3K64A

Crystal structure of fbf-2/fem-3 pme complex
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
400
structure length
400
Chain Sequence
LPTWSLDSNGEMRSRLSLSEVLDSGDLMKFAVDKTGCQFLEKAVKGSLTSYQKFQLFEQVIGRKDDFLKLSTNIFGNYLVQSVIGISLATNDDGYTKRQEKLKNFISSQMTDMCLDKFACRVIQSSLQNMDLSLACKLVQALPRDARLIAICVDQNANHVIQKVVAVIPLKNWEFIVDFVATPEHLRQICSDKYGCRVVQTIIEKLTADSMNVDLTSAAQNLRERALQRLMTSVTNRCQELATNEYANYIIQHIVSNDDLAVYRECIIEKCLMRNLLSLSQEKFASHVVEKAFLHAPLELLAEMMDEIFDGYIPHPDTGKDALDIMMFHQFGNYVVQCMLTICCDAVSGRRQTKEGGYDHAISFQDWLKKLHSRVTKERHRLSRFSSGKKMIETLANLRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fem-3 mRNA-binding factor 2
publication title Structural basis for specific recognition of multiple mRNA targets by a PUF regulatory protein.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Rna/rna binding protein
total genus 152
structure length 400
sequence length 400
ec nomenclature
pdb deposition date 2009-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00806 PUF Pumilio-family RNA binding repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.10.10 Mainly Alpha Alpha Horseshoe Leucine-rich Repeat Variant Leucine-rich Repeat Variant 3k64A00
1M8ZA 2VGLB 2Z6HA 4GMOA 4K6JA 4U5OA 5EWPA 3TX7A 3Q0OA 1Q1TC 3QGBA 3L6XA 1G3JA 5SVZA 5KL1A 4CRUB 3K7WA 3RZ9A 2F31A 4KZGA 2IWHA 2XA7A 2QK1A 2YNSA 4BPLA 3DADA 3K5QA 4JLQA 3Q0PA 1Z2CB 5DN7A 1I7XA 4HNMA 3K61A 2JAKA 5SWFA 5EKFA 3GVTA 3IBVA 4FZDA 1XQRA 4DB8A 4QMHA 5J3VA 3NMZA 4DB6A 2QMRA 2Q5DA 4B18A 1EE5A 4L7MA 3FGAB 3IFQA 5H2WA 2NPPA 4U3JC 1EJLI 2JKTA 1Y2AC 3NMWA 4U5UA 1IBRB 4V3QA 3NMXA 4MZ6E 5BZVA 1EJYI 2IX3A 4PLRA 3TT9A 2BCTA 2Z5KA 4FDDA 2NYLA 3K5YA 2NYMB 2PF4A 5SW9A 3Q5UA 3PSTA 4YGXA 1QBKB 4NEEA 5BZ5A 3BTRC 3V6YA 3GQ2A 4FZAA 3Q0SA 5H2XA 2RU4B 4D49A 2FV2A 4UQIB 1JPWA 2IE4A 5KL8A 3QG9A 3L6YA 2IE3A 4R0ZA 1GCJA 2XA7B 4I2ZA 1HO8A 3ZIQA 1UPLA 5CTTA 4U5NA 3TJZB 4LACA 2BAPA 3C2GA 3DW8A 2QK2A 1BK6A 4DZSA 4FQ3A 3GAEA 3UL1B 4HXTA 4CRVB 4ZDUA 5K6SA 1JPPA 5KLAA 4CT6B 1EE4A 5E6QB 5BZ1A 3BCTA 2JDQA 4UADA 2IW3A 3BWTA 4CT7B 3ND2A 1WA5B 2JKRB 2JKTB 2BNXA 2BKUB 4YK6A 4GMNA 3A6PA 2YJYA 4TNMA 3Q0MA 4U58A 3WOYA 4H3HA 4CV5B 4PVZA 2H4MA 4UAEA 1IALA 3V71A 3L3QA 1WA5C 5HUWC 4MZ5E 3GNIA 4I5LA 2IAEB 3BSXA 3LTMA 3UKZB 3UKXB 4D4EA 1W63B 4UAFB 4QMJA 5D5KC 2VGLA 4CB8A 1TH1A 3C2HA 5EKGA 4FZFA 3UKYB 3V74A 4RV1A 3OUWA 3O4XA 2Z6GA 3O2SA 1M1EA 3Q0QA 3QHEA 2X19B 3ZINA 4A0CA 1M8XA 4RXHB 4HTVA 3O2QA 4YJLA 3EBBA 4QMIA 3ZIPA 3WYFC 1LRVA 4EVPA 4V3OA 2YNRA 3ZIOA 4B8JA 4CB9A 4DVGB 4PLQA 1UKLA 3K4EA 4DB9A 4EV9A 2X1GF 4U5LA 2Z5MA 3BX2A 4DBAA 4I2WA 1Q1SC 