2P4GA

Crystal structure of a pyrimidine reductase-like protein (dip1392) from corynebacterium diphtheriae nctc at 2.30 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
248
structure length
248
Chain Sequence
VTTEQIVYGALPLTTINEPECRAIAITSINGSATLSGVSGPMGDQTDADLLIQLRGWADAIVVGAETARKENYGPVVLPHGIKNQRQKLGRCGLPKLTLLSKSLYFDFSSELFSPDLPSELSPLVITQQPANNSEQWDQRLQKLIDVGVEVIVAPTSTNPLKIAFDALHARRLKKISIEGGPSVYRQALSLGIVDRLHLTIAPNIICPVESPLFGKISDDSFTTRLVLEMLSSSPNGLIFSRYKVIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (NP_939744.1) from Corynebacterium diphtheriae at 2.30 A resolution
rcsb
molecule keywords Hypothetical protein
molecule tags Oxidoreductase
source organism Corynebacterium diphtheriae
total genus 80
structure length 248
sequence length 248
ec nomenclature
pdb deposition date 2007-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01872 RibD_C RibD C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 2p4gA00
2D5NA 4XT6A 1DDSA 5U26A 2W3VA 3IX9A 3DATA 2BL9A 3QYOA 3GHWA 3D84X 3NXOA 1DREA 3DL5A 5DFRA 4X5IA 3FQOA 3TD8A 2OBCA 2FZJA 4XT4A 4M6JA 3R33A 5HQYA 3KJRA 1RX5A 5HT4A 4P66A 3FQZA 3EELA 5EAJA 1RA3A 4FGHA 1DHJA 3TQAA 1DG7A 1KMVA 3RO9A 4PSSA 1CZ3A 2HQPA 4LAHX 3F0VX 3NTZA 3DGAA 4QJZD 3TQ9A 1DAJA 3F0UX 4PSYA 1RX9A 3S3VA 3IROA 4X5GA 2KGKA 3FRDX 4M6KA 1DR5A 3EEMA 1DYIA 4P3QA 4EJ1A 2ZZAA 4DPDA 1DDRA 3NXTA 3VCOA 5HQZA 3IA4A 2W9TA 4KM2A 4GH8A 3F8ZA 3NXRA 3JWKA 4ELEA 5E8QA 4EILA 3SRWX 3K47A 3DRCA 3JWCA 4XT8A 4EIGA 1RX3A 3SRRX 3FY8X 1RG7A 3ZPCA 1RX7A 3QGTA 3INVA 4DFRA 2LF1A 1M7AA 2W9GA 4KL9A 5HUIA 4QI9A 3NZ9X 1S3YA 5U27A 4H97A 4ELHA 2W9HA 4H98A 1DHIA 3OAFA 4G95A 1RB2A 4HOEA 3EEKA 4ELBA 3GHCA 3FRAX 1DF7A 1SEJA 4Q0EA 4NX7A 3FS6A 3IRNA 4KD7A 4KJJA 3M08A 5HVBA 4QLFA 1DIUA 2D0KA 3NRRA 5HF0X 4QHVA 1RA8A 5JG0X 3JW5A 3KGYA 2C2TA 2INQA 3IA5A 4ECKA 3FREX 4XT5A 1KLKA 5ECCA 7DFRA 3EX8A 4HOFA 4P3RA 1VJ3A 2BLAA 1LUDA 3KFYA 3SRUX 3IRMA 1DRBA 4KY4A 3NXYA 1DRFA 4M7UA 4PTHA 1U71A 1RX1A 2W3BA 1RC4A 4KEBA 1AO8A 3LG4A 1U70A 3OCHA 3CL9A 1OHKA 4KNEA 3F91A 1M78A 2B3ZA 4XE6X 1PDBA 1D1GA 3QLRA 3NZCX 3F8YA 4X5FA 1DYJA 1IA1A 3DL6A 1S3WA 1RX4A 3F0QX 2CIGA 8DFRA 1CD2A 4X5JA 2OIPA 3TQ8A 4H96A 3NZAX 4PDJA 1DHFA 1RE7A 4OSGA 3SRSX 5HSRA 1J3IA 1DRHA 3DG8A 3NZDA 2DRCA 3FQFA 3SRQX 3QLSA 1DR4A 4P68A 1HFRA 3FYVX 3FL9A 3NXXA 1DISA 1M79A 3TQBA 3RG9A 1J3KA 3GHVA 3SA1A 1RX8A 4OR7A 1U72A 1TDRA 2G6VA 4IXFX 1ZDRA 4QLEA 1RX6A 2FZHA 3GYFA 4M6LA 2HXVA 5FDAA 2W9SA 5HSUA 5HF2X 1JOLA 1QZFA 3CD2A 5CC9A 4LAEX 1KMSA 1DR3A 3KY8A 1YHOA 5CCCA 4HA9A 4KFJA 3K2HA 1S3UA 1RA1A 5HI6A 5JA3A 3QYLA 3F0XX 1IA2A 2P4GA 3UM5A 4QJCA 1MVTA 3FQCA 4KJKA 3FQ0A 4Q0DA 5DXVA 3FQVA 1RA2A 3JW3A 5ECXA 1E26A 3ROAA 3EEJA 