1DR7A

Crystal structures of organomercurial-activated chicken liver dihydrofolate reductase complexes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
186
structure length
186
Chain Sequence
VRSLNSIVAVCQNMGIGKDGNLPWPPLRNEYKYFQRMTSTSHVEGKQNAVIMGKKTWFSIPEKNRPLKDRINIVLSRELKEAPKGAHYLSKSLDDALALLDSPELKSKVDMVWIVGGTAVYKAAMEKPINHRLFVTRILHEFESDTFFPEIDYKDFKLLTEYPGVPADIQEEDGIQYKFEVYQKSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Organomercurial-Activated Chicken Liver Dihydrofolate Reductase Complexes
rcsb
molecule keywords DIHYDROFOLATE REDUCTASE
molecule tags Oxidoreductase
source organism Gallus gallus
total genus 47
structure length 186
sequence length 186
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 1992-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 1dr7A00
4KJJA 4I1NA 2HXVA 4Q0DA 1BOZA 5U26A 4XT4A 4OSGA 4M2XA 3SRRX 4G95A 1DYRA 2W3AA 3N0HA 4KJLA 1VDRA 1JOLA 1RH3A 4ELHA 3DATA 3CD2A 4XT5A 4XT6A 3FL8A 1DG8A 4X5IA 3ROAA 1DR1A 3FQOA 4TU5X 3SRUX 4DPDA 5EAJA 1S3VA 3K47A 1DR3A 4LAHX 4QHVA 3KY8A 4HOEA 1RB2A 1OHJA 3JW5A 1VJ3A 1E26A 4EJ1A 1S3UA 3K45A 4KD7A 2G6VA 4ELEA 3NZ6X 3IA4A 4IXGX 3QLRA 3TQ9A 3NXXA 3SA1A 4KLXA 1DISA 3DAUA 4ECKA 2CIGA 3E0BA 4QLEA 4Q67A 2KGKA 2C2TA 3QL0A 5HF2X 1KLKA 4ELFA 1U70A 1DHFA 1DR4A 1HFPA 3JWFA 4LAGX 2AZNA 4IXED 3JW3A 1S3YA 3DGAA 1RF7A 5DXVA 4X5JA 5HPBA 4FHBA 3KFYA 3FREX 3JSUA 3F0BX 2ZZAA 2W9HA 3FY8X 3FRAX 3SRSX 2INQA 4M7UA 8DFRA 3QLYA 1RC4A 3F91A 3KJSA 4XRBA 3HBBA 4QJCA 3FL9A 3TQBA 3EX8A 3IRNA 3NXRA 4PDJA 3QLXA 3EELA 3QG2A 3M09A 1LY3A 1AI9A 1DRFA 3NRRA 3I8AX 1RX1A 3QGTA 3SRWX 5FDAA 3M08A 3R33A 3HJ3A 6DFRA 2W3WA 3DG8A 2W9SA 3S3VA 1J3JA 4KEBA 1PDBA 1TDRA 3IRMA 4XT7A 3NU0A 1KMVA 5HF0X 1RA1A 3EEMA 3F8YA 4QLFA 1RA9A 4NX6A 1DLSA 4KBNA 1HFRA 1J3KA 4LEKX 3DFRA 1DDSA 3NXVA 3GHVA 2BL9A 3SR5X 3D80A 4M6KA 2ITHA 4KFJA 1AOEA 3S9UA 1DF7A 4PSYA 1RG7A 4XT8A 1D1GA 3LG4A 3QL3A 3SH2A 4ELGA 3SAIA 1MVSA 3EEKA 3NZDA 2B3ZA 3F0UX 4DDRA 5JA3A 1S3WA 7DFRA 4X5FA 3D84X 5HSUA 3F0XX 1RA8A 1DYHA 3OAFA 4DPHA 3INVA 1M78A 1PD9A 3FY9X 3DRCA 3FQ0A 2BLAA 2ANQA 3DL5A 1IA3A 2GD9A 4P3RA 3DL6A 3FQVA 4QJZD 4QLGA 1U72A 1LY4A 4HOGA 5HVEA 4EIGA 3IX9A 4CD2A 3I3RA 2XW7A 4P68A 1RX4A 4H96A 3CSEA 1DIUA 3K2HA 4OR7A 3SQYX 3F0QX 1DG7A 3VCOA 3NZBX 2H2QA 3NTZA 2P4GA 4IXFX 5HUIA 2HM9A 4KM2A 3FRFX 1LUDA 3JWKA 3QLZA 3JTWA 4Q0EA 3SA2A 4X5HA 1DRBA 3FYWX 3TD8A 4P3QA 3FRBX 1DREA 3EEJA 3FQZA 5HI6A 1SEJA 2BLBA 1DYJA 1RX5A 3K74A 3GI2A 1RX3A 1QZFA 3RG9A 1HFQA 3UM8A 4KNEA 1M7AA 3JWCA 1RA3A 1M79A 2W9GA 4NX7A 5HT5A 3RO9A 2ANOA 4DP3A 4ELBA 3EIGA 1DR2A 1DHJA 1RB3A 2BLCA 4M6JA 3OCHA 4M6LA 1DR7A 4QI9A 1KMSA 4G8ZX 2FZJA 3QLWA 2FZIA 2OIPA 4X5GA 4I13A 