B8OA 2IWHA 4UQIA 1EE5A 3FEYC 4G3AA 1BK6A 4I2WA 3ODRA 4U5NA 2NYLB 1GCJA 3V74A 2QK2A 3O2QA 3TJZB 4YGXA 4RV1A 4U5LA 3PSPA 2BCTA 2JDQA 1QBKB 3BX2A 4EV9A 4I2ZA 4FZAA 3TT9A 1PJNB 1Z2CB 4U58A 4P6ZG 5H2WA 2Z5MA 5E6QB 3K5YA 1Y2AC 1EJYI 2WTKA 3EG5B 4CB8A 2FV2A 3NMZA 2JAKA 4P6ZB 4YI0C 5BZVA 2BAPA 3Q0RA 3C2HA 4DJSA 1PJMB 3Q0SA 5K6SA 4UQIB 4IMJA 1JPPA 2XA7B 1M8YA 4CBAA 4PLRA 3L6YA 2Z5JA 3WPTA 5B56A 3ND2A 4DZSA 5K9SA 3L3FX 2H4MA 5KLRB 3TX7A 5HHGE 2IE3A 1JDHA 2C1TA 3BX3A 3LTMA 3BSBA
chains in the Genus database with same CATH superfamily
4FZFA 1U6GC 3K49A 5BZ5A 5CLAA 5KL1A 4QMHA 3GQ2A 2OT8A 3O2TA 3UL1B 1JPWA 3IBVA 3QHEA 3K4EA 4CRVB 3O4XA 4H3KA 5BYMA 3K7VA 3K64A 4HNMA 1M1EA 3Q0LA 5CLDA 4ZDUA 2PF4A 3TPOA 3GVOA 1W9CA 4L4IA 2JKRB 5J3VA 3GS3A 3QGCA 4I37A 5LSWA 1UPKA 3JX7A 4L7MA 4PVZA 3C2GA 3UKXB 1F59A 5HUWC 2RU4B 2XA7A 4TNMA 1EE4A 3K7WA 4I6IA 3LWWA 4B8PA 4ADYA 4U54A 3GB8A 5BZUA 2IAEB 3EA5B 4B18A 3ZIKA 3VE6A 3L6XA 3NOWA 5SWFA 2C1MA 2QNAA 3PSTA 2Z5KA 5SVZA 1B3UA 4NEEA 1XM9A 4DB8A 3VLEA 4LACA 2Z5OA 4RXHB 3ZINA 5KL8A 4FP7A 3DADA 3UL0B 5CLCA 4GMNA 2VGLB 1W63A 3BCTA 5BZ1A 4WV6A 4K92A 3GVTA 1QZ7A 4XZRB 5KLAA 5CL3A 3K5QA 4UAFB 2JKRA 3ZKVA 1TE4A 1UKLA 5H2XA 5CL8A 1O6PA 5CTTA 4V3QA 2IW3A 2NYMB 2Q5DA 3QMLC 1EJLI 4RZPA 2RU4A 3Q0OA 4OO6A 3W3UA 3OBVA 2NPPA 4K6JA 5CL4A 2DB0A 3C5WA 4FQ3A 2OF3A 4B8JA 4I5LA 2YNSA 3UKYB 1UN0A 1LUJA 2IAEA 2PKGA 3RZXA 2X19B 1V18A 4U3JC 1Q1TC 4I5NA 4EVPA 1BK5A 4JW3C 5CL6A 1TH1A 1W63B 4V3OA 3GAEA 1QGKA 4O27A 2VGLA 3WOZA 4H3HA 4A3TA 3OUXA 4CB9A 2IE4A 3JXZA 4CV5B 4D49A 4PLSA 4NZWA 1M8WA 1M5NS 1WA5C 2JKTB 3Q0NA 3NMXA 4GMOA 4U5OA 4A0CA 3ZIPA 3GNIA 3ZIOA 2GL7A 1M8XA 2P8QA 3Q5UA 3A6PA 4FFBC 4I7IA 4QMJA 4I2SA 2NPPB 4HM9A 2YNRA 3UVUA 3VLDA 4YJEA 2QK1A 2NYMA 3T8SA 1O6OA 3UJ4A 2W3CA 3T7UA 4BPLA 3L3QA 3LTJA 3ZHPA 1G3JA 1I7WA 4MZ6E 5HUYC 5JJAA 3KNDA 2Z5NA 5FC8E 3UKWB 5CLEA 1IBRB 4BQKA 3OUWA 1IQ1C 1T08A 3FGAB 3OPBA 4EV8A 4U5SA 4YJLA 3BSXA 1XQRA 1N4KA 4QMIA 4E4VA 2YJYA 3WOYA 4CT6B 4MFVA 1HO8A 3AU3A 3FEXC 4JLQA 1IB2A 4MFUA 3ODSA 4CT7B 4V3RA 3Q0PA 4KZGA 5CL9A 3BTRC 3Q0MA 4DB6A 3IFQA 1IALA 3O2SA 4MZ5E 4FZDA 3UKZB 2Z6HA 4I96A 5SW9A 4JW2B 2JKTA 3WYFC 4HTVA 4OIHA 1OYZA 3V6YA 3GRLA 1LRVA 4DB9A 4DVGB 2Z6GA 