3JVXA 3NZBX 2AZNA 4DPHA 3FY9X 3D80A 4H95A 3QFXA 2W3MA 1AI9A 4RGCA 1RX2A 2H2QA 1PD9A 4FHBA 3E0BA 3I3RA 4TU5X 2GD9A 3I8AX 3JSUA 1JUVA 3QG2A 1S3VA 2W3AA 3FL8A 1VDRA 3KJSA 3F0SX 1DR2A 3JWFA 4KLXA 3SQYX 4XT7A 1DLRA 3L3RA 3N0HA 4G3MA 3K74A 3QLZA 2C2SA 3SA2A 4HA7A 4KM0A 4FGGA 1DG8A 4XECX 2CD2A 1BOZA 1LY3A 4X5HA 1DLSA 4PTJA 4KBNA 3JWMA 4NX6A 4QLGA 4DP3A 3SH2A 1RF7A 3S9UA 4M2XA 3HBBA 3K45A 4PSTA 4ELGA 1HFPA 3F0BX 1DYRA 3Q1HA 1IA4A 5HPBA 1DR6A 1RA9A 2JYBA 4KY8A 3DAUA 3QL0A 3QL3A 1RD7A 3SAIA 2ITHA 3NZ6X 4M7VA 3DFRA 2DHFA 2XW7A 1IA3A 4XRBA 3S7AA 2HM9A 3ZPGA 2L28A 2ANQA 3QLYA 2QK8A 3CSEA 3FRBX 4I1NA 4IXED 1AOEA 3CLBA 3UM6A 4LEKX 3M09A 2BLCA 4KYAA 2BLBA 4EIZA 1J3JA 3FRFX 1LY4A 2FZIA 4CD2A 1DYHA 1RH3A 4LAGX 1DG5A 1DR7A 3FYWX 1HFQA 3NXVA 1BZFA 3GI2A 3SGYA 3HJ3A 3NU0A 3SR5X 3EIGA 3JTWA 4DDRA 4HOGA 6DFRA 3UM8A 2W3WA 2ANOA 1DR1A 4I13A 1RB3A 3QLXA 4KJLA 1MVSA 1PD8A 4ELFA 4G8ZX 5HT5A 2O7PA 4KAKA 3QLWA 4IXGX 4Q6AA 4Q67A 1DRAA 1JOMA 5HVEA 1OHJA
chains in the Genus database with same CATH superfamily
2D5NA 4XT6A 1DDSA 5U26A 2W3VA 3IX9A 3DATA 2BL9A 3QYOA 3GHWA 3D84X 3NXOA 1DREA 3DL5A 5DFRA 4X5IA 3FQOA 3TD8A 2OBCA 2FZJA 4XT4A 4M6JA 3R33A 5HQYA 3KJRA 1RX5A 5HT4A 4P66A 3FQZA 3EELA 5EAJA 1RA3A 4FGHA 1DHJA 3TQAA 1DG7A 1KMVA 3RO9A 4PSSA 1CZ3A 2HQPA 4LAHX 3F0VX 3NTZA 3DGAA 4QJZD 3TQ9A 1DAJA 3F0UX 4PSYA 1RX9A 3S3VA 3IROA 4X5GA 2KGKA 3FRDX 4M6KA 1DR5A 3EEMA 1DYIA 4P3QA 4EJ1A 2ZZAA 4DPDA 1DDRA 3NXTA 3VCOA 5HQZA 3IA4A 2W9TA 4KM2A 4GH8A 3F8ZA 3NXRA 3JWKA 4ELEA 5E8QA 4EILA 3SRWX 3K47A 3DRCA 3JWCA 4XT8A 4EIGA 1RX3A 3SRRX 3FY8X 1RG7A 3ZPCA 1RX7A 3QGTA 3INVA 4DFRA 2LF1A 1M7AA 2W9GA 4KL9A 5HUIA 4QI9A 3NZ9X 1S3YA 5U27A 4H97A 4ELHA 2W9HA 4H98A 1DHIA 3OAFA 4G95A 1RB2A 4HOEA 3EEKA 4ELBA 3GHCA 3FRAX 1DF7A 1SEJA 4Q0EA 4NX7A 3FS6A 3IRNA 4KD7A 4KJJA 3M08A 5HVBA 4QLFA 1DIUA 2D0KA 3NRRA 5HF0X 4QHVA 1RA8A 5JG0X 3JW5A 3KGYA 2C2TA 2INQA 3IA5A 4ECKA 3FREX 4XT5A 1KLKA 5ECCA 7DFRA 3EX8A 4HOFA 4P3RA 1VJ3A 2BLAA 1LUDA 3KFYA 3SRUX 3IRMA 1DRBA 4KY4A 3NXYA 1DRFA 4M7UA 4PTHA 1U71A 1RX1A 2W3BA 1RC4A 4KEBA 1AO8A 3LG4A 1U70A 3OCHA 3CL9A 1OHKA 4KNEA 3F91A 1M78A 2B3ZA 4XE6X 1PDBA 1D1GA 3QLRA 3NZCX 3F8YA 4X5FA 1DYJA 1IA1A 3DL6A 1S3WA 1RX4A 3F0QX 2CIGA 8DFRA 1CD2A 4X5JA 2OIPA 3TQ8A 4H96A 3NZAX 4PDJA 1DHFA 1RE7A 4OSGA 3SRSX 5HSRA 1J3IA 1DRHA 3DG8A 3NZDA 2DRCA 3FQFA 3SRQX 3QLSA 1DR4A 4P68A 1HFRA 3FYVX 3FL9A 3NXXA 1DISA 1M79A 3TQBA 3RG9A 1J3KA 3GHVA 3SA1A 1RX8A 4OR7A 1U72A 1TDRA 2G6VA 4IXFX 1ZDRA 4QLEA 1RX6A 2FZHA 3GYFA 4M6LA 2HXVA 5FDAA 2W9SA 5HSUA 5HF2X 1JOLA 1QZFA 3CD2A 5CC9A 4LAEX 1KMSA 1DR3A 3KY8A 1YHOA 5CCCA 4HA9A 4KFJA 3K2HA 1S3UA 1RA1A 5HI6A 5JA3A 3QYLA 3F0XX 1IA2A 2P4GA 3UM5A 4QJCA 1MVTA 3FQCA 4KJKA 