2HQPA 3F0VX 5JG0X 1IA1A 3UM6A 1DAJA 3KJRA 2JYBA 3GYFA 3TQAA 5HVBA 3NXOA 4DFRA 1YHOA 4GH8A 2W9TA 5DFRA 2O7PA 1DG5A 1DR5A 4H95A 3QYLA 2QK8A 4PTHA 5HT4A 3IA5A 4HA9A 4PTJA 3F8ZA 1DYIA 1CD2A 1DDRA 1DRAA 4KM0A 3NZ9X 3S7AA 4KAKA 4P66A 4PSSA 4G3MA 4Q6AA 2LF1A 3NZAX 2D0KA 1RD7A 4KL9A 3GHCA 5ECCA 4RGCA 4EIZA 2L28A 1OHKA 4H98A 3FYVX 1U71A 3NXYA 3FRDX 3KGYA 4KY8A 4KYAA 4PSTA 1AO8A 3FS6A 3FQFA 3CLBA 2W3VA 4LAEX 3ZPCA 3FQCA 5CC9A 2DRCA 1J3IA 3QFXA 3QYOA 4FGHA 3Q1HA 2CD2A 3SRQX 1DRHA 3L3RA 1RA2A 1RX2A 4HOFA 1JOMA 3IROA 3JVXA 4H97A 2W3MA 2W3BA 4M7VA 1RX7A 3JWMA 3UM5A 5ECXA 5HQYA 2C2SA 1RX6A 5HQZA 4KY4A 4EILA 3SGYA 4XECX 4FGGA 3NXTA 4KJKA 2FZHA 2D5NA 5CCCA 1CZ3A 1MVTA 1IA2A 1RX8A 3QLSA 2DHFA 5E8QA 3ZPGA 1JUVA 5U27A 3NZCX 1IA4A 1RE7A 3TQ8A 1ZDRA 1BZFA 4XE6X 2OBCA 5HSRA 1DLRA 1DR6A 4HA7A 1RX9A 3CL9A 3GHWA 1DHIA 1PD8A 3F0SX
chains in the Genus database with same CATH superfamily
4KJJA 4I1NA 2HXVA 4Q0DA 1BOZA 5U26A 4XT4A 4OSGA 4M2XA 3SRRX 4G95A 1DYRA 2W3AA 3N0HA 4KJLA 1VDRA 1JOLA 1RH3A 4ELHA 3DATA 3CD2A 4XT5A 4XT6A 3FL8A 1DG8A 4X5IA 3ROAA 1DR1A 3FQOA 4TU5X 3SRUX 4DPDA 5EAJA 1S3VA 3K47A 1DR3A 4LAHX 4QHVA 3KY8A 4HOEA 1RB2A 1OHJA 3JW5A 1VJ3A 1E26A 4EJ1A 1S3UA 3K45A 4KD7A 2G6VA 4ELEA 3NZ6X 3IA4A 4IXGX 3QLRA 3TQ9A 3NXXA 3SA1A 4KLXA 1DISA 3DAUA 4ECKA 2CIGA 3E0BA 4QLEA 4Q67A 2KGKA 2C2TA 3QL0A 5HF2X 1KLKA 4ELFA 1U70A 1DHFA 1DR4A 1HFPA 3JWFA 4LAGX 2AZNA 4IXED 3JW3A 1S3YA 3DGAA 1RF7A 5DXVA 4X5JA 5HPBA 4FHBA 3KFYA 3FREX 3JSUA 3F0BX 2ZZAA 2W9HA 3FY8X 3FRAX 3SRSX 2INQA 4M7UA 8DFRA 3QLYA 1RC4A 3F91A 3KJSA 4XRBA 3HBBA 4QJCA 3FL9A 3TQBA 3EX8A 3IRNA 3NXRA 4PDJA 3QLXA 3EELA 3QG2A 3M09A 1LY3A 1AI9A 1DRFA 3NRRA 3I8AX 1RX1A 3QGTA 3SRWX 5FDAA 3M08A 3R33A 3HJ3A 6DFRA 2W3WA 3DG8A 2W9SA 3S3VA 1J3JA 4KEBA 1PDBA 1TDRA 3IRMA 4XT7A 3NU0A 1KMVA 5HF0X 1RA1A 3EEMA 3F8YA 4QLFA 1RA9A 4NX6A 1DLSA 4KBNA 1HFRA 1J3KA 4LEKX 3DFRA 1DDSA 3NXVA 3GHVA 2BL9A 3SR5X 3D80A 4M6KA 2ITHA 4KFJA 1AOEA 3S9UA 1DF7A 4PSYA 1RG7A 4XT8A 1D1GA 3LG4A 3QL3A 3SH2A 4ELGA 3SAIA 1MVSA 3EEKA 3NZDA 2B3ZA 3F0UX 4DDRA 5JA3A 1S3WA 7DFRA 4X5FA 3D84X 5HSUA 3F0XX 1RA8A 1DYHA 3OAFA 4DPHA 3INVA 1M78A 1PD9A 3FY9X 3DRCA 3FQ0A 2BLAA 2ANQA 3DL5A 1IA3A 2GD9A 4P3RA 3DL6A 3FQVA 4QJZD 4QLGA 1U72A 1LY4A 4HOGA 5HVEA 4EIGA 3IX9A 4CD2A 3I3RA 2XW7A 4P68A 1RX4A 4H96A 3CSEA 1DIUA 3K2HA 4OR7A 3SQYX 3F0QX 1DG7A 3VCOA 3NZBX 2H2QA 3NTZA 2P4GA 4IXFX 5HUIA 2HM9A 4KM2A 3FRFX 1LUDA 3JWKA 3QLZA 3JTWA 4Q0EA 3SA2A 4X5HA 1DRBA 3FYWX 3TD8A 4P3QA 3FRBX 1DREA 3EEJA 3FQZA 5HI6A 1SEJA 2BLBA 1DYJA 1RX5A 3K74A 3GI2A 1RX3A 1QZFA 3RG9A 1HFQA 3UM8A 4KNEA 1M7AA 3JWCA 1RA3A 1M79A 2W9GA 4NX7A 5HT5A 3RO9A 2ANOA 4DP3A 4ELBA 3EIGA 1DR2A 1DHJA 1RB3A 2BLCA 