3BX3A 3C5WA 2QNAA 1M8YA 3K49A 2P8QA 3WOZA 4EV8A 4OO6A 4EVAA 4Y5JA 1BK5A 3K64A 4PLSA 3ZKVA 5HHGE 5AEIA 3OQSA 1QGRA 1M5NS 3H3DX 3EG5B 4U5VA 3OUXA 2NPPB 3GVOA 3VE6A 3K62A 2WTKA 4K92A 1O6OA 3QGCA 3BSBA 3UVUA 1OYZA 4JW2B 3WPTA 4P6ZG 1QZ7A 1QGKA 2C1TA 4B8OA 2RU4A 4UQIA 4YI0C 4WV6A 4RZPA 3FEYC 3VWAA 5KLRB 1PJNB 2OF3A 4U5SA 2NYLB 1I7WA 3OBVA 3EA5B 3LTJA 3PSPA 4H3KA 3GS3A 5FC8E 4FFBC 3Q0NA 2OT8A 4R11A 4CBAA 1PJMB 3O2TA 4HM9A 4O27A 3ZHPA 4NZWA 4IMJA 1LUJA 2GL7A 3Q0RA 3ODSA 1F59A 3QMLC 3UL0B 3TJ3A 1UPKA 3KNDA 3K7VA 3AU3A 3L3FX 1U6GC 2JKRA 3TPOA 5K9SA 3ZIRA 5KLTB 2Z5JA 4R10A 1O6PA 4V3RA 4BA3A 4E4VA 4MFUA 3OPBA 3ODRA 5BYMA 3RZXA 1M8WA 5LSWA 4IMIA 1B3UA 4ADYA 4OIHA 1UN0A 3LWWA 2DB0A 2W3CA 3K5ZA 3TPMA 3GRLA 5B56A 3GB8A 3W3UA 3FGAA 1V18A 1XM9A 2IAEA 1T08A 4I5NA 4DJSA 1W63A 4B8PA 4P6ZB 4BQKA 1IB2A 2Z5OA 4UWXA 4G3AA 1XQSA 3FEXC 3NOWA 4XZRB 3Q0LA 4MFVA 3T7UA 2C1MA 3UKWB 2PKGA 1JDHA 4EVTA 5JJAA 2NYMA 1IQ1C 2Z5NA 4YJEA 4U54A 1W9CA 5BZUA 5HUYC
chains in the Genus database with same CATH superfamily
4I37A 1M8ZA 2VGLB 2Z6HA 4GMOA 4K6JA 4U5OA 5EWPA 3TX7A 3Q0OA 1Q1TC 3QGBA 3L6XA 1G3JA 5SVZA 5KL1A 4CRUB 5CL9A 3K7WA 3RZ9A 5CLDA 2F31A 4KZGA 2IWHA 2XA7A 2QK1A 2YNSA 4BPLA 3DADA 3K5QA 4JLQA 3Q0PA 1Z2CB 5DN7A 1I7XA 4HNMA 3K61A 2JAKA 5SWFA 5EKFA 3GVTA 3IBVA 4FZDA 1XQRA 4DB8A 4QMHA 5J3VA 3NMZA 2XOAA 4DB6A 2QMRA 2Q5DA 4B18A 1EE5A 4L7MA 3FGAB 3ZIKA 3IFQA 5H2WA 4FP7A 2NPPA 4U3JC 1EJLI 2JKTA 1Y2AC 3NMWA 4U5UA 1IBRB 4V3QA 3NMXA 4MZ6E 5BZVA 1EJYI 4JKQA 2IX3A 4PLRA 3TT9A 2BCTA 2Z5KA 4FDDA 2NYLA 3K5YA 2NYMB 2PF4A 5SW9A 3Q5UA 3PSTA 4YGXA 3SLAA 1QBKB 4NEEA 3SL9A 5BZ5A 3BTRC 3V6YA 3BVSA 3GQ2A 4FZAA 3Q0SA 5H2XA 2RU4B 4D49A 2FV2A 4UQIB 4I2SA 1JPWA 2IE4A 5KL8A 3QG9A 3L6YA 2IE3A 4R0ZA 1GCJA 2XA7B 4I2ZA 1HO8A 3ZIQA 1UPLA 5CTTA 4U5NA 3TJZB 4LACA 3VLDA 2BAPA 3C2GA 3DW8A 2QK2A 1BK6A 4DZSA 4FQ3A 3GAEA 3UL1B 4HXTA 3JY1A 4CRVB 4ZDUA 5K6SA 1JPPA 5KLAA 4CT6B 3ZILA 1EE4A 5E6QB 5BZ1A 3BCTA 2JDQA 4UADA 2IW3A 3BWTA 4CT7B 3ND2A 1WA5B 2JKRB 3JXZA 4A3TA 2JKTB 2BNXA 2BKUB 4YK6A 4GMNA 3A6PA 2YJYA 4TNMA 3Q0MA 4U58A 3WOYA 4H3HA 4CV5B 4PVZA 2H4MA 5CL7A 4UAEA 1IALA 1TE4A 3V71A 3L3QA 1WA5C 5HUWC 4MZ5E 3GNIA 5CLEA 4I5LA 2IAEB 3BSXA 4L4HA 3LTMA 3UKZB 3UKXB 4D4EA 1W63B 5KUBA 4UAFB 4QMJA 5D5KC 2VGLA 4JW2A 4I7IA 4CB8A 1TH1A 3C2HA 5EKGA 4FZFA 3UKYB 3V74A 4I96A 4RV1A 3OUWA 3O4XA 4L4IA 2Z6GA 3O2SA 1M1EA 5CL3A 3Q0QA 3QHEA 2X19B 3ZINA 4A0CA 1M8XA 4RXHB 4HTVA 3O2QA 4YJLA 3EBBA 4QMIA 3ZIPA 3WYFC 1LRVA 4EVPA 4V3OA 2YNRA 3ZIOA 4B8JA 4CB9A 1LSHA 4DVGB 4PLQA 1UKLA 3K4EA 4DB9A 4EV9A 2X1GF 4U5LA 2Z5MA 3BX2A 4DBAA 4I2WA 1Q1SC 