3FQ0A 4Q0DA 5DXVA 3FQVA 1RA2A 3JW3A 5ECXA 1E26A 3ROAA 3EEJA 3JVXA 3NZBX 2AZNA 4DPHA 3FY9X 3D80A 4H95A 3QFXA 2W3MA 1AI9A 4RGCA 1RX2A 2H2QA 1PD9A 4FHBA 3E0BA 3I3RA 4TU5X 2GD9A 3I8AX 3JSUA 1JUVA 3QG2A 1S3VA 2W3AA 3FL8A 1VDRA 3KJSA 3F0SX 1DR2A 3JWFA 4KLXA 3SQYX 4XT7A 1DLRA 3L3RA 3N0HA 4G3MA 3K74A 3QLZA 2C2SA 3SA2A 4HA7A 4KM0A 4FGGA 1DG8A 4XECX 2CD2A 1BOZA 1LY3A 4X5HA 1DLSA 4PTJA 4KBNA 3JWMA 4NX6A 4QLGA 4DP3A 3SH2A 1RF7A 3S9UA 4M2XA 3HBBA 3K45A 4PSTA 4ELGA 1HFPA 3F0BX 1DYRA 3Q1HA 1IA4A 5HPBA 1DR6A 1RA9A 2JYBA 4KY8A 3DAUA 3QL0A 3QL3A 1RD7A 3SAIA 2ITHA 3NZ6X 4M7VA 3DFRA 2DHFA 2XW7A 1IA3A 4XRBA 3S7AA 2HM9A 3ZPGA 2L28A 2ANQA 3QLYA 2QK8A 3CSEA 3FRBX 4I1NA 4IXED 1AOEA 3CLBA 3UM6A 4LEKX 3M09A 2BLCA 4KYAA 2BLBA 4EIZA 1J3JA 3FRFX 1LY4A 2FZIA 4CD2A 1DYHA 1RH3A 4LAGX 1DG5A 1DR7A 3FYWX 1HFQA 3NXVA 1BZFA 3GI2A 3SGYA 3HJ3A 3NU0A 3SR5X 3EIGA 3JTWA 4DDRA 4HOGA 6DFRA 3UM8A 2W3WA 2ANOA 1DR1A 4I13A 1RB3A 3QLXA 4KJLA 1MVSA 1PD8A 4ELFA 4G8ZX 5HT5A 2O7PA 4KAKA 3QLWA 4IXGX 4Q6AA 4Q67A 1DRAA 1JOMA 5HVEA 1OHJA
chains in the Genus database with same CATH topology
2D5NA 4XT6A 1DDSA 5U26A 2W3VA 3IX9A 3DATA 2BL9A 3QYOA 3GHWA 3D84X 3NXOA 1DREA 3DL5A 5DFRA 4X5IA 3FQOA 3TD8A 2OBCA 2FZJA 4XT4A 4M6JA 3R33A 5HQYA 3KJRA 1RX5A 5HT4A 4P66A 3FQZA 3EELA 5EAJA 1RA3A 4FGHA 1DHJA 3TQAA 1DG7A 1KMVA 3RO9A 4PSSA 1CZ3A 2HQPA 4LAHX 3F0VX 3NTZA 3DGAA 4QJZD 3TQ9A 1DAJA 3F0UX 4PSYA 1RX9A 3S3VA 3IROA 4X5GA 2KGKA 3FRDX 4M6KA 1DR5A 3EEMA 1DYIA 4P3QA 4EJ1A 2ZZAA 4DPDA 1DDRA 3NXTA 3VCOA 5HQZA 3IA4A 2W9TA 4KM2A 4GH8A 3F8ZA 3NXRA 3JWKA 4ELEA 5E8QA 4EILA 3SRWX 3K47A 3DRCA 3JWCA 4XT8A 4EIGA 1RX3A 3SRRX 3FY8X 1RG7A 3ZPCA 1RX7A 3QGTA 3INVA 4DFRA 2LF1A 1M7AA 2W9GA 4KL9A 5HUIA 4QI9A 3NZ9X 1S3YA 5U27A 4H97A 4ELHA 2W9HA 4H98A 1DHIA 3OAFA 4G95A 1RB2A 4HOEA 3EEKA 4ELBA 3GHCA 3FRAX 1DF7A 1SEJA 4Q0EA 4NX7A 3FS6A 3IRNA 4KD7A 4KJJA 3M08A 5HVBA 4QLFA 1DIUA 2D0KA 3NRRA 5HF0X 4QHVA 1RA8A 5JG0X 3JW5A 3KGYA 2C2TA 2INQA 3IA5A 4ECKA 3FREX 4XT5A 1KLKA 5ECCA 7DFRA 3EX8A 4HOFA 4P3RA 1VJ3A 2BLAA 1LUDA 3KFYA 3SRUX 3IRMA 1DRBA 4KY4A 3NXYA 1DRFA 4M7UA 4PTHA 1U71A 1RX1A 2W3BA 1RC4A 4KEBA 1AO8A 3LG4A 1U70A 3OCHA 3CL9A 1OHKA 4KNEA 3F91A 1M78A 2B3ZA 4XE6X 1PDBA 1D1GA 3QLRA 3NZCX 3F8YA 4X5FA 1DYJA 1IA1A 3DL6A 1S3WA 1RX4A 3F0QX 2CIGA 8DFRA 1CD2A 4X5JA 2OIPA 3TQ8A 4H96A 3NZAX 4PDJA 1DHFA 1RE7A 4OSGA 3SRSX 5HSRA 1J3IA 1DRHA 3DG8A 3NZDA 2DRCA 3FQFA 3SRQX 3QLSA 1DR4A 4P68A 1HFRA 3FYVX 3FL9A 3NXXA 1DISA 1M79A 3TQBA 3RG9A 1J3KA 3GHVA 3SA1A 1RX8A 4OR7A 1U72A 1TDRA 2G6VA 4IXFX 1ZDRA 4QLEA 1RX6A 2FZHA 3GYFA 4M6LA 2HXVA 5FDAA 2W9SA 5HSUA 5HF2X 1JOLA 1QZFA 3CD2A 5CC9A 4LAEX 1KMSA 1DR3A 3KY8A 1YHOA 5CCCA 4HA9A 4KFJA 3K2HA 1S3UA 1RA1A 5HI6A 