4M6JA 3OCHA 4M6LA 1DR7A 4QI9A 1KMSA 4G8ZX 2FZJA 3QLWA 2FZIA 2OIPA 4X5GA 4I13A 2HQPA 3F0VX 5JG0X 1IA1A 3UM6A 1DAJA 3KJRA 2JYBA 3GYFA 3TQAA 5HVBA 3NXOA 4DFRA 1YHOA 4GH8A 2W9TA 5DFRA 2O7PA 1DG5A 1DR5A 4H95A 3QYLA 2QK8A 4PTHA 5HT4A 3IA5A 4HA9A 4PTJA 3F8ZA 1DYIA 1CD2A 1DDRA 1DRAA 4KM0A 3NZ9X 3S7AA 4KAKA 4P66A 4PSSA 4G3MA 4Q6AA 2LF1A 3NZAX 2D0KA 1RD7A 4KL9A 3GHCA 5ECCA 4RGCA 4EIZA 2L28A 1OHKA 4H98A 3FYVX 1U71A 3NXYA 3FRDX 3KGYA 4KY8A 4KYAA 4PSTA 1AO8A 3FS6A 3FQFA 3CLBA 2W3VA 4LAEX 3ZPCA 3FQCA 5CC9A 2DRCA 1J3IA 3QFXA 3QYOA 4FGHA 3Q1HA 2CD2A 3SRQX 1DRHA 3L3RA 1RA2A 1RX2A 4HOFA 1JOMA 3IROA 3JVXA 4H97A 2W3MA 2W3BA 4M7VA 1RX7A 3JWMA 3UM5A 5ECXA 5HQYA 2C2SA 1RX6A 5HQZA 4KY4A 4EILA 3SGYA 4XECX 4FGGA 3NXTA 4KJKA 2FZHA 2D5NA 5CCCA 1CZ3A 1MVTA 1IA2A 1RX8A 3QLSA 2DHFA 5E8QA 3ZPGA 1JUVA 5U27A 3NZCX 1IA4A 1RE7A 3TQ8A 1ZDRA 1BZFA 4XE6X 2OBCA 5HSRA 1DLRA 1DR6A 4HA7A 1RX9A 3CL9A 3GHWA 1DHIA 1PD8A 3F0SX
chains in the Genus database with same CATH topology
4KJJA 4I1NA 2HXVA 4Q0DA 1BOZA 5U26A 4XT4A 4OSGA 4M2XA 3SRRX 4G95A 1DYRA 2W3AA 3N0HA 4KJLA 1VDRA 1JOLA 1RH3A 4ELHA 3DATA 3CD2A 4XT5A 4XT6A 3FL8A 1DG8A 4X5IA 3ROAA 1DR1A 3FQOA 4TU5X 3SRUX 4DPDA 5EAJA 1S3VA 3K47A 1DR3A 4LAHX 4QHVA 3KY8A 4HOEA 1RB2A 1OHJA 3JW5A 1VJ3A 1E26A 4EJ1A 1S3UA 3K45A 4KD7A 2G6VA 4ELEA 3NZ6X 3IA4A 4IXGX 3QLRA 3TQ9A 3NXXA 3SA1A 4KLXA 1DISA 3DAUA 4ECKA 2CIGA 3E0BA 4QLEA 4Q67A 2KGKA 2C2TA 3QL0A 5HF2X 1KLKA 4ELFA 1U70A 1DHFA 1DR4A 1HFPA 3JWFA 4LAGX 2AZNA 4IXED 3JW3A 1S3YA 3DGAA 1RF7A 5DXVA 4X5JA 5HPBA 4FHBA 3KFYA 3FREX 3JSUA 3F0BX 2ZZAA 2W9HA 3FY8X 3FRAX 3SRSX 2INQA 4M7UA 8DFRA 3QLYA 1RC4A 3F91A 3KJSA 4XRBA 3HBBA 4QJCA 3FL9A 3TQBA 3EX8A 3IRNA 3NXRA 4PDJA 3QLXA 3EELA 3QG2A 3M09A 1LY3A 1AI9A 1DRFA 3NRRA 3I8AX 1RX1A 3QGTA 3SRWX 5FDAA 3M08A 3R33A 3HJ3A 6DFRA 2W3WA 3DG8A 2W9SA 3S3VA 1J3JA 4KEBA 1PDBA 1TDRA 3IRMA 4XT7A 3NU0A 1KMVA 5HF0X 1RA1A 3EEMA 3F8YA 4QLFA 1RA9A 4NX6A 1DLSA 4KBNA 1HFRA 1J3KA 4LEKX 3DFRA 1DDSA 3NXVA 3GHVA 2BL9A 3SR5X 3D80A 4M6KA 2ITHA 4KFJA 1AOEA 3S9UA 1DF7A 4PSYA 1RG7A 4XT8A 1D1GA 3LG4A 3QL3A 3SH2A 4ELGA 3SAIA 1MVSA 3EEKA 3NZDA 2B3ZA 3F0UX 4DDRA 5JA3A 1S3WA 7DFRA 4X5FA 3D84X 5HSUA 3F0XX 1RA8A 1DYHA 3OAFA 4DPHA 3INVA 1M78A 1PD9A 3FY9X 3DRCA 3FQ0A 2BLAA 2ANQA 3DL5A 1IA3A 2GD9A 4P3RA 3DL6A 3FQVA 4QJZD 4QLGA 1U72A 1LY4A 4HOGA 5HVEA 4EIGA 3IX9A 4CD2A 3I3RA 2XW7A 4P68A 1RX4A 4H96A 3CSEA 1DIUA 3K2HA 4OR7A 3SQYX 3F0QX 1DG7A 3VCOA 3NZBX 2H2QA 3NTZA 2P4GA 4IXFX 5HUIA 2HM9A 4KM2A 3FRFX 1LUDA 3JWKA 3QLZA 3JTWA 4Q0EA 3SA2A 4X5HA 1DRBA 3FYWX 3TD8A 4P3QA 3FRBX 1DREA 3EEJA 3FQZA 5HI6A 1SEJA 2BLBA 1DYJA 1RX5A 3K74A 3GI2A 1RX3A 1QZFA 3RG9A 1HFQA 3UM8A 4KNEA 1M7AA 3JWCA 1RA3A 1M79A 