3BX3A 3C5WA 2QNAA 4JW3C 1M8YA 3K49A 2P8QA 3WOZA 4U2XD 4EV8A 4I0YA 4OO6A 4EVAA 4Y5JA 1BK5A 3K64A 4PLSA 3ZKVA 5HHGE 5AEIA 3OQSA 1QGRA 1M5NS 3H3DX 3EG5B 4U5VA 5CLBA 3OUXA 2NPPB 3GVOA 3VE6A 3K62A 2WTKA 4K92A 1O6OA 3QGCA 3BSBA 3UVUA 1OYZA 4JW2B 3WPTA 4P6ZG 1QZ7A 1QGKA 2C1TA 4I1EA 4B8OA 2RU4A 4UQIA 4YI0C 4WV6A 4RZPA 3FEYC 3VWAA 5KLRB 1PJNB 2OF3A 3VLFA 4U5SA 2NYLB 1I7WA 3OBVA 3EA5B 3VLEA 3LTJA 3PSPA 4H3KA 3GS3A 3UJ0A 5FC8E 4FFBC 4I8MA 3Q0NA 2OT8A 4R11A 4CBAA 3JXYA 1PJMB 5CL6A 3O2TA 4HM9A 4O27A 3ZHPA 4NZWA 4IMJA 1LUJA 2GL7A 3Q0RA 3ODSA 5CLAA 1F59A 3QMLC 3UL0B 3TJ3A 1UPKA 3KNDA 3K7VA 3AU3A 3L3FX 1U6GC 2JKRA 3TPOA 5CL4A 5K9SA 3ZIRA 3JX7A 5KLTB 3T8SA 2Z5JA 4R10A 1O6PA 4V3RA 4BA3A 4E4VA 4MFUA 3OPBA 3ODRA 5BYMA 3RZXA 5CLCA 1M8WA 5LSWA 4IMIA 4I3NA 1B3UA 4ADYA 4OIHA 1UN0A 3LWWA 2DB0A 1N4KA 2W3CA 3K5ZA 3UJ4A 3TPMA 3GRLA 5B56A 3GB8A 3W3UA 3FGAA 1V18A 5CL5A 1XM9A 2IAEA 1T08A 4I6IA 4I5NA 4DJSA 1W63A 4B8PA 4P6ZB 4BQKA 1IB2A 2Z5OA 4UWXA 4G3AA 1XQSA 3FEXC 5CL8A 3NOWA 4XZRB 4A3VA 3Q0LA 4MFVA 3T7UA 3UKWB 2C1MA 2PKGA 1JDHA 4EVTA 5JJAA 2NYMA 1IQ1C 2Z5NA 4YJEA 4U54A 1W9CA 5BZUA 5HUYC
chains in the Genus database with same CATH topology
4I37A 1M8ZA 2VGLB 2Z6HA 4GMOA 4K6JA 4U5OA 5EWPA 3TX7A 3Q0OA 1Q1TC 3QGBA 3L6XA 1G3JA 5SVZA 5KL1A 4CRUB 5CL9A 3K7WA 3RZ9A 5CLDA 2F31A 4KZGA 2IWHA 2XA7A 2QK1A 2YNSA 4BPLA 3DADA 3K5QA 4JLQA 3Q0PA 1Z2CB 5DN7A 1I7XA 4HNMA 3K61A 2JAKA 5SWFA 5EKFA 3GVTA 3IBVA 4FZDA 1XQRA 4DB8A 4QMHA 5J3VA 3NMZA 2XOAA 4DB6A 2QMRA 2Q5DA 4B18A 1EE5A 4L7MA 3FGAB 3ZIKA 3IFQA 5H2WA 4FP7A 2NPPA 4U3JC 1EJLI 2JKTA 1Y2AC 3NMWA 4U5UA 1IBRB 4V3QA 3NMXA 4MZ6E 5BZVA 1EJYI 4JKQA 2IX3A 4PLRA 3TT9A 2BCTA 2Z5KA 4FDDA 2NYLA 3K5YA 2NYMB 2PF4A 5SW9A 3Q5UA 3PSTA 4YGXA 3SLAA 1QBKB 4NEEA 3SL9A 5BZ5A 3BTRC 3V6YA 3BVSA 3GQ2A 4FZAA 3Q0SA 5H2XA 2RU4B 4D49A 2FV2A 4UQIB 4I2SA 1JPWA 2IE4A 5KL8A 3QG9A 3L6YA 2IE3A 4R0ZA 1GCJA 2XA7B 4I2ZA 1HO8A 3ZIQA 1UPLA 5CTTA 4U5NA 3TJZB 4LACA 3VLDA 2BAPA 3C2GA 3DW8A 2QK2A 1BK6A 4DZSA 4FQ3A 3GAEA 3UL1B 4HXTA 3JY1A 4CRVB 4ZDUA 5K6SA 1JPPA 5KLAA 4CT6B 3ZILA 1EE4A 5E6QB 5BZ1A 3BCTA 2JDQA 4UADA 2IW3A 3BWTA 4CT7B 3ND2A 1WA5B 2JKRB 3JXZA 4A3TA 2JKTB 2BNXA 2BKUB 4YK6A 4GMNA 3A6PA 2YJYA 4TNMA 3Q0MA 4U58A 3WOYA 4H3HA 4CV5B 4PVZA 2H4MA 5CL7A 4UAEA 1IALA 1TE4A 3V71A 3L3QA 1WA5C 5HUWC 4MZ5E 3GNIA 5CLEA 4I5LA 2IAEB 3BSXA 4L4HA 3LTMA 3UKZB 3UKXB 4D4EA 1W63B 5KUBA 4UAFB 4QMJA 5D5KC 2VGLA 4JW2A 4I7IA 4CB8A 1TH1A 3C2HA 5EKGA 4FZFA 3UKYB 3V74A 4I96A 4RV1A 3OUWA 3O4XA 4L4IA 2Z6GA 3O2SA 1M1EA 5CL3A 3Q0QA 3QHEA 2X19B 3ZINA 4A0CA 1M8XA 4RXHB 4HTVA 3O2QA 4YJLA 3EBBA 4QMIA 3ZIPA 