4ELGA

Structure-activity relationship guides enantiomeric preference among potent inhibitors of b. anthracis dihydrofolate reductase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
166
structure length
166
Chain Sequence
MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNEGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHAFEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHVYEKQQLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-activity relationship for enantiomers of potent inhibitors of B. anthracis dihydrofolate reductase.
pubmed doi rcsb
molecule keywords Dihydrofolate reductase
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Bacillus anthracis
total genus 40
structure length 166
sequence length 166
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2012-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 4elgA00
1MVSA 1IA1A 3EEKA 4HA7A 5CCCA 2CIGA 1DRHA 4EILA 4ELFA 3FQZA 1DR5A 3JWKA 1RX6A 3ZPGA 3F8ZA 4XECX 1U71A 4QLEA 4NX6A 4Q67A 1DF7A 2HQPA 1DISA 4HOFA 1LY4A 4XT7A 1HFRA 3QL0A 6DFRA 4X5JA 5HT5A 2FZHA 5U27A 3D84X 4H97A 2BLCA 5HSUA 3F0UX 1RX9A 1DR1A 1IA4A 3SAIA 4KNEA 1DR6A 3TQ9A 4DFRA 1U72A 5HT4A 3EEMA 3HBBA 3QLZA 4KYAA 2HXVA 3JWCA 5CC9A 1LY3A 2DHFA 2O7PA 3GHVA 3SGYA 1DR4A 4P3QA 7DFRA 1DLRA 4ECKA 3NXYA 2BLAA 3DGAA 3NXVA 2C2SA 4Q0DA 1RB2A 3SA2A 3KJSA 1RA9A 1KLKA 2FZJA 5HPBA 2P4GA 4Q0EA 2INQA 2W9GA 4M6JA 2GD9A 3SRSX 1RG7A 3FQFA 1DR3A 4ELGA 1RX2A 3UM5A 4QJCA 4HOGA 3IRNA 4G8ZX 3DL6A 1DR2A 3JVXA 4KY8A 4G95A 4I13A 1AOEA 4DDRA 5EAJA 1PD9A 1BOZA 4X5GA 5HQZA 5HUIA 1IA2A 2D5NA 2W3WA 3QYLA 1S3WA 4KJJA 3SR5X 3LG4A 4OR7A 4PSYA 2DRCA 4FGGA 4ELBA 1M7AA 1RX1A 5DXVA 3L3RA 3F8YA 4P66A 3ROAA 3FS6A 3EELA 1RH3A 3SQYX 1RA2A 3IROA 4H96A 4EJ1A 1OHJA 3FRFX 3SRRX 2LF1A 1RB3A 1SEJA 3RO9A 4M7VA 1MVTA 5JA3A 4XE6X 2G6VA 2W3BA 5HQYA 3KFYA 1RF7A 4KM0A 4IXGX 3JSUA 4QLGA 3NZBX 1KMSA 1RX8A 4QJZD 1S3VA 3UM6A 4NX7A 3HJ3A 3GYFA 4KFJA 4H98A 1DDRA 2CD2A 3IRMA 4FGHA 3FREX 2JYBA 