3OQSA 4U5UA 3VLFA 2X1GF 5CL7A 3K61A 4EVAA 4UWXA 2IX3A 4Y5JA 3QG9A 2F31A 4BA3A 4R0ZA 5KLTB 3JY1A 1UPLA 1WA5B 2NYLA 5CLBA 3FGAA 3Q0QA 2XOAA 4U5VA 2QMRA 5DN7A 4YK6A 4CRUB 4I3NA 5KUBA 3JXYA 4HXTA 4EVTA 3H3DX 4IMIA 4UAEA 4PLQA 3K5ZA 3RZ9A 4R10A 1QGRA 4DBAA 3NMWA 5EWPA 3VWAA 1XQSA 5EKGA 3EBBA 3TPMA 4R11A 3K62A 1M8ZA 3UJ0A 4JW2A 5EKFA 2BKUB 3QGBA 1Q1SC 5D5KC 4A3VA 2BNXA 3ZIRA 3ZIQA 3DW8A 4D4EA 4FDDA 3BWTA 5AEIA 4UADA 3V71A 3TJ3A 1I7XA 4B8OA 2IWHA 4UQIA 1EE5A 3FEYC 4G3AA 4U2XD 1BK6A 3BVSA 4I2WA 3ODRA 4U5NA 2NYLB 1GCJA 3V74A 2QK2A 3O2QA 3TJZB 4YGXA 4RV1A 4U5LA 3PSPA 3SLAA 2BCTA 2JDQA 1QBKB 3BX2A 4EV9A 4I2ZA 4FZAA 3TT9A 3ZILA 1PJNB 1Z2CB 4U58A 4P6ZG 5H2WA 2Z5MA 5E6QB 3K5YA 1Y2AC 1EJYI 2WTKA 3EG5B 4CB8A 2FV2A 3NMZA 2JAKA 4P6ZB 4YI0C 5BZVA 2BAPA 3Q0RA 4I1EA 3C2HA 1LSHA 4DJSA 1PJMB 3Q0SA 5K6SA 4JKQA 4UQIB 4IMJA 1JPPA 2XA7B 1M8YA 4CBAA 4PLRA 3L6YA 2Z5JA 3WPTA 5B56A 3ND2A 4DZSA 5K9SA 3L3FX 2H4MA 4L4HA 5KLRB 3TX7A 5HHGE 2IE3A 5CL5A 1JDHA 2C1TA 4I8MA 3SL9A 3BX3A 3LTMA 4I0YA 3BSBA
chains in the Genus database with same CATH topology
4FZFA 1U6GC 3K49A 5BZ5A 5CLAA 5KL1A 4QMHA 3GQ2A 2OT8A 3O2TA 3UL1B 1JPWA 3IBVA 3QHEA 3K4EA 4CRVB 3O4XA 4H3KA 5BYMA 3K7VA 3K64A 4HNMA 1M1EA 3Q0LA 5CLDA 4ZDUA 2PF4A 3TPOA 3GVOA 1W9CA 4L4IA 2JKRB 5J3VA 3GS3A 3QGCA 4I37A 5LSWA 1UPKA 3JX7A 4L7MA 4PVZA 3C2GA 3UKXB 1F59A 5HUWC 2RU4B 2XA7A 4TNMA 1EE4A 3K7WA 4I6IA 3LWWA 4B8PA 4ADYA 4U54A 3GB8A 5BZUA 2IAEB 3EA5B 4B18A 3ZIKA 3VE6A 3L6XA 3NOWA 5SWFA 2C1MA 2QNAA 3PSTA 2Z5KA 5SVZA 1B3UA 4NEEA 1XM9A 4DB8A 3VLEA 4LACA 2Z5OA 4RXHB 3ZINA 5KL8A 4FP7A 3DADA 3UL0B 5CLCA 4GMNA 2VGLB 1W63A 3BCTA 5BZ1A 4WV6A 4K92A 3GVTA 1QZ7A 4XZRB 5KLAA 5CL3A 3K5QA 4UAFB 2JKRA 3ZKVA 1TE4A 1UKLA 5H2XA 5CL8A 1O6PA 5CTTA 4V3QA 2IW3A 2NYMB 2Q5DA 3QMLC 1EJLI 4RZPA 2RU4A 3Q0OA 4OO6A 3W3UA 3OBVA 2NPPA 4K6JA 5CL4A 2DB0A 3C5WA 4FQ3A 2OF3A 4B8JA 4I5LA 2YNSA 3UKYB 1UN0A 1LUJA 2IAEA 2PKGA 3RZXA 2X19B 1V18A 4U3JC 1Q1TC 4I5NA 4EVPA 1BK5A 4JW3C 5CL6A 1TH1A 1W63B 4V3OA 3GAEA 1QGKA 4O27A 2VGLA 3WOZA 4H3HA 4A3TA 3OUXA 4CB9A 2IE4A 3JXZA 4CV5B 4D49A 4PLSA 4NZWA 1M8WA 1M5NS 1WA5C 2JKTB 3Q0NA 3NMXA 4GMOA 4U5OA 4A0CA 3ZIPA 3GNIA 3ZIOA 2GL7A 1M8XA 2P8QA 3Q5UA 3A6PA 4FFBC 4I7IA 4QMJA 