5JA3A 3QYLA 3F0XX 1IA2A 2P4GA 3UM5A 4QJCA 1MVTA 3FQCA 4KJKA 3FQ0A 4Q0DA 5DXVA 3FQVA 1RA2A 3JW3A 5ECXA 1E26A 3ROAA 3EEJA 3JVXA 3NZBX 2AZNA 4DPHA 3FY9X 3D80A 4H95A 3QFXA 2W3MA 1AI9A 4RGCA 1RX2A 2H2QA 1PD9A 4FHBA 3E0BA 3I3RA 4TU5X 2GD9A 3I8AX 3JSUA 1JUVA 3QG2A 1S3VA 2W3AA 3FL8A 1VDRA 3KJSA 3F0SX 1DR2A 3JWFA 4KLXA 3SQYX 4XT7A 1DLRA 3L3RA 3N0HA 4G3MA 3K74A 3QLZA 2C2SA 3SA2A 4HA7A 4KM0A 4FGGA 1DG8A 4XECX 2CD2A 1BOZA 1LY3A 4X5HA 1DLSA 4PTJA 4KBNA 3JWMA 4NX6A 4QLGA 4DP3A 3SH2A 1RF7A 3S9UA 4M2XA 3HBBA 3K45A 4PSTA 4ELGA 1HFPA 3F0BX 1DYRA 3Q1HA 1IA4A 5HPBA 1DR6A 1RA9A 2JYBA 4KY8A 3DAUA 3QL0A 3QL3A 1RD7A 3SAIA 2ITHA 3NZ6X 4M7VA 3DFRA 2DHFA 2XW7A 1IA3A 4XRBA 3S7AA 2HM9A 3ZPGA 2L28A 2ANQA 3QLYA 2QK8A 3CSEA 3FRBX 4I1NA 4IXED 1AOEA 3CLBA 3UM6A 4LEKX 3M09A 2BLCA 4KYAA 2BLBA 4EIZA 1J3JA 3FRFX 1LY4A 2FZIA 4CD2A 1DYHA 1RH3A 4LAGX 1DG5A 1DR7A 3FYWX 1HFQA 3NXVA 1BZFA 3GI2A 3SGYA 3HJ3A 3NU0A 3SR5X 3EIGA 3JTWA 4DDRA 4HOGA 6DFRA 3UM8A 2W3WA 2ANOA 1DR1A 4I13A 1RB3A 3QLXA 4KJLA 1MVSA 1PD8A 4ELFA 4G8ZX 5HT5A 2O7PA 4KAKA 3QLWA 4IXGX 4Q6AA 4Q67A 1DRAA 1JOMA 5HVEA 1OHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D5N A;  4XT6 A;  1DDS A;  5U26 A;  2W3V A;  3IX9 A;  3DAT A;  2BL9 A;  3QYO A;  3GHW A;  3D84 X;  3NXO A;  1DRE A;  3DL5 A;  5DFR A;  4X5I A;  3FQO A;  3TD8 A;  2OBC A;  2FZJ A;  4XT4 A;  4M6J A;  3R33 A;  5HQY A;  3KJR A;  1RX5 A;  5HT4 A;  4P66 A;  3FQZ A;  3EEL A;  5EAJ A;  1RA3 A;  4FGH A;  1DHJ A;  3TQA A;  1DG7 A;  1KMV A;  3RO9 A;  4PSS A;  1CZ3 A;  2HQP A;  4LAH X;  3F0V X;  3NTZ A;  3DGA A;  4QJZ D;  3TQ9 A;  1DAJ A;  3F0U X;  4PSY A;  1RX9 A;  3S3V A;  3IRO A;  4X5G A;  2KGK A;  3FRD X;  4M6K A;  1DR5 A;  3EEM A;  1DYI A;  4P3Q A;  4EJ1 A;  2ZZA A;  4DPD A;  1DDR A;  3NXT A;  3VCO A;  5HQZ A;  3IA4 A;  2W9T A;  4KM2 A;  4GH8 A;  3F8Z A;  3NXR A;  3JWK A;  4ELE A;  5E8Q A;  4EIL A;  3SRW X;  3K47 A;  3DRC A;  3JWC A;  4XT8 A;  4EIG A;  1RX3 A;  3SRR X;  3FY8 X;  1RG7 A;  3ZPC A;  1RX7 A;  3QGT A;  3INV A;  4DFR A;  2LF1 A;  1M7A A;  2W9G A;  4KL9 A;  5HUI A;  4QI9 A;  3NZ9 X;  1S3Y A;  5U27 A;  4H97 A;  4ELH A;  2W9H A;  4H98 A;  1DHI A;  3OAF A;  4G95 A;  1RB2 A;  4HOE A;  3EEK A;  4ELB A;  3GHC A;  3FRA X;  1DF7 A;  1SEJ A;  4Q0E A;  4NX7 A;  3FS6 A;  3IRN A;  4KD7 A;  4KJJ A;  3M08 A;  5HVB A;  4QLF A;  1DIU A;  2D0K A;  3NRR A;  5HF0 X;  4QHV A;  1RA8 A;  5JG0 X;  3JW5 A;  3KGY A;  2C2T A;  2INQ A;  3IA5 A;  4ECK A;  3FRE X;  4XT5 A;  1KLK A;  5ECC A;  7DFR A;  3EX8 A;  4HOF A;  4P3R A;  1VJ3 A;  2BLA A;  1LUD A;  3KFY A;  3SRU X;  3IRM A;  1DRB A;  4KY4 A;  3NXY A;  1DRF A;  4M7U A;  4PTH A;  1U71 A;  1RX1 A;  2W3B A;  1RC4 A;  4KEB A;  