2ANQA 4KLXA 5E8QA 1DG5A 1RA3A 4XT8A 1DR7A 5U26A 3N0HA 2W3AA 3IA4A 4LAGX 1CD2A 3JW3A 1M78A 2ZZAA 4RGCA 5JG0X 2L28A 3FL8A 3K47A 3TQ8A 4OSGA 1S3YA 1DHFA 3FRAX 2BL9A 3RG9A 2W9TA 3K74A 3NXOA 3QFXA 4KBNA 1M79A 1RX5A 3GHWA 1RX3A 3S7AA 3QLXA 3FY8X 5HSRA 2FZIA 3CD2A 1QZFA 3ZPCA 1DIUA 3JWFA 3FYVX 3FL9A 4DPDA 3QG2A 4PDJA 3Q1HA 3JW5A 4M7UA 3SA1A 2W3VA 4DPHA 3OAFA 2W3MA 2OBCA 3UM8A 1IA3A 3NZDA 3NU0A 3SRQX 1HFQA 4KM2A 1RD7A 3K45A 1DYRA 4PTHA 1HFPA 1VJ3A 4P68A 3DG8A 4KD7A 1DAJA 1ZDRA 1U70A 1E26A 1RX4A 4KL9A 4XT4A 4LAHX 2H2QA 3M09A 4DP3A 4KJKA 2XW7A 3FQOA 2W9HA 1CZ3A 5HF0X 3DRCA 4IXED 3EEJA 1J3IA 3QLSA 3NXRA 4QHVA 4X5IA 2OIPA 1DG7A 3EIGA 4FHBA 4G3MA 3NXXA 1J3JA 1D1GA 3DAUA 3INVA 1DYJA 1TDRA 4PSTA 4X5HA 4I1NA 3F0QX 2KGKA 5HVEA 1DREA 3FQVA 1DRFA 1VDRA 3R33A 3QL3A 5ECCA 4XT5A 3CLBA 3KJRA 4XRBA 3F91A 2W9SA 5FDAA 3TD8A 3TQAA 3F0VX 1J3KA 3VCOA 1DYIA 4X5FA 4M6KA 1S3UA 3DL5A 3SRUX 3JTWA 4EIZA 2D0KA 4GH8A 5DFRA 4KAKA 3I8AX 3NRRA 3NXTA 1OHKA 3S3VA 4M2XA 1DRBA 4QI9A 3NTZA 3NZCX 3D80A 3QLWA 4QLFA 3M08A 2HM9A 3SRWX 4ELEA 1DHJA 2ANOA 2QK8A 3IX9A 4XT6A 3FYWX 1PD8A 3OCHA 1DYHA 1DG8A 4EIGA 4PTJA 4PSSA 3EX8A 3FRDX 4TU5X 3S9UA 3FY9X 4KEBA 3FQ0A 3GHCA 5ECXA 3E0BA 3F0SX 3GI2A 3NZ6X 4H95A 4P3RA 3CSEA 5HF2X 3F0BX 5HI6A 1JUVA 3DATA 4IXFX 1RE7A 3K2HA 3KGYA 3FQCA 1RA1A 4HA9A 1RC4A 1BZFA 1AO8A 1DLSA 3F0XX 2C2TA 3QYOA 1LUDA 2AZNA 4ELHA 1DRAA 3SH2A 3JWMA 3NZAX 4M6LA 4CD2A 4LAEX 2B3ZA 5HVBA 3QLRA 1RA8A 1RX7A 1YHOA 2ITHA 4HOEA 2BLBA 3CL9A 3NZ9X 1PDBA 4KY4A 3TQBA 3IA5A 3FRBX 3QGTA 1AI9A 3KY8A 3I3RA 1DHIA 4LEKX 8DFRA 4Q6AA 1JOLA 3QLYA 1JOMA 3DFRA 4KJLA 1KMVA 1DDSA
chains in the Genus database with same CATH superfamily
1MVSA 1IA1A 3EEKA 4HA7A 5CCCA 2CIGA 1DRHA 4EILA 4ELFA 3FQZA 1DR5A 3JWKA 1RX6A 3ZPGA 3F8ZA 4XECX 1U71A 4QLEA 4NX6A 4Q67A 1DF7A 2HQPA 1DISA 4HOFA 1LY4A 4XT7A 1HFRA 3QL0A 6DFRA 4X5JA 5HT5A 2FZHA 5U27A 3D84X 4H97A 2BLCA 5HSUA 3F0UX 1RX9A 1DR1A 1IA4A 3SAIA 4KNEA 1DR6A 3TQ9A 4DFRA 1U72A 5HT4A 3EEMA 3HBBA 