4I2SA 2NPPB 4HM9A 2YNRA 3UVUA 3VLDA 4YJEA 2QK1A 2NYMA 1O6OA 2W3CA 3T7UA 4BPLA 3L3QA 3LTJA 3ZHPA 1G3JA 1I7WA 4MZ6E 5HUYC 5JJAA 3KNDA 2Z5NA 5FC8E 3UKWB 5CLEA 1IBRB 4BQKA 3OUWA 1IQ1C 1T08A 3FGAB 3OPBA 4EV8A 4U5SA 4YJLA 3BSXA 1XQRA 4QMIA 4E4VA 2YJYA 3WOYA 4CT6B 4MFVA 1HO8A 3AU3A 3FEXC 4JLQA 1IB2A 4MFUA 3ODSA 4CT7B 4V3RA 3Q0PA 4KZGA 5CL9A 3BTRC 3Q0MA 4DB6A 3IFQA 1IALA 3O2SA 4MZ5E 4FZDA 3UKZB 2Z6HA 4I96A 5SW9A 4JW2B 2JKTA 3WYFC 4HTVA 4OIHA 1OYZA 3V6YA 3GRLA 1LRVA 4DB9A 4DVGB 2Z6GA 3OQSA 4U5UA 3VLFA 2X1GF 5CL7A 3K61A 4EVAA 4UWXA 2IX3A 4Y5JA 3QG9A 2F31A 4BA3A 4R0ZA 5KLTB 3JY1A 1UPLA 1WA5B 2NYLA 5CLBA 3FGAA 3Q0QA 2XOAA 4U5VA 2QMRA 5DN7A 4YK6A 4CRUB 4I3NA 5KUBA 3JXYA 4HXTA 4EVTA 3H3DX 4IMIA 4UAEA 4PLQA 3K5ZA 3RZ9A 4R10A 1QGRA 4DBAA 3NMWA 5EWPA 3VWAA 1XQSA 5EKGA 3EBBA 3TPMA 4R11A 3K62A 1M8ZA 4JW2A 5EKFA 2BKUB 3QGBA 1Q1SC 5D5KC 4A3VA 2BNXA 3ZIRA 3ZIQA 3DW8A 4D4EA 4FDDA 3BWTA 5AEIA 4UADA 3V71A 3TJ3A 1I7XA 4B8OA 2IWHA 4UQIA 1EE5A 3FEYC 4G3AA 4U2XD 1BK6A 3BVSA 4I2WA 3ODRA 4U5NA 2NYLB 1GCJA 3V74A 2QK2A 3O2QA 3TJZB 4YGXA 4RV1A 4U5LA 3PSPA 3SLAA 2BCTA 2JDQA 1QBKB 3BX2A 4EV9A 4I2ZA 4FZAA 3TT9A 3ZILA 1PJNB 1Z2CB 4U58A 4P6ZG 5H2WA 2Z5MA 5E6QB 3K5YA 1Y2AC 1EJYI 2WTKA 3EG5B 4CB8A 2FV2A 3NMZA 2JAKA 4P6ZB 4YI0C 5BZVA 2BAPA 3Q0RA 4I1EA 3C2HA 4DJSA 1PJMB 3Q0SA 5K6SA 4JKQA 4UQIB 4IMJA 1JPPA 2XA7B 1M8YA 4CBAA 4PLRA 3L6YA 2Z5JA 3WPTA 5B56A 3ND2A 4DZSA 5K9SA 3L3FX 2H4MA 4L4HA 5KLRB 3TX7A 5HHGE 2IE3A 5CL5A 1JDHA 2C1TA 4I8MA 3SL9A 3BX3A 3LTMA 4I0YA 3BSBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZF A;  1U6G C;  3K49 A;  5BZ5 A;  5KL1 A;  4QMH A;  3GQ2 A;  2OT8 A;  3O2T A;  3UL1 B;  1JPW A;  3IBV A;  3QHE A;  3K4E A;  4CRV B;  3O4X A;  4H3K A;  5BYM A;  3K7V A;  3K64 A;  4HNM A;  1M1E A;  3Q0L A;  4ZDU A;  2PF4 A;  3TPO A;  3GVO A;  1W9C A;  2JKR B;  5J3V A;  3GS3 A;  3QGC A;  5LSW A;  1UPK A;  4L7M A;  4PVZ A;  3C2G A;  3UKX B;  1F59 A;  5HUW C;  2RU4 B;  2XA7 A;  4TNM A;  1EE4 A;  3K7W A;  3LWW A;  4B8P A;  4ADY A;  4U54 A;  3GB8 A;  5BZU A;  2IAE B;  3EA5 B;  4B18 A;  3VE6 A;  3L6X A;  3NOW A;  5SWF A;  2C1M A;  2QNA A;  3PST A;  2Z5K A;  5SVZ A;  1B3U A;  4NEE A;  1XM9 A;  4DB8 A;  4LAC A;  2Z5O A;  