1AO8 A;  3LG4 A;  1U70 A;  3OCH A;  3CL9 A;  1OHK A;  4KNE A;  3F91 A;  1M78 A;  2B3Z A;  4XE6 X;  1PDB A;  1D1G A;  3QLR A;  3NZC X;  3F8Y A;  4X5F A;  1DYJ A;  1IA1 A;  3DL6 A;  1S3W A;  1RX4 A;  3F0Q X;  2CIG A;  8DFR A;  1CD2 A;  4X5J A;  2OIP A;  3TQ8 A;  4H96 A;  3NZA X;  4PDJ A;  1DHF A;  1RE7 A;  4OSG A;  3SRS X;  5HSR A;  1J3I A;  1DRH A;  3DG8 A;  3NZD A;  2DRC A;  3FQF A;  3SRQ X;  3QLS A;  1DR4 A;  4P68 A;  1HFR A;  3FYV X;  3FL9 A;  3NXX A;  1DIS A;  1M79 A;  3TQB A;  3RG9 A;  1J3K A;  3GHV A;  3SA1 A;  1RX8 A;  4OR7 A;  1U72 A;  1TDR A;  2G6V A;  4IXF X;  1ZDR A;  4QLE A;  1RX6 A;  2FZH A;  3GYF A;  4M6L A;  2HXV A;  5FDA A;  2W9S A;  5HSU A;  5HF2 X;  1JOL A;  1QZF A;  3CD2 A;  5CC9 A;  4LAE X;  1KMS A;  1DR3 A;  3KY8 A;  1YHO A;  5CCC A;  4HA9 A;  4KFJ A;  3K2H A;  1S3U A;  1RA1 A;  5HI6 A;  5JA3 A;  3QYL A;  3F0X X;  1IA2 A;  2P4G A;  3UM5 A;  4QJC A;  1MVT A;  3FQC A;  4KJK A;  3FQ0 A;  4Q0D A;  5DXV A;  3FQV A;  1RA2 A;  3JW3 A;  5ECX A;  1E26 A;  3ROA A;  3EEJ A;  3JVX A;  3NZB X;  2AZN A;  4DPH A;  3FY9 X;  3D80 A;  4H95 A;  3QFX A;  2W3M A;  1AI9 A;  4RGC A;  1RX2 A;  2H2Q A;  1PD9 A;  4FHB A;  3E0B A;  3I3R A;  4TU5 X;  2GD9 A;  3I8A X;  3JSU A;  1JUV A;  3QG2 A;  1S3V A;  2W3A A;  3FL8 A;  1VDR A;  3KJS A;  3F0S X;  1DR2 A;  3JWF A;  4KLX A;  3SQY X;  4XT7 A;  1DLR A;  3L3R A;  3N0H A;  4G3M A;  3K74 A;  3QLZ A;  2C2S A;  3SA2 A;  4HA7 A;  4KM0 A;  4FGG A;  1DG8 A;  4XEC X;  2CD2 A;  1BOZ A;  1LY3 A;  4X5H A;  1DLS A;  4PTJ A;  4KBN A;  3JWM A;  4NX6 A;  4QLG A;  4DP3 A;  3SH2 A;  1RF7 A;  3S9U A;  4M2X A;  3HBB A;  3K45 A;  4PST A;  4ELG A;  1HFP A;  3F0B X;  1DYR A;  3Q1H A;  1IA4 A;  5HPB A;  1DR6 A;  1RA9 A;  2JYB A;  4KY8 A;  3DAU A;  3QL0 A;  3QL3 A;  1RD7 A;  3SAI A;  2ITH A;  3NZ6 X;  4M7V A;  3DFR A;  2DHF A;  2XW7 A;  1IA3 A;  4XRB A;  3S7A A;  2HM9 A;  3ZPG A;  2L28 A;  2ANQ A;  3QLY A;  2QK8 A;  3CSE A;  3FRB X;  4I1N A;  4IXE D;  1AOE A;  3CLB A;  3UM6 A;  4LEK X;  3M09 A;  2BLC A;  4KYA A;  2BLB A;  4EIZ A;  1J3J A;  3FRF X;  1LY4 A;  2FZI A;  4CD2 A;  1DYH A;  1RH3 A;  4LAG X;  1DG5 A;  1DR7 A;  3FYW X;  1HFQ A;  3NXV A;  1BZF A;  3GI2 A;  3SGY A;  3HJ3 A;  3NU0 A;  3SR5 X;  3EIG A;  3JTW A;  4DDR A;  4HOG A;  6DFR A;  3UM8 A;  2W3W A;  2ANO A;  1DR1 A;  4I13 A;  1RB3 A;  3QLX A;  4KJL A;  1MVS A;  1PD8 A;  4ELF A;  4G8Z X;  5HT5 A;  2O7P A;  4KAK A;  3QLW A;  4IXG X;  4Q6A A;  4Q67 A;  1DRA A;  1JOM A;  5HVE A;  1OHJ A; 
#chains in the Genus database with same CATH topology