2W9GA 4NX7A 5HT5A 3RO9A 2ANOA 4DP3A 4ELBA 3EIGA 1DR2A 1DHJA 1RB3A 2BLCA 4M6JA 3OCHA 4M6LA 1DR7A 4QI9A 1KMSA 4G8ZX 2FZJA 3QLWA 2FZIA 2OIPA 4X5GA 4I13A 2HQPA 3F0VX 5JG0X 1IA1A 3UM6A 1DAJA 3KJRA 2JYBA 3GYFA 3TQAA 5HVBA 3NXOA 4DFRA 1YHOA 4GH8A 2W9TA 5DFRA 2O7PA 1DG5A 1DR5A 4H95A 3QYLA 2QK8A 4PTHA 5HT4A 3IA5A 4HA9A 4PTJA 3F8ZA 1DYIA 1CD2A 1DDRA 1DRAA 4KM0A 3NZ9X 3S7AA 4KAKA 4P66A 4PSSA 4G3MA 4Q6AA 2LF1A 3NZAX 2D0KA 1RD7A 4KL9A 3GHCA 5ECCA 4RGCA 4EIZA 2L28A 1OHKA 4H98A 3FYVX 1U71A 3NXYA 3FRDX 3KGYA 4KY8A 4KYAA 4PSTA 1AO8A 3FS6A 3FQFA 3CLBA 2W3VA 4LAEX 3ZPCA 3FQCA 5CC9A 2DRCA 1J3IA 3QFXA 3QYOA 4FGHA 3Q1HA 2CD2A 3SRQX 1DRHA 3L3RA 1RA2A 1RX2A 4HOFA 1JOMA 3IROA 3JVXA 4H97A 2W3MA 2W3BA 4M7VA 1RX7A 3JWMA 3UM5A 5ECXA 5HQYA 2C2SA 1RX6A 5HQZA 4KY4A 4EILA 3SGYA 4XECX 4FGGA 3NXTA 4KJKA 2FZHA 2D5NA 5CCCA 1CZ3A 1MVTA 1IA2A 1RX8A 3QLSA 2DHFA 5E8QA 3ZPGA 1JUVA 5U27A 3NZCX 1IA4A 1RE7A 3TQ8A 1ZDRA 1BZFA 4XE6X 2OBCA 5HSRA 1DLRA 1DR6A 4HA7A 1RX9A 3CL9A 3GHWA 1DHIA 1PD8A 3F0SX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KJJ A;  4I1N A;  2HXV A;  4Q0D A;  1BOZ A;  5U26 A;  4XT4 A;  4OSG A;  4M2X A;  3SRR X;  4G95 A;  1DYR A;  2W3A A;  3N0H A;  4KJL A;  1VDR A;  1JOL A;  1RH3 A;  4ELH A;  3DAT A;  3CD2 A;  4XT5 A;  4XT6 A;  3FL8 A;  1DG8 A;  4X5I A;  3ROA A;  1DR1 A;  3FQO A;  4TU5 X;  3SRU X;  4DPD A;  5EAJ A;  1S3V A;  3K47 A;  1DR3 A;  4LAH X;  4QHV A;  3KY8 A;  4HOE A;  1RB2 A;  1OHJ A;  3JW5 A;  1VJ3 A;  1E26 A;  4EJ1 A;  1S3U A;  3K45 A;  4KD7 A;  2G6V A;  4ELE A;  3NZ6 X;  3IA4 A;  4IXG X;  3QLR A;  3TQ9 A;  3NXX A;  3SA1 A;  4KLX A;  1DIS A;  3DAU A;  4ECK A;  2CIG A;  3E0B A;  4QLE A;  4Q67 A;  2KGK A;  2C2T A;  3QL0 A;  5HF2 X;  1KLK A;  4ELF A;  1U70 A;  1DHF A;  1DR4 A;  1HFP A;  3JWF A;  4LAG X;  2AZN A;  4IXE D;  3JW3 A;  1S3Y A;  3DGA A;  1RF7 A;  5DXV A;  4X5J A;  5HPB A;  4FHB A;  3KFY A;  3FRE X;  3JSU A;  3F0B X;  2ZZA A;  2W9H A;  3FY8 X;  3FRA X;  3SRS X;  2INQ A;  4M7U A;  8DFR A;  3QLY A;  1RC4 A;  3F91 A;  3KJS A;  4XRB A;  3HBB A;  4QJC A;  3FL9 A;  3TQB A;  3EX8 A;  3IRN A;  3NXR A;  4PDJ A;  3QLX A;  3EEL A;  3QG2 A;  3M09 A;  1LY3 A;  1AI9 A;  1DRF A;  3NRR A;  3I8A X;  1RX1 A;  3QGT A;  3SRW X;  5FDA A;  3M08 A;  3R33 A;  3HJ3 A;  6DFR A;  2W3W A;  3DG8 A;  2W9S A;  3S3V A;  1J3J A;  4KEB A;  1PDB A;  1TDR A;  3IRM A;  4XT7 A;  3NU0 A;  1KMV A;  5HF0 X;  1RA1 A;  3EEM A;  3F8Y A;  4QLF A;  1RA9 A;  4NX6 A;  1DLS A;  4KBN A;  1HFR A;  1J3K A;  4LEK X;  3DFR A;  1DDS A;  3NXV A;  3GHV A;  2BL9 A;  3SR5 X;  3D80 A;  4M6K A;  2ITH A;  4KFJ A;  1AOE A;  3S9U A;  1DF7 A;  4PSY A;  1RG7 A;  4XT8 A;  1D1G A;  3LG4 