3WYFC 1LRVA 4EVPA 4V3OA 2YNRA 3ZIOA 4B8JA 4CB9A 4DVGB 4PLQA 1UKLA 3K4EA 4DB9A 4EV9A 2X1GF 4U5LA 2Z5MA 3BX2A 4DBAA 4I2WA 1Q1SC 3BX3A 3C5WA 2QNAA 4JW3C 1M8YA 3K49A 2P8QA 3WOZA 4U2XD 4EV8A 4I0YA 4OO6A 4EVAA 4Y5JA 1BK5A 3K64A 4PLSA 3ZKVA 5HHGE 5AEIA 3OQSA 1QGRA 1M5NS 3H3DX 3EG5B 4U5VA 5CLBA 3OUXA 2NPPB 3GVOA 3VE6A 3K62A 2WTKA 4K92A 1O6OA 3QGCA 3BSBA 3UVUA 1OYZA 4JW2B 3WPTA 4P6ZG 1QZ7A 1QGKA 2C1TA 4I1EA 4B8OA 2RU4A 4UQIA 4YI0C 4WV6A 4RZPA 3FEYC 3VWAA 5KLRB 1PJNB 2OF3A 3VLFA 4U5SA 2NYLB 1I7WA 3OBVA 3EA5B 3VLEA 3LTJA 3PSPA 4H3KA 3GS3A 5FC8E 4FFBC 4I8MA 3Q0NA 2OT8A 4R11A 4CBAA 3JXYA 1PJMB 5CL6A 3O2TA 4HM9A 4O27A 3ZHPA 4NZWA 4IMJA 1LUJA 2GL7A 3Q0RA 3ODSA 5CLAA 1F59A 3QMLC 3UL0B 3TJ3A 1UPKA 3KNDA 3K7VA 3AU3A 3L3FX 1U6GC 2JKRA 3TPOA 5CL4A 5K9SA 3ZIRA 3JX7A 5KLTB 2Z5JA 4R10A 1O6PA 4V3RA 4BA3A 4E4VA 4MFUA 3OPBA 3ODRA 5BYMA 3RZXA 5CLCA 1M8WA 5LSWA 4IMIA 4I3NA 1B3UA 4ADYA 4OIHA 1UN0A 3LWWA 2DB0A 2W3CA 3K5ZA 3TPMA 3GRLA 5B56A 3GB8A 3W3UA 3FGAA 1V18A 5CL5A 1XM9A 2IAEA 1T08A 4I6IA 4I5NA 4DJSA 1W63A 4B8PA 4P6ZB 4BQKA 1IB2A 2Z5OA 4UWXA 4G3AA 1XQSA 3FEXC 5CL8A 3NOWA 4XZRB 4A3VA 3Q0LA 4MFVA 3T7UA 3UKWB 2C1MA 2PKGA 1JDHA 4EVTA 5JJAA 2NYMA 1IQ1C 2Z5NA 4YJEA 4U54A 1W9CA 5BZUA 5HUYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M8Z A;  2VGL B;  2Z6H A;  4GMO A;  4K6J A;  4U5O A;  5EWP A;  3TX7 A;  3Q0O A;  1Q1T C;  3QGB A;  3L6X A;  1G3J A;  5SVZ A;  5KL1 A;  4CRU B;  3K7W A;  3RZ9 A;  2F31 A;  4KZG A;  2IWH A;  2XA7 A;  2QK1 A;  2YNS A;  4BPL A;  3DAD A;  3K5Q A;  4JLQ A;  3Q0P A;  1Z2C B;  5DN7 A;  1I7X A;  4HNM A;  3K61 A;  2JAK A;  5SWF A;  5EKF A;  3GVT A;  3IBV A;  4FZD A;  1XQR A;  4DB8 A;  4QMH A;  5J3V A;  3NMZ A;  4DB6 A;  2QMR A;  2Q5D A;  4B18 A;  1EE5 A;  4L7M A;  3FGA B;  3IFQ A;  5H2W A;  2NPP A;  4U3J C;  1EJL I;  2JKT A;  1Y2A C;  3NMW A;  4U5U A;  1IBR B;  4V3Q A;  3NMX A;  4MZ6 E;  5BZV A;  1EJY I;  2IX3 A;  4PLR A;  3TT9 A;  2BCT A;  2Z5K A;  4FDD A;  2NYL A;  3K5Y A;  2NYM B;  2PF4 A;  5SW9 A;  3Q5U A;  3PST A;  4YGX A;  1QBK B;  4NEE A;  5BZ5 A;  3BTR C;  3V6Y A;  3GQ2 A;  4FZA A;  3Q0S A;  5H2X A;  2RU4 B;  4D49 A;  2FV2 A;  4UQI B;  1JPW A;  2IE4 A;  5KL8 A;  3QG9 A;  3L6Y A;  2IE3 A;  4R0Z A;  1GCJ A;  2XA7 B;  4I2Z A;  1HO8 A;  3ZIQ A;  1UPL A;  5CTT A;  4U5N A;  3TJZ B;  4LAC A;  2BAP A;  3C2G A;  3DW8 A;  2QK2 A;  1BK6 A;  4DZS A;  4FQ3 A;  3GAE A;  3UL1 B;  4HXT A;  4CRV B;  4ZDU A;  5K6S A;  1JPP A;  5KLA A;  4CT6 B;  1EE4 A;  5E6Q B;  5BZ1 A;  3BCT A;  2JDQ A;  4UAD A;  2IW3 A;  3BWT A;  4CT7 B;  3ND2 A;  1WA5 B;  2JKR B;  2JKT B;  