 2D5N A;  4XT6 A;  1DDS A;  5U26 A;  2W3V A;  3IX9 A;  3DAT A;  2BL9 A;  3QYO A;  3GHW A;  3D84 X;  3NXO A;  1DRE A;  3DL5 A;  5DFR A;  4X5I A;  3FQO A;  3TD8 A;  2OBC A;  2FZJ A;  4XT4 A;  4M6J A;  3R33 A;  5HQY A;  3KJR A;  1RX5 A;  5HT4 A;  4P66 A;  3FQZ A;  3EEL A;  5EAJ A;  1RA3 A;  4FGH A;  1DHJ A;  3TQA A;  1DG7 A;  1KMV A;  3RO9 A;  4PSS A;  1CZ3 A;  2HQP A;  4LAH X;  3F0V X;  3NTZ A;  3DGA A;  4QJZ D;  3TQ9 A;  1DAJ A;  3F0U X;  4PSY A;  1RX9 A;  3S3V A;  3IRO A;  4X5G A;  2KGK A;  3FRD X;  4M6K A;  1DR5 A;  3EEM A;  1DYI A;  4P3Q A;  4EJ1 A;  2ZZA A;  4DPD A;  1DDR A;  3NXT A;  3VCO A;  5HQZ A;  3IA4 A;  2W9T A;  4KM2 A;  4GH8 A;  3F8Z A;  3NXR A;  3JWK A;  4ELE A;  5E8Q A;  4EIL A;  3SRW X;  3K47 A;  3DRC A;  3JWC A;  4XT8 A;  4EIG A;  1RX3 A;  3SRR X;  3FY8 X;  1RG7 A;  3ZPC A;  1RX7 A;  3QGT A;  3INV A;  4DFR A;  2LF1 A;  1M7A A;  2W9G A;  4KL9 A;  5HUI A;  4QI9 A;  3NZ9 X;  1S3Y A;  5U27 A;  4H97 A;  4ELH A;  2W9H A;  4H98 A;  1DHI A;  3OAF A;  4G95 A;  1RB2 A;  4HOE A;  3EEK A;  4ELB A;  3GHC A;  3FRA X;  1DF7 A;  1SEJ A;  4Q0E A;  4NX7 A;  3FS6 A;  3IRN A;  4KD7 A;  4KJJ A;  3M08 A;  5HVB A;  4QLF A;  1DIU A;  2D0K A;  3NRR A;  5HF0 X;  4QHV A;  1RA8 A;  5JG0 X;  3JW5 A;  3KGY A;  2C2T A;  2INQ A;  3IA5 A;  4ECK A;  3FRE X;  4XT5 A;  1KLK A;  5ECC A;  7DFR A;  3EX8 A;  4HOF A;  4P3R A;  1VJ3 A;  2BLA A;  1LUD A;  3KFY A;  3SRU X;  3IRM A;  1DRB A;  4KY4 A;  3NXY A;  1DRF A;  4M7U A;  4PTH A;  1U71 A;  1RX1 A;  2W3B A;  1RC4 A;  4KEB A;  1AO8 A;  3LG4 A;  1U70 A;  3OCH A;  3CL9 A;  1OHK A;  4KNE A;  3F91 A;  1M78 A;  2B3Z A;  4XE6 X;  1PDB A;  1D1G A;  3QLR A;  3NZC X;  3F8Y A;  4X5F A;  1DYJ A;  1IA1 A;  3DL6 A;  1S3W A;  1RX4 A;  3F0Q X;  2CIG A;  8DFR A;  1CD2 A;  4X5J A;  2OIP A;  3TQ8 A;  4H96 A;  3NZA X;  4PDJ A;  1DHF A;  1RE7 A;  4OSG A;  3SRS X;  5HSR A;  1J3I A;  1DRH A;  3DG8 A;  3NZD A;  2DRC A;  3FQF A;  3SRQ X;  3QLS A;  1DR4 A;  4P68 A;  1HFR A;  3FYV X;  3FL9 A;  3NXX A;  1DIS A;  1M79 A;  3TQB A;  3RG9 A;  1J3K A;  3GHV A;  3SA1 A;  1RX8 A;  4OR7 A;  1U72 A;  1TDR A;  2G6V A;  4IXF X;  1ZDR A;  4QLE A;  1RX6 A;  2FZH A;  3GYF A;  4M6L A;  2HXV A;  5FDA A;  2W9S A;  5HSU A;  5HF2 X;  1JOL A;  1QZF A;  3CD2 A;  5CC9 A;  4LAE X;  1KMS A;  1DR3 A;  3KY8 A;  1YHO A;  5CCC A;  4HA9 A;  4KFJ A;  3K2H A;  1S3U A;  1RA1 A;  5HI6 A;  5JA3 A;  3QYL A;  3F0X X;  1IA2 A;  2P4G A;  3UM5 A;  4QJC A;  1MVT A;  3FQC A;  4KJK A;  3FQ0 A;  4Q0D A;  5DXV A;  3FQV A;  1RA2 A;  3JW3 A;  5ECX A;  1E26 A;  3ROA A;  3EEJ A;  3JVX A;  3NZB X;  2AZN A;  4DPH A;  3FY9 X;  3D80 A;  4H95 A;  3QFX A;  2W3M A;  1AI9 A;  4RGC A;  1RX2 A;  2H2Q A;  1PD9 A;  4FHB A;  3E0B A;  3I3R A;  4TU5 X;  2GD9 A;  3I8A X;  3JSU A;  1JUV A;  3QG2 A;  1S3V A;  2W3A A;  