A;  3QL3 A;  3SH2 A;  4ELG A;  3SAI A;  1MVS A;  3EEK A;  3NZD A;  2B3Z A;  3F0U X;  4DDR A;  5JA3 A;  1S3W A;  7DFR A;  4X5F A;  3D84 X;  5HSU A;  3F0X X;  1RA8 A;  1DYH A;  3OAF A;  4DPH A;  3INV A;  1M78 A;  1PD9 A;  3FY9 X;  3DRC A;  3FQ0 A;  2BLA A;  2ANQ A;  3DL5 A;  1IA3 A;  2GD9 A;  4P3R A;  3DL6 A;  3FQV A;  4QJZ D;  4QLG A;  1U72 A;  1LY4 A;  4HOG A;  5HVE A;  4EIG A;  3IX9 A;  4CD2 A;  3I3R A;  2XW7 A;  4P68 A;  1RX4 A;  4H96 A;  3CSE A;  1DIU A;  3K2H A;  4OR7 A;  3SQY X;  3F0Q X;  1DG7 A;  3VCO A;  3NZB X;  2H2Q A;  3NTZ A;  2P4G A;  4IXF X;  5HUI A;  2HM9 A;  4KM2 A;  3FRF X;  1LUD A;  3JWK A;  3QLZ A;  3JTW A;  4Q0E A;  3SA2 A;  4X5H A;  1DRB A;  3FYW X;  3TD8 A;  4P3Q A;  3FRB X;  1DRE A;  3EEJ A;  3FQZ A;  5HI6 A;  1SEJ A;  2BLB A;  1DYJ A;  1RX5 A;  3K74 A;  3GI2 A;  1RX3 A;  1QZF A;  3RG9 A;  1HFQ A;  3UM8 A;  4KNE A;  1M7A A;  3JWC A;  1RA3 A;  1M79 A;  2W9G A;  4NX7 A;  5HT5 A;  3RO9 A;  2ANO A;  4DP3 A;  4ELB A;  3EIG A;  1DR2 A;  1DHJ A;  1RB3 A;  2BLC A;  4M6J A;  3OCH A;  4M6L A;  1DR7 A;  4QI9 A;  1KMS A;  4G8Z X;  2FZJ A;  3QLW A;  2FZI A;  2OIP A;  4X5G A;  4I13 A;  2HQP A;  3F0V X;  5JG0 X;  1IA1 A;  3UM6 A;  1DAJ A;  3KJR A;  2JYB A;  3GYF A;  3TQA A;  5HVB A;  3NXO A;  4DFR A;  1YHO A;  4GH8 A;  2W9T A;  5DFR A;  2O7P A;  1DG5 A;  1DR5 A;  4H95 A;  3QYL A;  2QK8 A;  4PTH A;  5HT4 A;  3IA5 A;  4HA9 A;  4PTJ A;  3F8Z A;  1DYI A;  1CD2 A;  1DDR A;  1DRA A;  4KM0 A;  3NZ9 X;  3S7A A;  4KAK A;  4P66 A;  4PSS A;  4G3M A;  4Q6A A;  2LF1 A;  3NZA X;  2D0K A;  1RD7 A;  4KL9 A;  3GHC A;  5ECC A;  4RGC A;  4EIZ A;  2L28 A;  1OHK A;  4H98 A;  3FYV X;  1U71 A;  3NXY A;  3FRD X;  3KGY A;  4KY8 A;  4KYA A;  4PST A;  1AO8 A;  3FS6 A;  3FQF A;  3CLB A;  2W3V A;  4LAE X;  3ZPC A;  3FQC A;  5CC9 A;  2DRC A;  1J3I A;  3QFX A;  3QYO A;  4FGH A;  3Q1H A;  2CD2 A;  3SRQ X;  1DRH A;  3L3R A;  1RA2 A;  1RX2 A;  4HOF A;  1JOM A;  3IRO A;  3JVX A;  4H97 A;  2W3M A;  2W3B A;  4M7V A;  1RX7 A;  3JWM A;  3UM5 A;  5ECX A;  5HQY A;  2C2S A;  1RX6 A;  5HQZ A;  4KY4 A;  4EIL A;  3SGY A;  4XEC X;  4FGG A;  3NXT A;  4KJK A;  2FZH A;  2D5N A;  5CCC A;  1CZ3 A;  1MVT A;  1IA2 A;  1RX8 A;  3QLS A;  2DHF A;  5E8Q A;  3ZPG A;  1JUV A;  5U27 A;  3NZC X;  1IA4 A;  1RE7 A;  3TQ8 A;  1ZDR A;  1BZF A;  4XE6 X;  2OBC A;  5HSR A;  1DLR A;  1DR6 A;  4HA7 A;  1RX9 A;  3CL9 A;  3GHW A;  1DHI A;  1PD8 A;  3F0S X; 
#chains in the Genus database with same CATH topology