3QLZA 4KYAA 2HXVA 3JWCA 5CC9A 1LY3A 2DHFA 2O7PA 3GHVA 3SGYA 1DR4A 4P3QA 7DFRA 1DLRA 4ECKA 3NXYA 2BLAA 3DGAA 3NXVA 2C2SA 4Q0DA 1RB2A 3SA2A 3KJSA 1RA9A 1KLKA 2FZJA 5HPBA 2P4GA 4Q0EA 2INQA 2W9GA 4M6JA 2GD9A 3SRSX 1RG7A 3FQFA 1DR3A 4ELGA 1RX2A 3UM5A 4QJCA 4HOGA 3IRNA 4G8ZX 3DL6A 1DR2A 3JVXA 4KY8A 4G95A 4I13A 1AOEA 4DDRA 5EAJA 1PD9A 1BOZA 4X5GA 5HQZA 5HUIA 1IA2A 2D5NA 2W3WA 3QYLA 1S3WA 4KJJA 3SR5X 3LG4A 4OR7A 4PSYA 2DRCA 4FGGA 4ELBA 1M7AA 1RX1A 5DXVA 3L3RA 3F8YA 4P66A 3ROAA 3FS6A 3EELA 1RH3A 3SQYX 1RA2A 3IROA 4H96A 4EJ1A 1OHJA 3FRFX 3SRRX 2LF1A 1RB3A 1SEJA 3RO9A 4M7VA 1MVTA 5JA3A 4XE6X 2G6VA 2W3BA 5HQYA 3KFYA 1RF7A 4KM0A 4IXGX 3JSUA 4QLGA 3NZBX 1KMSA 1RX8A 4QJZD 1S3VA 3UM6A 4NX7A 3HJ3A 3GYFA 4KFJA 4H98A 1DDRA 2CD2A 3IRMA 4FGHA 3FREX 2JYBA 2ANQA 4KLXA 5E8QA 1DG5A 1RA3A 4XT8A 1DR7A 5U26A 3N0HA 2W3AA 3IA4A 4LAGX 1CD2A 3JW3A 1M78A 2ZZAA 4RGCA 5JG0X 2L28A 3FL8A 3K47A 3TQ8A 4OSGA 1S3YA 1DHFA 3FRAX 2BL9A 3RG9A 2W9TA 3K74A 3NXOA 3QFXA 4KBNA 1M79A 1RX5A 3GHWA 1RX3A 3S7AA 3QLXA 3FY8X 5HSRA 2FZIA 3CD2A 1QZFA 3ZPCA 1DIUA 3JWFA 3FYVX 3FL9A 4DPDA 3QG2A 4PDJA 3Q1HA 3JW5A 4M7UA 3SA1A 2W3VA 4DPHA 3OAFA 2W3MA 2OBCA 3UM8A 1IA3A 3NZDA 3NU0A 3SRQX 1HFQA 4KM2A 1RD7A 3K45A 1DYRA 4PTHA 1HFPA 1VJ3A 4P68A 3DG8A 4KD7A 1DAJA 1ZDRA 1U70A 1E26A 1RX4A 4KL9A 4XT4A 4LAHX 2H2QA 3M09A 4DP3A 4KJKA 2XW7A 3FQOA 2W9HA 1CZ3A 5HF0X 3DRCA 4IXED 3EEJA 1J3IA 3QLSA 3NXRA 4QHVA 4X5IA 2OIPA 1DG7A 3EIGA 4FHBA 4G3MA 3NXXA 1J3JA 1D1GA 3DAUA 3INVA 1DYJA 1TDRA 4PSTA 4X5HA 4I1NA 3F0QX 2KGKA 5HVEA 1DREA 3FQVA 1DRFA 1VDRA 3R33A 3QL3A 5ECCA 4XT5A 3CLBA 3KJRA 4XRBA 3F91A 2W9SA 5FDAA 3TD8A 3TQAA 3F0VX 1J3KA 3VCOA 1DYIA 4X5FA 4M6KA 1S3UA 3DL5A 3SRUX 3JTWA 4EIZA 2D0KA 4GH8A 5DFRA 4KAKA 3I8AX 3NRRA 3NXTA 1OHKA 3S3VA 4M2XA 1DRBA 4QI9A 3NTZA 3NZCX 3D80A 3QLWA 4QLFA 3M08A 2HM9A 3SRWX 4ELEA 1DHJA 2ANOA 2QK8A 3IX9A 4XT6A 3FYWX 1PD8A 3OCHA 1DYHA 1DG8A 4EIGA 4PTJA 4PSSA 3EX8A 3FRDX 4TU5X 3S9UA 3FY9X 4KEBA 3FQ0A 3GHCA 5ECXA 3E0BA 3F0SX 3GI2A 3NZ6X 