4RXH B;  3ZIN A;  5KL8 A;  3DAD A;  3UL0 B;  4GMN A;  2VGL B;  1W63 A;  3BCT A;  5BZ1 A;  4WV6 A;  4K92 A;  3GVT A;  1QZ7 A;  4XZR B;  5KLA A;  3K5Q A;  4UAF B;  2JKR A;  3ZKV A;  1UKL A;  5H2X A;  1O6P A;  5CTT A;  4V3Q A;  2IW3 A;  2NYM B;  2Q5D A;  3QML C;  1EJL I;  4RZP A;  2RU4 A;  3Q0O A;  4OO6 A;  3W3U A;  3OBV A;  2NPP A;  4K6J A;  2DB0 A;  3C5W A;  4FQ3 A;  2OF3 A;  4B8J A;  4I5L A;  2YNS A;  3UKY B;  1UN0 A;  1LUJ A;  2IAE A;  2PKG A;  3RZX A;  2X19 B;  1V18 A;  4U3J C;  1Q1T C;  4I5N A;  4EVP A;  1BK5 A;  1TH1 A;  1W63 B;  4V3O A;  3GAE A;  1QGK A;  4O27 A;  2VGL A;  3WOZ A;  4H3H A;  4CB9 A;  3OUX A;  2IE4 A;  4CV5 B;  4D49 A;  4PLS A;  4NZW A;  1M8W A;  1M5N S;  1WA5 C;  2JKT B;  3Q0N A;  3NMX A;  4GMO A;  4U5O A;  4A0C A;  3ZIP A;  3GNI A;  3ZIO A;  2GL7 A;  1M8X A;  2P8Q A;  3Q5U A;  3A6P A;  4FFB C;  4QMJ A;  2NPP B;  4HM9 A;  2YNR A;  3UVU A;  4YJE A;  2QK1 A;  2NYM A;  1O6O A;  2W3C A;  3T7U A;  4BPL A;  3L3Q A;  3LTJ A;  3ZHP A;  1G3J A;  1I7W A;  4MZ6 E;  5HUY C;  5JJA A;  3KND A;  2Z5N A;  5FC8 E;  3UKW B;  1IBR B;  4BQK A;  3OUW A;  1IQ1 C;  1T08 A;  3FGA B;  3OPB A;  4EV8 A;  4U5S A;  4YJL A;  3BSX A;  1XQR A;  4QMI A;  4E4V A;  2YJY A;  3WOY A;  4CT6 B;  4MFV A;  1HO8 A;  3AU3 A;  3FEX C;  4JLQ A;  1IB2 A;  4MFU A;  3ODS A;  4CT7 B;  4V3R A;  3Q0P A;  4KZG A;  3BTR C;  3Q0M A;  4DB6 A;  3IFQ A;  1IAL A;  3O2S A;  4MZ5 E;  4FZD A;  3UKZ B;  2Z6H A;  5SW9 A;  4JW2 B;  2JKT A;  3WYF C;  4HTV A;  4OIH A;  1OYZ A;  3V6Y A;  3GRL A;  1LRV A;  4DB9 A;  4DVG B;  2Z6G A;  3OQS A;  4U5U A;  2X1G F;  3K61 A;  4EVA A;  4UWX A;  2IX3 A;  4Y5J A;  3QG9 A;  2F31 A;  4BA3 A;  4R0Z A;  5KLT B;  1UPL A;  1WA5 B;  2NYL A;  3FGA A;  3Q0Q A;  4U5V A;  2QMR A;  5DN7 A;  4YK6 A;  4CRU B;  4HXT A;  4EVT A;  3H3D X;  4IMI A;  4UAE A;  4PLQ A;  3K5Z A;  3RZ9 A;  4R10 A;  1QGR A;  4DBA A;  3NMW A;  5EWP A;  3VWA A;  1XQS A;  5EKG A;  3EBB A;  3TPM A;  4R11 A;  3K62 A;  1M8Z A;  5EKF A;  2BKU B;  3QGB A;  1Q1S C;  5D5K C;  2BNX A;  3ZIR A;  3ZIQ A;  4D4E A;  3DW8 A;  4FDD A;  3BWT A;  5AEI A;  4UAD A;  3V71 A;  3TJ3 A;  1I7X A;  4B8O A;  2IWH A;  4UQI A;  1EE5 A;  3FEY C;  4G3A A;  