3FL8 A;  1VDR A;  3KJS A;  3F0S X;  1DR2 A;  3JWF A;  4KLX A;  3SQY X;  4XT7 A;  1DLR A;  3L3R A;  3N0H A;  4G3M A;  3K74 A;  3QLZ A;  2C2S A;  3SA2 A;  4HA7 A;  4KM0 A;  4FGG A;  1DG8 A;  4XEC X;  2CD2 A;  1BOZ A;  1LY3 A;  4X5H A;  1DLS A;  4PTJ A;  4KBN A;  3JWM A;  4NX6 A;  4QLG A;  4DP3 A;  3SH2 A;  1RF7 A;  3S9U A;  4M2X A;  3HBB A;  3K45 A;  4PST A;  4ELG A;  1HFP A;  3F0B X;  1DYR A;  3Q1H A;  1IA4 A;  5HPB A;  1DR6 A;  1RA9 A;  2JYB A;  4KY8 A;  3DAU A;  3QL0 A;  3QL3 A;  1RD7 A;  3SAI A;  2ITH A;  3NZ6 X;  4M7V A;  3DFR A;  2DHF A;  2XW7 A;  1IA3 A;  4XRB A;  3S7A A;  2HM9 A;  3ZPG A;  2L28 A;  2ANQ A;  3QLY A;  2QK8 A;  3CSE A;  3FRB X;  4I1N A;  4IXE D;  1AOE A;  3CLB A;  3UM6 A;  4LEK X;  3M09 A;  2BLC A;  4KYA A;  2BLB A;  4EIZ A;  1J3J A;  3FRF X;  1LY4 A;  2FZI A;  4CD2 A;  1DYH A;  1RH3 A;  4LAG X;  1DG5 A;  1DR7 A;  3FYW X;  1HFQ A;  3NXV A;  1BZF A;  3GI2 A;  3SGY A;  3HJ3 A;  3NU0 A;  3SR5 X;  3EIG A;  3JTW A;  4DDR A;  4HOG A;  6DFR A;  3UM8 A;  2W3W A;  2ANO A;  1DR1 A;  4I13 A;  1RB3 A;  3QLX A;  4KJL A;  1MVS A;  1PD8 A;  4ELF A;  4G8Z X;  5HT5 A;  2O7P A;  4KAK A;  3QLW A;  4IXG X;  4Q6A A;  4Q67 A;  1DRA A;  1JOM A;  5HVE A;  1OHJ A; 
#chains in the Genus database with same CATH homology
 2D5N A;  4XT6 A;  1DDS A;  5U26 A;  2W3V A;  3IX9 A;  3DAT A;  2BL9 A;  3QYO A;  3GHW A;  3D84 X;  3NXO A;  1DRE A;  3DL5 A;  5DFR A;  4X5I A;  3FQO A;  3TD8 A;  2OBC A;  2FZJ A;  4XT4 A;  4M6J A;  3R33 A;  5HQY A;  3KJR A;  1RX5 A;  5HT4 A;  4P66 A;  3FQZ A;  3EEL A;  5EAJ A;  1RA3 A;  4FGH A;  1DHJ A;  3TQA A;  1DG7 A;  1KMV A;  3RO9 A;  4PSS A;  1CZ3 A;  2HQP A;  4LAH X;  3F0V X;  3NTZ A;  3DGA A;  4QJZ D;  3TQ9 A;  1DAJ A;  3F0U X;  4PSY A;  1RX9 A;  3S3V A;  3IRO A;  4X5G A;  2KGK A;  3FRD X;  4M6K A;  1DR5 A;  3EEM A;  1DYI A;  4P3Q A;  4EJ1 A;  2ZZA A;  4DPD A;  1DDR A;  3NXT A;  3VCO A;  5HQZ A;  3IA4 A;  2W9T A;  4KM2 A;  4GH8 A;  3F8Z A;  3NXR A;  3JWK A;  4ELE A;  5E8Q A;  4EIL A;  3SRW X;  3K47 A;  3DRC A;  3JWC A;  4XT8 A;  4EIG A;  1RX3 A;  3SRR X;  3FY8 X;  1RG7 A;  3ZPC A;  1RX7 A;  3QGT A;  3INV A;  4DFR A;  2LF1 A;  1M7A A;  2W9G A;  4KL9 A;  5HUI A;  4QI9 A;  3NZ9 X;  1S3Y A;  5U27 A;  4H97 A;  4ELH A;  2W9H A;  4H98 A;  1DHI A;  3OAF A;  4G95 A;  1RB2 A;  4HOE A;  3EEK A;  4ELB A;  3GHC A;  3FRA X;  1DF7 A;  1SEJ A;  4Q0E A;  4NX7 A;  3FS6 A;  3IRN A;  4KD7 A;  4KJJ A;  3M08 A;  5HVB A;  4QLF A;  1DIU A;  2D0K A;  3NRR A;  5HF0 X;  4QHV A;  1RA8 A;  5JG0 X;  3JW5 A;  3KGY A;  2C2T A;  2INQ A;  3IA5 A;  4ECK A;  3FRE X;  4XT5 A;  1KLK A;  5ECC A;  7DFR A;  3EX8 A;  4HOF A;  4P3R A;  1VJ3 A;  2BLA A;  1LUD A;  