4H95A 4P3RA 3CSEA 5HF2X 3F0BX 5HI6A 1JUVA 3DATA 4IXFX 1RE7A 3K2HA 3KGYA 3FQCA 1RA1A 4HA9A 1RC4A 1BZFA 1AO8A 1DLSA 3F0XX 2C2TA 3QYOA 1LUDA 2AZNA 4ELHA 1DRAA 3SH2A 3JWMA 3NZAX 4M6LA 4CD2A 4LAEX 2B3ZA 5HVBA 3QLRA 1RA8A 1RX7A 1YHOA 2ITHA 4HOEA 2BLBA 3CL9A 3NZ9X 1PDBA 4KY4A 3TQBA 3IA5A 3FRBX 3QGTA 1AI9A 3KY8A 3I3RA 1DHIA 4LEKX 8DFRA 4Q6AA 1JOLA 3QLYA 1JOMA 3DFRA 4KJLA 1KMVA 1DDSA
chains in the Genus database with same CATH topology
1MVSA 1IA1A 3EEKA 4HA7A 5CCCA 2CIGA 1DRHA 4EILA 4ELFA 3FQZA 1DR5A 3JWKA 1RX6A 3ZPGA 3F8ZA 4XECX 1U71A 4QLEA 4NX6A 4Q67A 1DF7A 2HQPA 1DISA 4HOFA 1LY4A 4XT7A 1HFRA 3QL0A 6DFRA 4X5JA 5HT5A 2FZHA 5U27A 3D84X 4H97A 2BLCA 5HSUA 3F0UX 1RX9A 1DR1A 1IA4A 3SAIA 4KNEA 1DR6A 3TQ9A 4DFRA 1U72A 5HT4A 3EEMA 3HBBA 3QLZA 4KYAA 2HXVA 3JWCA 5CC9A 1LY3A 2DHFA 2O7PA 3GHVA 3SGYA 1DR4A 4P3QA 7DFRA 1DLRA 4ECKA 3NXYA 2BLAA 3DGAA 3NXVA 2C2SA 4Q0DA 1RB2A 3SA2A 3KJSA 1RA9A 1KLKA 2FZJA 5HPBA 2P4GA 4Q0EA 2INQA 2W9GA 4M6JA 2GD9A 3SRSX 1RG7A 3FQFA 1DR3A 4ELGA 1RX2A 3UM5A 4QJCA 4HOGA 3IRNA 4G8ZX 3DL6A 1DR2A 3JVXA 4KY8A 4G95A 4I13A 1AOEA 4DDRA 5EAJA 1PD9A 1BOZA 4X5GA 5HQZA 5HUIA 1IA2A 2D5NA 2W3WA 3QYLA 1S3WA 4KJJA 3SR5X 3LG4A 4OR7A 4PSYA 2DRCA 4FGGA 4ELBA 1M7AA 1RX1A 5DXVA 3L3RA 3F8YA 4P66A 3ROAA 3FS6A 3EELA 1RH3A 3SQYX 1RA2A 3IROA 4H96A 4EJ1A 1OHJA 3FRFX 3SRRX 2LF1A 1RB3A 1SEJA 3RO9A 4M7VA 1MVTA 5JA3A 4XE6X 2G6VA 2W3BA 5HQYA 3KFYA 1RF7A 4KM0A 4IXGX 3JSUA 4QLGA 3NZBX 1KMSA 1RX8A 4QJZD 1S3VA 3UM6A 4NX7A 3HJ3A 3GYFA 4KFJA 4H98A 1DDRA 2CD2A 3IRMA 4FGHA 3FREX 2JYBA 2ANQA 4KLXA 5E8QA 1DG5A 1RA3A 4XT8A 1DR7A 5U26A 3N0HA 2W3AA 3IA4A 4LAGX 1CD2A 3JW3A 1M78A 2ZZAA 4RGCA 5JG0X 2L28A 3FL8A 3K47A 3TQ8A 4OSGA 1S3YA 1DHFA 3FRAX 2BL9A 3RG9A 2W9TA 3K74A 3NXOA 3QFXA 4KBNA 1M79A 1RX5A 3GHWA 1RX3A 3S7AA 3QLXA 3FY8X 5HSRA 2FZIA 3CD2A 1QZFA 3ZPCA 1DIUA 3JWFA 3FYVX 3FL9A 4DPDA 3QG2A 4PDJA 3Q1HA 3JW5A 4M7UA 3SA1A 2W3VA 4DPHA 3OAFA 2W3MA 2OBCA 3UM8A 1IA3A 3NZDA 3NU0A 3SRQX 1HFQA 4KM2A 1RD7A 3K45A 1DYRA 