2BNX A;  2BKU B;  4YK6 A;  4GMN A;  3A6P A;  2YJY A;  4TNM A;  3Q0M A;  4U58 A;  3WOY A;  4H3H A;  4CV5 B;  4PVZ A;  2H4M A;  4UAE A;  1IAL A;  3V71 A;  3L3Q A;  1WA5 C;  5HUW C;  4MZ5 E;  3GNI A;  4I5L A;  2IAE B;  3BSX A;  3LTM A;  3UKZ B;  3UKX B;  4D4E A;  1W63 B;  4UAF B;  4QMJ A;  5D5K C;  2VGL A;  4CB8 A;  1TH1 A;  3C2H A;  5EKG A;  4FZF A;  3UKY B;  3V74 A;  4RV1 A;  3OUW A;  3O4X A;  2Z6G A;  3O2S A;  1M1E A;  3Q0Q A;  3QHE A;  2X19 B;  3ZIN A;  4A0C A;  1M8X A;  4RXH B;  4HTV A;  3O2Q A;  4YJL A;  3EBB A;  4QMI A;  3ZIP A;  3WYF C;  1LRV A;  4EVP A;  4V3O A;  2YNR A;  3ZIO A;  4B8J A;  4CB9 A;  4DVG B;  4PLQ A;  1UKL A;  3K4E A;  4DB9 A;  4EV9 A;  2X1G F;  4U5L A;  2Z5M A;  3BX2 A;  4DBA A;  4I2W A;  1Q1S C;  3BX3 A;  3C5W A;  2QNA A;  1M8Y A;  3K49 A;  2P8Q A;  3WOZ A;  4EV8 A;  4OO6 A;  4EVA A;  4Y5J A;  1BK5 A;  3K64 A;  4PLS A;  3ZKV A;  5HHG E;  5AEI A;  3OQS A;  1QGR A;  1M5N S;  3H3D X;  3EG5 B;  4U5V A;  3OUX A;  2NPP B;  3GVO A;  3VE6 A;  3K62 A;  2WTK A;  4K92 A;  1O6O A;  3QGC A;  3BSB A;  3UVU A;  1OYZ A;  4JW2 B;  3WPT A;  4P6Z G;  1QZ7 A;  1QGK A;  2C1T A;  4B8O A;  2RU4 A;  4UQI A;  4YI0 C;  4WV6 A;  4RZP A;  3FEY C;  3VWA A;  5KLR B;  1PJN B;  2OF3 A;  4U5S A;  2NYL B;  1I7W A;  3OBV A;  3EA5 B;  3LTJ A;  3PSP A;  4H3K A;  3GS3 A;  5FC8 E;  4FFB C;  3Q0N A;  2OT8 A;  4R11 A;  4CBA A;  1PJM B;  3O2T A;  4HM9 A;  4O27 A;  3ZHP A;  4NZW A;  4IMJ A;  1LUJ A;  2GL7 A;  3Q0R A;  3ODS A;  1F59 A;  3QML C;  3UL0 B;  3TJ3 A;  1UPK A;  3KND A;  3K7V A;  3AU3 A;  3L3F X;  1U6G C;  2JKR A;  3TPO A;  5K9S A;  3ZIR A;  5KLT B;  2Z5J A;  4R10 A;  1O6P A;  4V3R A;  4BA3 A;  4E4V A;  4MFU A;  3OPB A;  3ODR A;  5BYM A;  3RZX A;  1M8W A;  5LSW A;  4IMI A;  1B3U A;  4ADY A;  4OIH A;  1UN0 A;  3LWW A;  2DB0 A;  2W3C A;  3K5Z A;  3TPM A;  3GRL A;  5B56 A;  3GB8 A;  3W3U A;  3FGA A;  1V18 A;  1XM9 A;  2IAE A;  1T08 A;  4I5N A;  4DJS A;  1W63 A;  4B8P A;  4P6Z B;  4BQK A;  1IB2 A;  2Z5O A;  4UWX A;  4G3A A;  1XQS A;  3FEX C;  3NOW A;  4XZR B;  3Q0L A;  4MFV A;  3T7U A;  2C1M A;  3UKW B;  2PKG A;  1JDH A;  4EVT A;  5JJA A;  2NYM A;  1IQ1 C;  2Z5N A;  4YJE A;  4U54 A;  1W9C A;  5BZU A;  5HUY C; 
#chains in the Genus database with same CATH topology