 4KJJ A;  4I1N A;  2HXV A;  4Q0D A;  1BOZ A;  5U26 A;  4XT4 A;  4OSG A;  4M2X A;  3SRR X;  4G95 A;  1DYR A;  2W3A A;  3N0H A;  4KJL A;  1VDR A;  1JOL A;  1RH3 A;  4ELH A;  3DAT A;  3CD2 A;  4XT5 A;  4XT6 A;  3FL8 A;  1DG8 A;  4X5I A;  3ROA A;  1DR1 A;  3FQO A;  4TU5 X;  3SRU X;  4DPD A;  5EAJ A;  1S3V A;  3K47 A;  1DR3 A;  4LAH X;  4QHV A;  3KY8 A;  4HOE A;  1RB2 A;  1OHJ A;  3JW5 A;  1VJ3 A;  1E26 A;  4EJ1 A;  1S3U A;  3K45 A;  4KD7 A;  2G6V A;  4ELE A;  3NZ6 X;  3IA4 A;  4IXG X;  3QLR A;  3TQ9 A;  3NXX A;  3SA1 A;  4KLX A;  1DIS A;  3DAU A;  4ECK A;  2CIG A;  3E0B A;  4QLE A;  4Q67 A;  2KGK A;  2C2T A;  3QL0 A;  5HF2 X;  1KLK A;  4ELF A;  1U70 A;  1DHF A;  1DR4 A;  1HFP A;  3JWF A;  4LAG X;  2AZN A;  4IXE D;  3JW3 A;  1S3Y A;  3DGA A;  1RF7 A;  5DXV A;  4X5J A;  5HPB A;  4FHB A;  3KFY A;  3FRE X;  3JSU A;  3F0B X;  2ZZA A;  2W9H A;  3FY8 X;  3FRA X;  3SRS X;  2INQ A;  4M7U A;  8DFR A;  3QLY A;  1RC4 A;  3F91 A;  3KJS A;  4XRB A;  3HBB A;  4QJC A;  3FL9 A;  3TQB A;  3EX8 A;  3IRN A;  3NXR A;  4PDJ A;  3QLX A;  3EEL A;  3QG2 A;  3M09 A;  1LY3 A;  1AI9 A;  1DRF A;  3NRR A;  3I8A X;  1RX1 A;  3QGT A;  3SRW X;  5FDA A;  3M08 A;  3R33 A;  3HJ3 A;  6DFR A;  2W3W A;  3DG8 A;  2W9S A;  3S3V A;  1J3J A;  4KEB A;  1PDB A;  1TDR A;  3IRM A;  4XT7 A;  3NU0 A;  1KMV A;  5HF0 X;  1RA1 A;  3EEM A;  3F8Y A;  4QLF A;  1RA9 A;  4NX6 A;  1DLS A;  4KBN A;  1HFR A;  1J3K A;  4LEK X;  3DFR A;  1DDS A;  3NXV A;  3GHV A;  2BL9 A;  3SR5 X;  3D80 A;  4M6K A;  2ITH A;  4KFJ A;  1AOE A;  3S9U A;  1DF7 A;  4PSY A;  1RG7 A;  4XT8 A;  1D1G A;  3LG4 A;  3QL3 A;  3SH2 A;  4ELG A;  3SAI A;  1MVS A;  3EEK A;  3NZD A;  2B3Z A;  3F0U X;  4DDR A;  5JA3 A;  1S3W A;  7DFR A;  4X5F A;  3D84 X;  5HSU A;  3F0X X;  1RA8 A;  1DYH A;  3OAF A;  4DPH A;  3INV A;  1M78 A;  1PD9 A;  3FY9 X;  3DRC A;  3FQ0 A;  2BLA A;  2ANQ A;  3DL5 A;  1IA3 A;  2GD9 A;  4P3R A;  3DL6 A;  3FQV A;  4QJZ D;  4QLG A;  1U72 A;  1LY4 A;  4HOG A;  5HVE A;  4EIG A;  3IX9 A;  4CD2 A;  3I3R A;  2XW7 A;  4P68 A;  1RX4 A;  4H96 A;  3CSE A;  1DIU A;  3K2H A;  4OR7 A;  3SQY X;  3F0Q X;  1DG7 A;  3VCO A;  3NZB X;  2H2Q A;  3NTZ A;  2P4G A;  4IXF X;  5HUI A;  2HM9 A;  4KM2 A;  3FRF X;  1LUD A;  3JWK A;  3QLZ A;  3JTW A;  4Q0E A;  3SA2 A;  4X5H A;  1DRB A;  3FYW X;  3TD8 A;  4P3Q A;  3FRB X;  1DRE A;  3EEJ A;  3FQZ A;  5HI6 A;  1SEJ A;  2BLB A;  1DYJ A;  1RX5 A;  3K74 A;  3GI2 A;  1RX3 A;  1QZF A;  3RG9 A;  1HFQ A;  3UM8 A;  4KNE A;  1M7A A;  3JWC A;  1RA3 A;  1M79 A;  2W9G A;  4NX7 A;  5HT5 A;  3RO9 A;  2ANO A;  4DP3 A;  4ELB A;  3EIG A;  1DR2 A;  1DHJ A;  1RB3 A;  2BLC A;  4M6J A;  3OCH A;  4M6L A;  1DR7 A;  4QI9 A;  1KMS A;  4G8Z X;  2FZJ A;  3QLW A;  2FZI A;  2OIP A;  4X5G A;  4I13 A;  2HQP A;  3F0V X;  5JG0 X;  1IA1 A;  3UM6 A;  1DAJ A;  3KJR A;  2JYB A;  3GYF A;  3TQA