4PTHA 1HFPA 1VJ3A 4P68A 3DG8A 4KD7A 1DAJA 1ZDRA 1U70A 1E26A 1RX4A 4KL9A 4XT4A 4LAHX 2H2QA 3M09A 4DP3A 4KJKA 2XW7A 3FQOA 2W9HA 1CZ3A 5HF0X 3DRCA 4IXED 3EEJA 1J3IA 3QLSA 3NXRA 4QHVA 4X5IA 2OIPA 1DG7A 3EIGA 4FHBA 4G3MA 3NXXA 1J3JA 1D1GA 3DAUA 3INVA 1DYJA 1TDRA 4PSTA 4X5HA 4I1NA 3F0QX 2KGKA 5HVEA 1DREA 3FQVA 1DRFA 1VDRA 3R33A 3QL3A 5ECCA 4XT5A 3CLBA 3KJRA 4XRBA 3F91A 2W9SA 5FDAA 3TD8A 3TQAA 3F0VX 1J3KA 3VCOA 1DYIA 4X5FA 4M6KA 1S3UA 3DL5A 3SRUX 3JTWA 4EIZA 2D0KA 4GH8A 5DFRA 4KAKA 3I8AX 3NRRA 3NXTA 1OHKA 3S3VA 4M2XA 1DRBA 4QI9A 3NTZA 3NZCX 3D80A 3QLWA 4QLFA 3M08A 2HM9A 3SRWX 4ELEA 1DHJA 2ANOA 2QK8A 3IX9A 4XT6A 3FYWX 1PD8A 3OCHA 1DYHA 1DG8A 4EIGA 4PTJA 4PSSA 3EX8A 3FRDX 4TU5X 3S9UA 3FY9X 4KEBA 3FQ0A 3GHCA 5ECXA 3E0BA 3F0SX 3GI2A 3NZ6X 4H95A 4P3RA 3CSEA 5HF2X 3F0BX 5HI6A 1JUVA 3DATA 4IXFX 1RE7A 3K2HA 3KGYA 3FQCA 1RA1A 4HA9A 1RC4A 1BZFA 1AO8A 1DLSA 3F0XX 2C2TA 3QYOA 1LUDA 2AZNA 4ELHA 1DRAA 3SH2A 3JWMA 3NZAX 4M6LA 4CD2A 4LAEX 2B3ZA 5HVBA 3QLRA 1RA8A 1RX7A 1YHOA 2ITHA 4HOEA 2BLBA 3CL9A 3NZ9X 1PDBA 4KY4A 3TQBA 3IA5A 3FRBX 3QGTA 1AI9A 3KY8A 3I3RA 1DHIA 4LEKX 8DFRA 4Q6AA 1JOLA 3QLYA 1JOMA 3DFRA 4KJLA 1KMVA 1DDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MVS A;  1IA1 A;  3EEK A;  4HA7 A;  5CCC A;  2CIG A;  1DRH A;  4EIL A;  4ELF A;  3FQZ A;  1DR5 A;  3JWK A;  1RX6 A;  3ZPG A;  3F8Z A;  4XEC X;  1U71 A;  4QLE A;  4NX6 A;  4Q67 A;  1DF7 A;  2HQP A;  1DIS A;  4HOF A;  1LY4 A;  4XT7 A;  1HFR A;  3QL0 A;  6DFR A;  4X5J A;  5HT5 A;  2FZH A;  5U27 A;  3D84 X;  4H97 A;  2BLC A;  5HSU A;  3F0U X;  1RX9 A;  1DR1 A;  1IA4 A;  3SAI A;  4KNE A;  1DR6 A;  3TQ9 A;  4DFR A;  1U72 A;  5HT4 A;  3EEM A;  3HBB A;  3QLZ A;  4KYA A;  2HXV A;  3JWC A;  5CC9 A;  1LY3 A;  2DHF A;  2O7P A;  3GHV A;  3SGY A;  1DR4 A;  4P3Q A;  7DFR A;  1DLR A;  4ECK A;  3NXY A;  2BLA A;  3DGA A;  3NXV A;  2C2S A;  4Q0D A;  1RB2 A;  3SA2 A;  3KJS A;  1RA9 A;  1KLK A;  2FZJ A;  5HPB A;  2P4G A;  4Q0E A;  2INQ A;  2W9G A;  