1BK6 A;  4I2W A;  3ODR A;  4U5N A;  2NYL B;  1GCJ A;  3V74 A;  2QK2 A;  3O2Q A;  3TJZ B;  4YGX A;  4RV1 A;  4U5L A;  3PSP A;  2BCT A;  2JDQ A;  1QBK B;  3BX2 A;  4EV9 A;  4I2Z A;  4FZA A;  3TT9 A;  1PJN B;  1Z2C B;  4U58 A;  4P6Z G;  5H2W A;  2Z5M A;  5E6Q B;  3K5Y A;  1Y2A C;  1EJY I;  2WTK A;  3EG5 B;  4CB8 A;  2FV2 A;  3NMZ A;  2JAK A;  4P6Z B;  4YI0 C;  5BZV A;  2BAP A;  3Q0R A;  3C2H A;  4DJS A;  1PJM B;  3Q0S A;  5K6S A;  4UQI B;  4IMJ A;  1JPP A;  2XA7 B;  1M8Y A;  4CBA A;  4PLR A;  3L6Y A;  2Z5J A;  3WPT A;  5B56 A;  3ND2 A;  4DZS A;  5K9S A;  3L3F X;  2H4M A;  5KLR B;  3TX7 A;  5HHG E;  2IE3 A;  1JDH A;  2C1T A;  3BX3 A;  3LTM A;  3BSB A; 
#chains in the Genus database with same CATH topology
 4FZF A;  1U6G C;  3K49 A;  5BZ5 A;  5CLA A;  5KL1 A;  4QMH A;  3GQ2 A;  2OT8 A;  3O2T A;  3UL1 B;  1JPW A;  3IBV A;  3QHE A;  3K4E A;  4CRV B;  3O4X A;  4H3K A;  5BYM A;  3K7V A;  3K64 A;  4HNM A;  1M1E A;  3Q0L A;  5CLD A;  4ZDU A;  2PF4 A;  3TPO A;  3GVO A;  1W9C A;  4L4I A;  2JKR B;  5J3V A;  3GS3 A;  3QGC A;  4I37 A;  5LSW A;  1UPK A;  3JX7 A;  4L7M A;  4PVZ A;  3C2G A;  3UKX B;  1F59 A;  5HUW C;  2RU4 B;  2XA7 A;  4TNM A;  1EE4 A;  3K7W A;  4I6I A;  3LWW A;  4B8P A;  4ADY A;  4U54 A;  3GB8 A;  5BZU A;  2IAE B;  3EA5 B;  4B18 A;  3ZIK A;  3VE6 A;  3L6X A;  3NOW A;  5SWF A;  2C1M A;  2QNA A;  3PST A;  2Z5K A;  5SVZ A;  1B3U A;  4NEE A;  1XM9 A;  4DB8 A;  3VLE A;  4LAC A;  2Z5O A;  4RXH B;  3ZIN A;  5KL8 A;  4FP7 A;  3DAD A;  3UL0 B;  5CLC A;  4GMN A;  2VGL B;  1W63 A;  3BCT A;  5BZ1 A;  4WV6 A;  4K92 A;  3GVT A;  1QZ7 A;  4XZR B;  5KLA A;  5CL3 A;  3K5Q A;  4UAF B;  2JKR A;  3ZKV A;  1TE4 A;  1UKL A;  5H2X A;  5CL8 A;  1O6P A;  5CTT A;  4V3Q A;  2IW3 A;  2NYM B;  2Q5D A;  3QML C;  1EJL I;  4RZP A;  2RU4 A;  3Q0O A;  4OO6 A;  3W3U A;  3OBV A;  2NPP A;  4K6J A;  5CL4 A;  2DB0 A;  3C5W A;  4FQ3 A;  2OF3 A;  4B8J A;  4I5L A;  2YNS A;  3UKY B;  1UN0 A;  1LUJ A;  2IAE A;  2PKG A;  3RZX A;  2X19 B;  1V18 A;  4U3J C;  1Q1T C;  4I5N A;  4EVP A;  1BK5 A;  4JW3 C;  5CL6 A;  1TH1 A;  1W63 B;  4V3O A;  3GAE A;  1QGK A;  4O27 A;  2VGL A;  3WOZ A;  4H3H A;  4A3T A;  3OUX A;  4CB9 A;  2IE4 