A;  5HVB A;  3NXO A;  4DFR A;  1YHO A;  4GH8 A;  2W9T A;  5DFR A;  2O7P A;  1DG5 A;  1DR5 A;  4H95 A;  3QYL A;  2QK8 A;  4PTH A;  5HT4 A;  3IA5 A;  4HA9 A;  4PTJ A;  3F8Z A;  1DYI A;  1CD2 A;  1DDR A;  1DRA A;  4KM0 A;  3NZ9 X;  3S7A A;  4KAK A;  4P66 A;  4PSS A;  4G3M A;  4Q6A A;  2LF1 A;  3NZA X;  2D0K A;  1RD7 A;  4KL9 A;  3GHC A;  5ECC A;  4RGC A;  4EIZ A;  2L28 A;  1OHK A;  4H98 A;  3FYV X;  1U71 A;  3NXY A;  3FRD X;  3KGY A;  4KY8 A;  4KYA A;  4PST A;  1AO8 A;  3FS6 A;  3FQF A;  3CLB A;  2W3V A;  4LAE X;  3ZPC A;  3FQC A;  5CC9 A;  2DRC A;  1J3I A;  3QFX A;  3QYO A;  4FGH A;  3Q1H A;  2CD2 A;  3SRQ X;  1DRH A;  3L3R A;  1RA2 A;  1RX2 A;  4HOF A;  1JOM A;  3IRO A;  3JVX A;  4H97 A;  2W3M A;  2W3B A;  4M7V A;  1RX7 A;  3JWM A;  3UM5 A;  5ECX A;  5HQY A;  2C2S A;  1RX6 A;  5HQZ A;  4KY4 A;  4EIL A;  3SGY A;  4XEC X;  4FGG A;  3NXT A;  4KJK A;  2FZH A;  2D5N A;  5CCC A;  1CZ3 A;  1MVT A;  1IA2 A;  1RX8 A;  3QLS A;  2DHF A;  5E8Q A;  3ZPG A;  1JUV A;  5U27 A;  3NZC X;  1IA4 A;  1RE7 A;  3TQ8 A;  1ZDR A;  1BZF A;  4XE6 X;  2OBC A;  5HSR A;  1DLR A;  1DR6 A;  4HA7 A;  1RX9 A;  3CL9 A;  3GHW A;  1DHI A;  1PD8 A;  3F0S X; 
#chains in the Genus database with same CATH homology
 4KJJ A;  4I1N A;  2HXV A;  4Q0D A;  1BOZ A;  5U26 A;  4XT4 A;  4OSG A;  4M2X A;  3SRR X;  4G95 A;  1DYR A;  2W3A A;  3N0H A;  4KJL A;  1VDR A;  1JOL A;  1RH3 A;  4ELH A;  3DAT A;  3CD2 A;  4XT5 A;  4XT6 A;  3FL8 A;  1DG8 A;  4X5I A;  3ROA A;  1DR1 A;  3FQO A;  4TU5 X;  3SRU X;  4DPD A;  5EAJ A;  1S3V A;  3K47 A;  1DR3 A;  4LAH X;  4QHV A;  3KY8 A;  4HOE A;  1RB2 A;  1OHJ A;  3JW5 A;  1VJ3 A;  1E26 A;  4EJ1 A;  1S3U A;  3K45 A;  4KD7 A;  2G6V A;  4ELE A;  3NZ6 X;  3IA4 A;  4IXG X;  3QLR A;  3TQ9 A;  3NXX A;  3SA1 A;  4KLX A;  1DIS A;  3DAU A;  4ECK A;  2CIG A;  3E0B A;  4QLE A;  4Q67 A;  2KGK A;  2C2T A;  3QL0 A;  5HF2 X;  1KLK A;  4ELF A;  1U70 A;  1DHF A;  1DR4 A;  1HFP A;  3JWF A;  4LAG X;  2AZN A;  4IXE D;  3JW3 A;  1S3Y A;  3DGA A;  1RF7 A;  5DXV A;  4X5J A;  5HPB A;  4FHB A;  3KFY A;  3FRE X;  3JSU A;  3F0B X;  2ZZA A;  2W9H A;  3FY8 X;  3FRA X;  3SRS X;  2INQ A;  4M7U A;  8DFR A;  3QLY A;  1RC4 A;  3F91 A;  3KJS A;  4XRB A;  3HBB A;  4QJC A;  3FL9 A;  3TQB A;  3EX8 A;  3IRN A;  3NXR A;  4PDJ A;  3QLX A;  3EEL A;  3QG2 A;  3M09 A;  1LY3 A;  1AI9 A;  1DRF A;  3NRR A;  3I8A X;  1RX1 A;  3QGT A;  3SRW X;  5FDA A;  3M08 A;  3R33 A;  3HJ3 A;  6DFR A;  2W3W A;  3DG8 A;  2W9S A;  3S3V A;  1J3J A;  4KEB A;  1PDB A;  1TDR A;  3IRM A;  4XT7 A;  3NU0 A;  1KMV A;  5HF0 X;  1RA1 A;  3EEM A;  3F8Y A;  4QLF A;  1RA9 A;  4NX6 A;  1DLS A;  4KBN A;  1HFR A;  