4M6J A;  2GD9 A;  3SRS X;  1RG7 A;  3FQF A;  1DR3 A;  4ELG A;  1RX2 A;  3UM5 A;  4QJC A;  4HOG A;  3IRN A;  4G8Z X;  3DL6 A;  1DR2 A;  3JVX A;  4KY8 A;  4G95 A;  4I13 A;  1AOE A;  4DDR A;  5EAJ A;  1PD9 A;  1BOZ A;  4X5G A;  5HQZ A;  5HUI A;  1IA2 A;  2D5N A;  2W3W A;  3QYL A;  1S3W A;  4KJJ A;  3SR5 X;  3LG4 A;  4OR7 A;  4PSY A;  2DRC A;  4FGG A;  4ELB A;  1M7A A;  1RX1 A;  5DXV A;  3L3R A;  3F8Y A;  4P66 A;  3ROA A;  3FS6 A;  3EEL A;  1RH3 A;  3SQY X;  1RA2 A;  3IRO A;  4H96 A;  4EJ1 A;  1OHJ A;  3FRF X;  3SRR X;  2LF1 A;  1RB3 A;  1SEJ A;  3RO9 A;  4M7V A;  1MVT A;  5JA3 A;  4XE6 X;  2G6V A;  2W3B A;  5HQY A;  3KFY A;  1RF7 A;  4KM0 A;  4IXG X;  3JSU A;  4QLG A;  3NZB X;  1KMS A;  1RX8 A;  4QJZ D;  1S3V A;  3UM6 A;  4NX7 A;  3HJ3 A;  3GYF A;  4KFJ A;  4H98 A;  1DDR A;  2CD2 A;  3IRM A;  4FGH A;  3FRE X;  2JYB A;  2ANQ A;  4KLX A;  5E8Q A;  1DG5 A;  1RA3 A;  4XT8 A;  1DR7 A;  5U26 A;  3N0H A;  2W3A A;  3IA4 A;  4LAG X;  1CD2 A;  3JW3 A;  1M78 A;  2ZZA A;  4RGC A;  5JG0 X;  2L28 A;  3FL8 A;  3K47 A;  3TQ8 A;  4OSG A;  1S3Y A;  1DHF A;  3FRA X;  2BL9 A;  3RG9 A;  2W9T A;  3K74 A;  3NXO A;  3QFX A;  4KBN A;  1M79 A;  1RX5 A;  3GHW A;  1RX3 A;  3S7A A;  3QLX A;  3FY8 X;  5HSR A;  2FZI A;  3CD2 A;  1QZF A;  3ZPC A;  1DIU A;  3JWF A;  3FYV X;  3FL9 A;  4DPD A;  3QG2 A;  4PDJ A;  3Q1H A;  3JW5 A;  4M7U A;  3SA1 A;  2W3V A;  4DPH A;  3OAF A;  2W3M A;  2OBC A;  3UM8 A;  1IA3 A;  3NZD A;  3NU0 A;  3SRQ X;  1HFQ A;  4KM2 A;  1RD7 A;  3K45 A;  1DYR A;  4PTH A;  1HFP A;  1VJ3 A;  4P68 A;  3DG8 A;  4KD7 A;  1DAJ A;  1ZDR A;  1U70 A;  1E26 A;  1RX4 A;  4KL9 A;  4XT4 A;  4LAH X;  2H2Q A;  3M09 A;  4DP3 A;  4KJK A;  2XW7 A;  3FQO A;  2W9H A;  1CZ3 A;  5HF0 X;  3DRC A;  4IXE D;  3EEJ A;  1J3I A;  3QLS A;  3NXR A;  4QHV A;  4X5I A;  2OIP A;  1DG7 A;  3EIG A;  4FHB A;  4G3M A;  3NXX A;  1J3J A;  1D1G A;  3DAU A;  3INV A;  1DYJ A;  1TDR A;  4PST A;  4X5H A;  4I1N A;  3F0Q X;  2KGK A;  5HVE