A;  3JXZ A;  4CV5 B;  4D49 A;  4PLS A;  4NZW A;  1M8W A;  1M5N S;  1WA5 C;  2JKT B;  3Q0N A;  3NMX A;  4GMO A;  4U5O A;  4A0C A;  3ZIP A;  3GNI A;  3ZIO A;  2GL7 A;  1M8X A;  2P8Q A;  3Q5U A;  3A6P A;  4FFB C;  4I7I A;  4QMJ A;  4I2S A;  2NPP B;  4HM9 A;  2YNR A;  3UVU A;  3VLD A;  4YJE A;  2QK1 A;  2NYM A;  3T8S A;  1O6O A;  3UJ4 A;  2W3C A;  3T7U A;  4BPL A;  3L3Q A;  3LTJ A;  3ZHP A;  1G3J A;  1I7W A;  4MZ6 E;  5HUY C;  5JJA A;  3KND A;  2Z5N A;  5FC8 E;  3UKW B;  5CLE A;  1IBR B;  4BQK A;  3OUW A;  1IQ1 C;  1T08 A;  3FGA B;  3OPB A;  4EV8 A;  4U5S A;  4YJL A;  3BSX A;  1XQR A;  1N4K A;  4QMI A;  4E4V A;  2YJY A;  3WOY A;  4CT6 B;  4MFV A;  1HO8 A;  3AU3 A;  3FEX C;  4JLQ A;  1IB2 A;  4MFU A;  3ODS A;  4CT7 B;  4V3R A;  3Q0P A;  4KZG A;  5CL9 A;  3BTR C;  3Q0M A;  4DB6 A;  3IFQ A;  1IAL A;  3O2S A;  4MZ5 E;  4FZD A;  3UKZ B;  2Z6H A;  4I96 A;  5SW9 A;  4JW2 B;  2JKT A;  3WYF C;  4HTV A;  4OIH A;  1OYZ A;  3V6Y A;  3GRL A;  1LRV A;  4DB9 A;  4DVG B;  2Z6G A;  3OQS A;  4U5U A;  3VLF A;  2X1G F;  5CL7 A;  3K61 A;  4EVA A;  4UWX A;  2IX3 A;  4Y5J A;  3QG9 A;  2F31 A;  4BA3 A;  4R0Z A;  5KLT B;  3JY1 A;  1UPL A;  1WA5 B;  2NYL A;  5CLB A;  3FGA A;  3Q0Q A;  2XOA A;  4U5V A;  2QMR A;  5DN7 A;  4YK6 A;  4CRU B;  4I3N A;  5KUB A;  3JXY A;  4HXT A;  4EVT A;  3H3D X;  4IMI A;  4UAE A;  4PLQ A;  3K5Z A;  3RZ9 A;  4R10 A;  1QGR A;  4DBA A;  3NMW A;  5EWP A;  3VWA A;  1XQS A;  5EKG A;  3EBB A;  3TPM A;  4R11 A;  3K62 A;  1M8Z A;  3UJ0 A;  4JW2 A;  5EKF A;  2BKU B;  3QGB A;  1Q1S C;  5D5K C;  4A3V A;  2BNX A;  3ZIR A;  3ZIQ A;  3DW8 A;  4D4E A;  4FDD A;  3BWT A;  5AEI A;  4UAD A;  3V71 A;  3TJ3 A;  1I7X A;  4B8O A;  2IWH A;  4UQI A;  1EE5 A;  3FEY C;  4G3A A;  4U2X D;  1BK6 A;  3BVS A;  4I2W A;  3ODR A;  4U5N A;  2NYL B;  1GCJ A;  3V74 A;  2QK2 A;  3O2Q A;  3TJZ B;  4YGX A;  4RV1 A;  4U5L A;  3PSP A;  3SLA A;  2BCT A;  2JDQ A;  1QBK B;  3BX2 A;  4EV9 A;  4I2Z A;  4FZA A;  3TT9 A;  3ZIL A;  1PJN B;  1Z2C B;  4U58 A;  4P6Z G;  5H2W A;  2Z5M A;  5E6Q B;  3K5Y A;  1Y2A C;  1EJY I;  2WTK A;  3EG5 B;  4CB8 A;  2FV2 A;  3NMZ A;  2JAK A;  4P6Z B;  4YI0 C;  5BZV A;  2BAP A;  3Q0R A;  4I1E A;  3C2H