1J3K A;  4LEK X;  3DFR A;  1DDS A;  3NXV A;  3GHV A;  2BL9 A;  3SR5 X;  3D80 A;  4M6K A;  2ITH A;  4KFJ A;  1AOE A;  3S9U A;  1DF7 A;  4PSY A;  1RG7 A;  4XT8 A;  1D1G A;  3LG4 A;  3QL3 A;  3SH2 A;  4ELG A;  3SAI A;  1MVS A;  3EEK A;  3NZD A;  2B3Z A;  3F0U X;  4DDR A;  5JA3 A;  1S3W A;  7DFR A;  4X5F A;  3D84 X;  5HSU A;  3F0X X;  1RA8 A;  1DYH A;  3OAF A;  4DPH A;  3INV A;  1M78 A;  1PD9 A;  3FY9 X;  3DRC A;  3FQ0 A;  2BLA A;  2ANQ A;  3DL5 A;  1IA3 A;  2GD9 A;  4P3R A;  3DL6 A;  3FQV A;  4QJZ D;  4QLG A;  1U72 A;  1LY4 A;  4HOG A;  5HVE A;  4EIG A;  3IX9 A;  4CD2 A;  3I3R A;  2XW7 A;  4P68 A;  1RX4 A;  4H96 A;  3CSE A;  1DIU A;  3K2H A;  4OR7 A;  3SQY X;  3F0Q X;  1DG7 A;  3VCO A;  3NZB X;  2H2Q A;  3NTZ A;  2P4G A;  4IXF X;  5HUI A;  2HM9 A;  4KM2 A;  3FRF X;  1LUD A;  3JWK A;  3QLZ A;  3JTW A;  4Q0E A;  3SA2 A;  4X5H A;  1DRB A;  3FYW X;  3TD8 A;  4P3Q A;  3FRB X;  1DRE A;  3EEJ A;  3FQZ A;  5HI6 A;  1SEJ A;  2BLB A;  1DYJ A;  1RX5 A;  3K74 A;  3GI2 A;  1RX3 A;  1QZF A;  3RG9 A;  1HFQ A;  3UM8 A;  4KNE A;  1M7A A;  3JWC A;  1RA3 A;  1M79 A;  2W9G A;  4NX7 A;  5HT5 A;  3RO9 A;  2ANO A;  4DP3 A;  4ELB A;  3EIG A;  1DR2 A;  1DHJ A;  1RB3 A;  2BLC A;  4M6J A;  3OCH A;  4M6L A;  1DR7 A;  4QI9 A;  1KMS A;  4G8Z X;  2FZJ A;  3QLW A;  2FZI A;  2OIP A;  4X5G A;  4I13 A;  2HQP A;  3F0V X;  5JG0 X;  1IA1 A;  3UM6 A;  1DAJ A;  3KJR A;  2JYB A;  3GYF A;  3TQA A;  5HVB A;  3NXO A;  4DFR A;  1YHO A;  4GH8 A;  2W9T A;  5DFR A;  2O7P A;  1DG5 A;  1DR5 A;  4H95 A;  3QYL A;  2QK8 A;  4PTH A;  5HT4 A;  3IA5 A;  4HA9 A;  4PTJ A;  3F8Z A;  1DYI A;  1CD2 A;  1DDR A;  1DRA A;  4KM0 A;  3NZ9 X;  3S7A A;  4KAK A;  4P66 A;  4PSS A;  4G3M A;  4Q6A A;  2LF1 A;  3NZA X;  2D0K A;  1RD7 A;  4KL9 A;  3GHC A;  5ECC A;  4RGC A;  4EIZ A;  2L28 A;  1OHK A;  4H98 A;  3FYV X;  1U71 A;  3NXY A;  3FRD X;  3KGY A;  4KY8 A;  4KYA A;  4PST A;  1AO8 A;  3FS6 A;  3FQF A;  3CLB A;  2W3V A;  4LAE X;  3ZPC A;  3FQC A;  5CC9 A;  2DRC A;  1J3I A;  3QFX A;  3QYO A;  4FGH A;  3Q1H A;  2CD2 A;  3SRQ X;  1DRH A;  3L3R A;  1RA2 A;  1RX2 A;  4HOF A;  1JOM A;  3IRO A;  3JVX A;  4H97 A;  2W3M A;  2W3B A;  4M7V A;  1RX7 A;  3JWM A;  3UM5 A;  5ECX A;  5HQY A;  2C2S A;  1RX6 A;  5HQZ A;  4KY4 A;  4EIL A;  3SGY A;  4XEC X;  4FGG A;  3NXT A;  4KJK A;  2FZH A;  2D5N A;  5CCC A;  1CZ3 A;  1MVT A;  1IA2 A;  1RX8 A;  3QLS A;  2DHF A;  5E8Q A;  3ZPG A;  1JUV A;  5U27 A;  3NZC X;  1IA4 A;  1RE7 A;  3TQ8 A;  1ZDR A;  1BZF A;  4XE6 X;  2OBC A;  5HSR A;  1DLR A;  1DR6 A;  4HA7 A;  1RX9 A;  3CL9 A;  3GHW A;  1DHI A;  1PD8 A;  3F0S X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...