 4I37 A;  1M8Z A;  2VGL B;  2Z6H A;  4GMO A;  4K6J A;  4U5O A;  5EWP A;  3TX7 A;  3Q0O A;  1Q1T C;  3QGB A;  3L6X A;  1G3J A;  5SVZ A;  5KL1 A;  4CRU B;  5CL9 A;  3K7W A;  3RZ9 A;  5CLD A;  2F31 A;  4KZG A;  2IWH A;  2XA7 A;  2QK1 A;  2YNS A;  4BPL A;  3DAD A;  3K5Q A;  4JLQ A;  3Q0P A;  1Z2C B;  5DN7 A;  1I7X A;  4HNM A;  3K61 A;  2JAK A;  5SWF A;  5EKF A;  3GVT A;  3IBV A;  4FZD A;  1XQR A;  4DB8 A;  4QMH A;  5J3V A;  3NMZ A;  2XOA A;  4DB6 A;  2QMR A;  2Q5D A;  4B18 A;  1EE5 A;  4L7M A;  3FGA B;  3ZIK A;  3IFQ A;  5H2W A;  4FP7 A;  2NPP A;  4U3J C;  1EJL I;  2JKT A;  1Y2A C;  3NMW A;  4U5U A;  1IBR B;  4V3Q A;  3NMX A;  4MZ6 E;  5BZV A;  1EJY I;  4JKQ A;  2IX3 A;  4PLR A;  3TT9 A;  2BCT A;  2Z5K A;  4FDD A;  2NYL A;  3K5Y A;  2NYM B;  2PF4 A;  5SW9 A;  3Q5U A;  3PST A;  4YGX A;  3SLA A;  1QBK B;  4NEE A;  3SL9 A;  5BZ5 A;  3BTR C;  3V6Y A;  3BVS A;  3GQ2 A;  4FZA A;  3Q0S A;  5H2X A;  2RU4 B;  4D49 A;  2FV2 A;  4UQI B;  4I2S A;  1JPW A;  2IE4 A;  5KL8 A;  3QG9 A;  3L6Y A;  2IE3 A;  4R0Z A;  1GCJ A;  2XA7 B;  4I2Z A;  1HO8 A;  3ZIQ A;  1UPL A;  5CTT A;  4U5N A;  3TJZ B;  4LAC A;  3VLD A;  2BAP A;  3C2G A;  3DW8 A;  2QK2 A;  1BK6 A;  4DZS A;  4FQ3 A;  3GAE A;  3UL1 B;  4HXT A;  3JY1 A;  4CRV B;  4ZDU A;  5K6S A;  1JPP A;  5KLA A;  4CT6 B;  3ZIL A;  1EE4 A;  5E6Q B;  5BZ1 A;  3BCT A;  2JDQ A;  4UAD A;  2IW3 A;  3BWT A;  4CT7 B;  3ND2 A;  1WA5 B;  2JKR B;  3JXZ A;  4A3T A;  2JKT B;  2BNX A;  2BKU B;  4YK6 A;  4GMN A;  3A6P A;  2YJY A;  4TNM A;  3Q0M A;  4U58 A;  3WOY A;  4H3H A;  4CV5 B;  4PVZ A;  2H4M A;  5CL7 A;  4UAE A;  1IAL A;  1TE4 A;  3V71 A;  3L3Q A;  1WA5 C;  5HUW C;  4MZ5 E;  3GNI A;  5CLE A;  4I5L A;  2IAE B;  3BSX A;  4L4H A;  3LTM A;  3UKZ B;  3UKX B;  4D4E A;  1W63 B;  5KUB A;  4UAF B;  4QMJ A;  5D5K C;  2VGL A;  4JW2 A;  4I7I A;  4CB8 A;  1TH1 A;  3C2H A;  5EKG A;  4FZF A;  3UKY B;  3V74 A;  4I96 A;  4RV1 A;  3OUW A;  3O4X A;  4L4I A;  2Z6G A;  3O2S A;  1M1E A;  5CL3 A;  3Q0Q A;  3QHE A;  2X19 B;  3ZIN A;  4A0C A;  1M8X A;  4RXH B;  4HTV A;  3O2Q A;  4YJL A;  3EBB A;  4QMI A;  3ZIP A;  3WYF C;  1LRV A;  4EVP A;  4V3O A;  2YNR A;  3ZIO A;  4B8J A;  4CB9 A;  1LSH A;  4DVG B;  4PLQ A;  1UKL A;  3K4E A;  4DB9 A;  4EV9 A;  2X1G F;  4U5L A;  2Z5M A;  3BX2 A;  4DBA A;  4I2W A;  1Q1S C;  3BX3 A;  3C5W A;  2QNA A;  4JW3 C;  1M8Y A;  3K49 A;  2P8Q A;  3WOZ A;  4U2X D;  4EV8 A;  4I0Y A;  4OO6 A;  4EVA A;  4Y5J A;  1BK5 A;  3K64 A;  4PLS A;  3ZKV A;  5HHG E;  5AEI A;  3OQS A;  1QGR A;  1M5N S;  3H3D X;  3EG5 B;  4U5V A;  5CLB A;  3OUX A;  2NPP B;  3GVO A;  3VE6 A;  3K62 A;  2WTK A;  4K92 A;  1O6O A;  3QGC A;  3BSB A;  3UVU A;  1OYZ A;  4JW2 B;  3WPT A;  4P6Z G;  1QZ7 A;  1QGK A;  2C1T A;  4I1E A;  4B8O A;  2RU4 A;  4UQI A;  4YI0 C;  4WV6 A;  4RZP A;  3FEY C;  3VWA A;  5KLR B;  1PJN B;  2OF3 A;  3VLF A;  4U5S A;  2NYL B;  1I7W A;  