A;  1DRE A;  3FQV A;  1DRF A;  1VDR A;  3R33 A;  3QL3 A;  5ECC A;  4XT5 A;  3CLB A;  3KJR A;  4XRB A;  3F91 A;  2W9S A;  5FDA A;  3TD8 A;  3TQA A;  3F0V X;  1J3K A;  3VCO A;  1DYI A;  4X5F A;  4M6K A;  1S3U A;  3DL5 A;  3SRU X;  3JTW A;  4EIZ A;  2D0K A;  4GH8 A;  5DFR A;  4KAK A;  3I8A X;  3NRR A;  3NXT A;  1OHK A;  3S3V A;  4M2X A;  1DRB A;  4QI9 A;  3NTZ A;  3NZC X;  3D80 A;  3QLW A;  4QLF A;  3M08 A;  2HM9 A;  3SRW X;  4ELE A;  1DHJ A;  2ANO A;  2QK8 A;  3IX9 A;  4XT6 A;  3FYW X;  1PD8 A;  3OCH A;  1DYH A;  1DG8 A;  4EIG A;  4PTJ A;  4PSS A;  3EX8 A;  3FRD X;  4TU5 X;  3S9U A;  3FY9 X;  4KEB A;  3FQ0 A;  3GHC A;  5ECX A;  3E0B A;  3F0S X;  3GI2 A;  3NZ6 X;  4H95 A;  4P3R A;  3CSE A;  5HF2 X;  3F0B X;  5HI6 A;  1JUV A;  3DAT A;  4IXF X;  1RE7 A;  3K2H A;  3KGY A;  3FQC A;  1RA1 A;  4HA9 A;  1RC4 A;  1BZF A;  1AO8 A;  1DLS A;  3F0X X;  2C2T A;  3QYO A;  1LUD A;  2AZN A;  4ELH A;  1DRA A;  3SH2 A;  3JWM A;  3NZA X;  4M6L A;  4CD2 A;  4LAE X;  2B3Z A;  5HVB A;  3QLR A;  1RA8 A;  1RX7 A;  1YHO A;  2ITH A;  4HOE A;  2BLB A;  3CL9 A;  3NZ9 X;  1PDB A;  4KY4 A;  3TQB A;  3IA5 A;  3FRB X;  3QGT A;  1AI9 A;  3KY8 A;  3I3R A;  1DHI A;  4LEK X;  8DFR A;  4Q6A A;  1JOL A;  3QLY A;  1JOM A;  3DFR A;  4KJL A;  1KMV A;  1DDS A; 
#chains in the Genus database with same CATH topology
 1MVS A;  1IA1 A;  3EEK A;  4HA7 A;  5CCC A;  2CIG A;  1DRH A;  4EIL A;  4ELF A;  3FQZ A;  1DR5 A;  3JWK A;  1RX6 A;  3ZPG A;  3F8Z A;  4XEC X;  1U71 A;  4QLE A;  4NX6 A;  4Q67 A;  1DF7 A;  2HQP A;  1DIS A;  4HOF A;  1LY4 A;  4XT7 A;  1HFR A;  3QL0 A;  6DFR A;  4X5J A;  5HT5 A;  2FZH A;  5U27 A;  3D84 X;  4H97 A;  2BLC A;  5HSU A;  3F0U X;  1RX9 A;  1DR1 A;  1IA4 A;  3SAI A;  4KNE A;  1DR6 A;  3TQ9 A;  4DFR A;  1U72 A;  5HT4 A;  3EEM A;  3HBB A;  3QLZ A;  4KYA A;  2HXV A;  3JWC A;  5CC9 A;  1LY3 A;  2DHF A;  2O7P A;  3GHV A;  3SGY A;  1DR4 A;  4P3Q A;  7DFR A;  1DLR A;  4ECK A;  3NXY A;  2BLA A;  3DGA A;  