A;  1LSH A;  4DJS A;  1PJM B;  3Q0S A;  5K6S A;  4JKQ A;  4UQI B;  4IMJ A;  1JPP A;  2XA7 B;  1M8Y A;  4CBA A;  4PLR A;  3L6Y A;  2Z5J A;  3WPT A;  5B56 A;  3ND2 A;  4DZS A;  5K9S A;  3L3F X;  2H4M A;  4L4H A;  5KLR B;  3TX7 A;  5HHG E;  2IE3 A;  5CL5 A;  1JDH A;  2C1T A;  4I8M A;  3SL9 A;  3BX3 A;  3LTM A;  4I0Y A;  3BSB A; 
#chains in the Genus database with same CATH homology
 4FZF A;  1U6G C;  3K49 A;  5BZ5 A;  5CLA A;  5KL1 A;  4QMH A;  3GQ2 A;  2OT8 A;  3O2T A;  3UL1 B;  1JPW A;  3IBV A;  3QHE A;  3K4E A;  4CRV B;  3O4X A;  4H3K A;  5BYM A;  3K7V A;  3K64 A;  4HNM A;  1M1E A;  3Q0L A;  5CLD A;  4ZDU A;  2PF4 A;  3TPO A;  3GVO A;  1W9C A;  4L4I A;  2JKR B;  5J3V A;  3GS3 A;  3QGC A;  4I37 A;  5LSW A;  1UPK A;  3JX7 A;  4L7M A;  4PVZ A;  3C2G A;  3UKX B;  1F59 A;  5HUW C;  2RU4 B;  2XA7 A;  4TNM A;  1EE4 A;  3K7W A;  4I6I A;  3LWW A;  4B8P A;  4ADY A;  4U54 A;  3GB8 A;  5BZU A;  2IAE B;  3EA5 B;  4B18 A;  3ZIK A;  3VE6 A;  3L6X A;  3NOW A;  5SWF A;  2C1M A;  2QNA A;  3PST A;  2Z5K A;  5SVZ A;  1B3U A;  4NEE A;  1XM9 A;  4DB8 A;  3VLE A;  4LAC A;  2Z5O A;  4RXH B;  3ZIN A;  5KL8 A;  4FP7 A;  3DAD A;  3UL0 B;  5CLC A;  4GMN A;  2VGL B;  1W63 A;  3BCT A;  5BZ1 A;  4WV6 A;  4K92 A;  3GVT A;  1QZ7 A;  4XZR B;  5KLA A;  5CL3 A;  3K5Q A;  4UAF B;  2JKR A;  3ZKV A;  1TE4 A;  1UKL A;  5H2X A;  5CL8 A;  1O6P A;  5CTT A;  4V3Q A;  2IW3 A;  2NYM B;  2Q5D A;  3QML C;  1EJL I;  4RZP A;  2RU4 A;  3Q0O A;  4OO6 A;  3W3U A;  3OBV A;  2NPP A;  4K6J A;  5CL4 A;  2DB0 A;  3C5W A;  4FQ3 A;  2OF3 A;  4B8J A;  4I5L A;  2YNS A;  3UKY B;  1UN0 A;  1LUJ A;  2IAE A;  2PKG A;  3RZX A;  2X19 B;  1V18 A;  4U3J C;  1Q1T C;  4I5N A;  4EVP A;  1BK5 A;  4JW3 C;  5CL6 A;  1TH1 A;  1W63 B;  4V3O A;  3GAE A;  1QGK A;  4O27 A;  2VGL A;  3WOZ A;  4H3H A;  4A3T A;  3OUX A;  4CB9 A;  2IE4 A;  3JXZ A;  4CV5 B;  4D49 A;  4PLS A;  4NZW A;  1M8W A;  1M5N S;  1WA5 C;  2JKT B;  3Q0N A;  3NMX A;  4GMO A;  4U5O A;  4A0C A;  3ZIP A;  3GNI A;  3ZIO A;  2GL7 A;  1M8X A;  2P8Q A;  3Q5U A;  3A6P A;  4FFB C;  4I7I A;  4QMJ A;  4I2S A;  2NPP B;  4HM9 A;  2YNR A;  3UVU A;  3VLD A;  4YJE A;  2QK1 A;  2NYM A;  1O6O A;  2W3C A;  3T7U