3OBV A;  3EA5 B;  3VLE A;  3LTJ A;  3PSP A;  4H3K A;  3GS3 A;  3UJ0 A;  5FC8 E;  4FFB C;  4I8M A;  3Q0N A;  2OT8 A;  4R11 A;  4CBA A;  3JXY A;  1PJM B;  5CL6 A;  3O2T A;  4HM9 A;  4O27 A;  3ZHP A;  4NZW A;  4IMJ A;  1LUJ A;  2GL7 A;  3Q0R A;  3ODS A;  5CLA A;  1F59 A;  3QML C;  3UL0 B;  3TJ3 A;  1UPK A;  3KND A;  3K7V A;  3AU3 A;  3L3F X;  1U6G C;  2JKR A;  3TPO A;  5CL4 A;  5K9S A;  3ZIR A;  3JX7 A;  5KLT B;  3T8S A;  2Z5J A;  4R10 A;  1O6P A;  4V3R A;  4BA3 A;  4E4V A;  4MFU A;  3OPB A;  3ODR A;  5BYM A;  3RZX A;  5CLC A;  1M8W A;  5LSW A;  4IMI A;  4I3N A;  1B3U A;  4ADY A;  4OIH A;  1UN0 A;  3LWW A;  2DB0 A;  1N4K A;  2W3C A;  3K5Z A;  3UJ4 A;  3TPM A;  3GRL A;  5B56 A;  3GB8 A;  3W3U A;  3FGA A;  1V18 A;  5CL5 A;  1XM9 A;  2IAE A;  1T08 A;  4I6I A;  4I5N A;  4DJS A;  1W63 A;  4B8P A;  4P6Z B;  4BQK A;  1IB2 A;  2Z5O A;  4UWX A;  4G3A A;  1XQS A;  3FEX C;  5CL8 A;  3NOW A;  4XZR B;  4A3V A;  3Q0L A;  4MFV A;  3T7U A;  3UKW B;  2C1M A;  2PKG A;  1JDH A;  4EVT A;  5JJA A;  2NYM A;  1IQ1 C;  2Z5N A;  4YJE A;  4U54 A;  1W9C A;  5BZU A;  5HUY C; 
#chains in the Genus database with same CATH homology
 4I37 A;  1M8Z A;  2VGL B;  2Z6H A;  4GMO A;  4K6J A;  4U5O A;  5EWP A;  3TX7 A;  3Q0O A;  1Q1T C;  3QGB A;  3L6X A;  1G3J A;  5SVZ A;  5KL1 A;  4CRU B;  5CL9 A;  3K7W A;  3RZ9 A;  5CLD A;  2F31 A;  4KZG A;  2IWH A;  2XA7 A;  2QK1 A;  2YNS A;  4BPL A;  3DAD A;  3K5Q A;  4JLQ A;  3Q0P A;  1Z2C B;  5DN7 A;  1I7X A;  4HNM A;  3K61 A;  2JAK A;  5SWF A;  5EKF A;  3GVT A;  3IBV A;  4FZD A;  1XQR A;  4DB8 A;  4QMH A;  5J3V A;  3NMZ A;  2XOA A;  4DB6 A;  2QMR A;  2Q5D A;  4B18 A;  1EE5 A;  4L7M A;  3FGA B;  3ZIK A;  3IFQ A;  5H2W A;  4FP7 A;  2NPP A;  4U3J C;  1EJL I;  2JKT A;  1Y2A C;  3NMW A;  4U5U A;  1IBR B;  4V3Q A;  3NMX A;  4MZ6 E;  5BZV A;  1EJY I;  4JKQ A;  2IX3 A;  4PLR A;  3TT9 A;  2BCT A;  2Z5K A;  4FDD A;  2NYL A;  3K5Y A;  2NYM B;  2PF4 A;  5SW9 A;  3Q5U A;  3PST A;  4YGX A;  3SLA A;  1QBK B;  4NEE A;  3SL9 A;  5BZ5 A;  3BTR C;  3V6Y A;  3BVS A;  3GQ2 A;  4FZA A;  3Q0S A;  5H2X A;  2RU4 B;  4D49 A;  2FV2 A;  4UQI B;  4I2S A;  1JPW A;  2IE4 A;  5KL8 A;  3QG9 A;  3L6Y A;  2IE3 A;  4R0Z A;  1GCJ A;  2XA7 B;  4I2Z A;  1HO8 A;  3ZIQ A;  1UPL A;  5CTT A;  4U5N A;  3TJZ B;  4LAC A;  3VLD A;  2BAP A;  3C2G A;  3DW8 A;  2QK2 A;  1BK6 A;  4DZS A;  4FQ3 A;  3GAE A;  3UL1 B;  4HXT A;  3JY1 A;  4CRV B;  4ZDU A;  5K6S A;  1JPP A;  5KLA A;  4CT6 B;  3ZIL A;  1EE4 A;  5E6Q B;  5BZ1 A;  3BCT A;  2JDQ A;  4UAD A;  2IW3 A;  3BWT A;  4CT7 B;  3ND2 A;  1WA5 