3KFY A;  3SRU X;  3IRM A;  1DRB A;  4KY4 A;  3NXY A;  1DRF A;  4M7U A;  4PTH A;  1U71 A;  1RX1 A;  2W3B A;  1RC4 A;  4KEB A;  1AO8 A;  3LG4 A;  1U70 A;  3OCH A;  3CL9 A;  1OHK A;  4KNE A;  3F91 A;  1M78 A;  2B3Z A;  4XE6 X;  1PDB A;  1D1G A;  3QLR A;  3NZC X;  3F8Y A;  4X5F A;  1DYJ A;  1IA1 A;  3DL6 A;  1S3W A;  1RX4 A;  3F0Q X;  2CIG A;  8DFR A;  1CD2 A;  4X5J A;  2OIP A;  3TQ8 A;  4H96 A;  3NZA X;  4PDJ A;  1DHF A;  1RE7 A;  4OSG A;  3SRS X;  5HSR A;  1J3I A;  1DRH A;  3DG8 A;  3NZD A;  2DRC A;  3FQF A;  3SRQ X;  3QLS A;  1DR4 A;  4P68 A;  1HFR A;  3FYV X;  3FL9 A;  3NXX A;  1DIS A;  1M79 A;  3TQB A;  3RG9 A;  1J3K A;  3GHV A;  3SA1 A;  1RX8 A;  4OR7 A;  1U72 A;  1TDR A;  2G6V A;  4IXF X;  1ZDR A;  4QLE A;  1RX6 A;  2FZH A;  3GYF A;  4M6L A;  2HXV A;  5FDA A;  2W9S A;  5HSU A;  5HF2 X;  1JOL A;  1QZF A;  3CD2 A;  5CC9 A;  4LAE X;  1KMS A;  1DR3 A;  3KY8 A;  1YHO A;  5CCC A;  4HA9 A;  4KFJ A;  3K2H A;  1S3U A;  1RA1 A;  5HI6 A;  5JA3 A;  3QYL A;  3F0X X;  1IA2 A;  2P4G A;  3UM5 A;  4QJC A;  1MVT A;  3FQC A;  4KJK A;  3FQ0 A;  4Q0D A;  5DXV A;  3FQV A;  1RA2 A;  3JW3 A;  5ECX A;  1E26 A;  3ROA A;  3EEJ A;  3JVX A;  3NZB X;  2AZN A;  4DPH A;  3FY9 X;  3D80 A;  4H95 A;  3QFX A;  2W3M A;  1AI9 A;  4RGC A;  1RX2 A;  2H2Q A;  1PD9 A;  4FHB A;  3E0B A;  3I3R A;  4TU5 X;  2GD9 A;  3I8A X;  3JSU A;  1JUV A;  3QG2 A;  1S3V A;  2W3A A;  3FL8 A;  1VDR A;  3KJS A;  3F0S X;  1DR2 A;  3JWF A;  4KLX A;  3SQY X;  4XT7 A;  1DLR A;  3L3R A;  3N0H A;  4G3M A;  3K74 A;  3QLZ A;  2C2S A;  3SA2 A;  4HA7 A;  4KM0 A;  4FGG A;  1DG8 A;  4XEC X;  2CD2 A;  1BOZ A;  1LY3 A;  4X5H A;  1DLS A;  4PTJ A;  4KBN A;  3JWM A;  4NX6 A;  4QLG A;  4DP3 A;  3SH2 A;  1RF7 A;  3S9U A;  4M2X A;  3HBB A;  3K45 A;  4PST A;  4ELG A;  1HFP A;  3F0B X;  1DYR A;  3Q1H A;  1IA4 A;  5HPB A;  1DR6 A;  1RA9 A;  2JYB A;  4KY8 A;  3DAU A;  3QL0 A;  3QL3 A;  1RD7 A;  3SAI A;  2ITH A;  3NZ6 X;  4M7V A;  3DFR A;  2DHF A;  2XW7 A;  1IA3 A;  4XRB A;  3S7A A;  2HM9 A;  3ZPG A;  2L28 A;  2ANQ A;  3QLY A;  2QK8 A;  3CSE A;  3FRB X;  4I1N A;  4IXE D;  1AOE A;  3CLB A;  3UM6 A;  4LEK X;  3M09 A;  2BLC A;  4KYA A;  2BLB A;  4EIZ A;  1J3J A;  3FRF X;  1LY4 A;  2FZI A;  4CD2 A;  1DYH A;  1RH3 A;  4LAG X;  1DG5 A;  1DR7 A;  3FYW X;  1HFQ A;  3NXV A;  1BZF A;  3GI2 A;  3SGY A;  3HJ3 A;  3NU0 A;  3SR5 X;  3EIG A;  3JTW A;  4DDR A;  4HOG A;  6DFR A;  3UM8 A;  2W3W A;  2ANO A;  1DR1 A;  4I13 A;  1RB3 A;  3QLX A;  4KJL A;  1MVS A;  1PD8 A;  4ELF A;  4G8Z X;  5HT5 A;  2O7P A;  4KAK A;  3QLW A;  4IXG X;  4Q6A A;  4Q67 A;  1DRA A;  1JOM A;  5HVE A;  1OHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...