A;  4BPL A;  3L3Q A;  3LTJ A;  3ZHP A;  1G3J A;  1I7W A;  4MZ6 E;  5HUY C;  5JJA A;  3KND A;  2Z5N A;  5FC8 E;  3UKW B;  5CLE A;  1IBR B;  4BQK A;  3OUW A;  1IQ1 C;  1T08 A;  3FGA B;  3OPB A;  4EV8 A;  4U5S A;  4YJL A;  3BSX A;  1XQR A;  4QMI A;  4E4V A;  2YJY A;  3WOY A;  4CT6 B;  4MFV A;  1HO8 A;  3AU3 A;  3FEX C;  4JLQ A;  1IB2 A;  4MFU A;  3ODS A;  4CT7 B;  4V3R A;  3Q0P A;  4KZG A;  5CL9 A;  3BTR C;  3Q0M A;  4DB6 A;  3IFQ A;  1IAL A;  3O2S A;  4MZ5 E;  4FZD A;  3UKZ B;  2Z6H A;  4I96 A;  5SW9 A;  4JW2 B;  2JKT A;  3WYF C;  4HTV A;  4OIH A;  1OYZ A;  3V6Y A;  3GRL A;  1LRV A;  4DB9 A;  4DVG B;  2Z6G A;  3OQS A;  4U5U A;  3VLF A;  2X1G F;  5CL7 A;  3K61 A;  4EVA A;  4UWX A;  2IX3 A;  4Y5J A;  3QG9 A;  2F31 A;  4BA3 A;  4R0Z A;  5KLT B;  3JY1 A;  1UPL A;  1WA5 B;  2NYL A;  5CLB A;  3FGA A;  3Q0Q A;  2XOA A;  4U5V A;  2QMR A;  5DN7 A;  4YK6 A;  4CRU B;  4I3N A;  5KUB A;  3JXY A;  4HXT A;  4EVT A;  3H3D X;  4IMI A;  4UAE A;  4PLQ A;  3K5Z A;  3RZ9 A;  4R10 A;  1QGR A;  4DBA A;  3NMW A;  5EWP A;  3VWA A;  1XQS A;  5EKG A;  3EBB A;  3TPM A;  4R11 A;  3K62 A;  1M8Z A;  4JW2 A;  5EKF A;  2BKU B;  3QGB A;  1Q1S C;  5D5K C;  4A3V A;  2BNX A;  3ZIR A;  3ZIQ A;  3DW8 A;  4D4E A;  4FDD A;  3BWT A;  5AEI A;  4UAD A;  3V71 A;  3TJ3 A;  1I7X A;  4B8O A;  2IWH A;  4UQI A;  1EE5 A;  3FEY C;  4G3A A;  4U2X D;  1BK6 A;  3BVS A;  4I2W A;  3ODR A;  4U5N A;  2NYL B;  1GCJ A;  3V74 A;  2QK2 A;  3O2Q A;  3TJZ B;  4YGX A;  4RV1 A;  4U5L A;  3PSP A;  3SLA A;  2BCT A;  2JDQ A;  1QBK B;  3BX2 A;  4EV9 A;  4I2Z A;  4FZA A;  3TT9 A;  3ZIL A;  1PJN B;  1Z2C B;  4U58 A;  4P6Z G;  5H2W A;  2Z5M A;  5E6Q B;  3K5Y A;  1Y2A C;  1EJY I;  2WTK A;  3EG5 B;  4CB8 A;  2FV2 A;  3NMZ A;  2JAK A;  4P6Z B;  4YI0 C;  5BZV A;  2BAP A;  3Q0R A;  4I1E A;  3C2H A;  4DJS A;  1PJM B;  3Q0S A;  5K6S A;  4JKQ A;  4UQI B;  4IMJ A;  1JPP A;  2XA7 B;  1M8Y A;  4CBA A;  4PLR A;  3L6Y A;  2Z5J A;  3WPT A;  5B56 A;  3ND2 A;  4DZS A;  5K9S A;  3L3F X;  2H4M A;  4L4H A;  5KLR B;  3TX7 A;  5HHG E;  2IE3 A;  5CL5 A;  1JDH A;  2C1T A;  4I8M A;  3SL9 A;  3BX3 A;  3LTM A;  4I0Y A;  3BSB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...