B;  2JKR B;  3JXZ A;  4A3T A;  2JKT B;  2BNX A;  2BKU B;  4YK6 A;  4GMN A;  3A6P A;  2YJY A;  4TNM A;  3Q0M A;  4U58 A;  3WOY A;  4H3H A;  4CV5 B;  4PVZ A;  2H4M A;  5CL7 A;  4UAE A;  1IAL A;  1TE4 A;  3V71 A;  3L3Q A;  1WA5 C;  5HUW C;  4MZ5 E;  3GNI A;  5CLE A;  4I5L A;  2IAE B;  3BSX A;  4L4H A;  3LTM A;  3UKZ B;  3UKX B;  4D4E A;  1W63 B;  5KUB A;  4UAF B;  4QMJ A;  5D5K C;  2VGL A;  4JW2 A;  4I7I A;  4CB8 A;  1TH1 A;  3C2H A;  5EKG A;  4FZF A;  3UKY B;  3V74 A;  4I96 A;  4RV1 A;  3OUW A;  3O4X A;  4L4I A;  2Z6G A;  3O2S A;  1M1E A;  5CL3 A;  3Q0Q A;  3QHE A;  2X19 B;  3ZIN A;  4A0C A;  1M8X A;  4RXH B;  4HTV A;  3O2Q A;  4YJL A;  3EBB A;  4QMI A;  3ZIP A;  3WYF C;  1LRV A;  4EVP A;  4V3O A;  2YNR A;  3ZIO A;  4B8J A;  4CB9 A;  4DVG B;  4PLQ A;  1UKL A;  3K4E A;  4DB9 A;  4EV9 A;  2X1G F;  4U5L A;  2Z5M A;  3BX2 A;  4DBA A;  4I2W A;  1Q1S C;  3BX3 A;  3C5W A;  2QNA A;  4JW3 C;  1M8Y A;  3K49 A;  2P8Q A;  3WOZ A;  4U2X D;  4EV8 A;  4I0Y A;  4OO6 A;  4EVA A;  4Y5J A;  1BK5 A;  3K64 A;  4PLS A;  3ZKV A;  5HHG E;  5AEI A;  3OQS A;  1QGR A;  1M5N S;  3H3D X;  3EG5 B;  4U5V A;  5CLB A;  3OUX A;  2NPP B;  3GVO A;  3VE6 A;  3K62 A;  2WTK A;  4K92 A;  1O6O A;  3QGC A;  3BSB A;  3UVU A;  1OYZ A;  4JW2 B;  3WPT A;  4P6Z G;  1QZ7 A;  1QGK A;  2C1T A;  4I1E A;  4B8O A;  2RU4 A;  4UQI A;  4YI0 C;  4WV6 A;  4RZP A;  3FEY C;  3VWA A;  5KLR B;  1PJN B;  2OF3 A;  3VLF A;  4U5S A;  2NYL B;  1I7W A;  3OBV A;  3EA5 B;  3VLE A;  3LTJ A;  3PSP A;  4H3K A;  3GS3 A;  5FC8 E;  4FFB C;  4I8M A;  3Q0N A;  2OT8 A;  4R11 A;  4CBA A;  3JXY A;  1PJM B;  5CL6 A;  3O2T A;  4HM9 A;  4O27 A;  3ZHP A;  4NZW A;  4IMJ A;  1LUJ A;  2GL7 A;  3Q0R A;  3ODS A;  5CLA A;  1F59 A;  3QML C;  3UL0 B;  3TJ3 A;  1UPK A;  3KND A;  3K7V A;  3AU3 A;  3L3F X;  1U6G C;  2JKR A;  3TPO A;  5CL4 A;  5K9S A;  3ZIR A;  3JX7 A;  5KLT B;  2Z5J A;  4R10 A;  1O6P A;  4V3R A;  4BA3 A;  4E4V A;  4MFU A;  3OPB A;  3ODR A;  5BYM A;  3RZX A;  5CLC A;  1M8W A;  5LSW A;  4IMI A;  4I3N A;  1B3U A;  4ADY A;  4OIH A;  1UN0 A;  3LWW A;  2DB0 A;  2W3C A;  3K5Z A;  3TPM A;  3GRL A;  5B56 A;  3GB8 A;  3W3U A;  3FGA A;  1V18 A;  5CL5 A;  1XM9 A;  2IAE A;  1T08 A;  4I6I A;  4I5N A;  4DJS A;  1W63 A;  4B8P A;  4P6Z B;  4BQK A;  1IB2 A;  2Z5O A;  4UWX A;  4G3A A;  1XQS A;  3FEX C;  5CL8 A;  3NOW A;  4XZR B;  4A3V A;  3Q0L A;  4MFV A;  3T7U A;  3UKW B;  2C1M A;  2PKG A;  1JDH A;  4EVT A;  5JJA A;  2NYM A;  1IQ1 C;  2Z5N A;  4YJE A;  4U54 A;  1W9C A;  5BZU A;  5HUY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...