3NXV A;  2C2S A;  4Q0D A;  1RB2 A;  3SA2 A;  3KJS A;  1RA9 A;  1KLK A;  2FZJ A;  5HPB A;  2P4G A;  4Q0E A;  2INQ A;  2W9G A;  4M6J A;  2GD9 A;  3SRS X;  1RG7 A;  3FQF A;  1DR3 A;  4ELG A;  1RX2 A;  3UM5 A;  4QJC A;  4HOG A;  3IRN A;  4G8Z X;  3DL6 A;  1DR2 A;  3JVX A;  4KY8 A;  4G95 A;  4I13 A;  1AOE A;  4DDR A;  5EAJ A;  1PD9 A;  1BOZ A;  4X5G A;  5HQZ A;  5HUI A;  1IA2 A;  2D5N A;  2W3W A;  3QYL A;  1S3W A;  4KJJ A;  3SR5 X;  3LG4 A;  4OR7 A;  4PSY A;  2DRC A;  4FGG A;  4ELB A;  1M7A A;  1RX1 A;  5DXV A;  3L3R A;  3F8Y A;  4P66 A;  3ROA A;  3FS6 A;  3EEL A;  1RH3 A;  3SQY X;  1RA2 A;  3IRO A;  4H96 A;  4EJ1 A;  1OHJ A;  3FRF X;  3SRR X;  2LF1 A;  1RB3 A;  1SEJ A;  3RO9 A;  4M7V A;  1MVT A;  5JA3 A;  4XE6 X;  2G6V A;  2W3B A;  5HQY A;  3KFY A;  1RF7 A;  4KM0 A;  4IXG X;  3JSU A;  4QLG A;  3NZB X;  1KMS A;  1RX8 A;  4QJZ D;  1S3V A;  3UM6 A;  4NX7 A;  3HJ3 A;  3GYF A;  4KFJ A;  4H98 A;  1DDR A;  2CD2 A;  3IRM A;  4FGH A;  3FRE X;  2JYB A;  2ANQ A;  4KLX A;  5E8Q A;  1DG5 A;  1RA3 A;  4XT8 A;  1DR7 A;  5U26 A;  3N0H A;  2W3A A;  3IA4 A;  4LAG X;  1CD2 A;  3JW3 A;  1M78 A;  2ZZA A;  4RGC A;  5JG0 X;  2L28 A;  3FL8 A;  3K47 A;  3TQ8 A;  4OSG A;  1S3Y A;  1DHF A;  3FRA X;  2BL9 A;  3RG9 A;  2W9T A;  3K74 A;  3NXO A;  3QFX A;  4KBN A;  1M79 A;  1RX5 A;  3GHW A;  1RX3 A;  3S7A A;  3QLX A;  3FY8 X;  5HSR A;  2FZI A;  3CD2 A;  1QZF A;  3ZPC A;  1DIU A;  3JWF A;  3FYV X;  3FL9 A;  4DPD A;  3QG2 A;  4PDJ A;  3Q1H A;  3JW5 A;  4M7U A;  3SA1 A;  2W3V A;  4DPH A;  3OAF A;  2W3M A;  2OBC A;  3UM8 A;  1IA3 A;  3NZD A;  3NU0 A;  3SRQ X;  1HFQ A;  4KM2 A;  1RD7 A;  3K45 A;  1DYR A;  4PTH A;  1HFP A;  1VJ3 A;  4P68 A;  3DG8 A;  4KD7 A;  1DAJ A;  1ZDR A;  1U70 A;  1E26 A;  1RX4 A;  4KL9 A;  4XT4 A;  4LAH X;  2H2Q A;  3M09 A;  4DP3 A;  4KJK A;  2XW7 A;  3FQO A;  2W9H A;  1CZ3 A;  5HF0 X;  3DRC A;  4IXE D;  3EEJ A;  1J3I A;  3QLS A;  3NXR A;  4QHV A;  4X5I A;  2OIP A;  1DG7 A;  3EIG A;  4FHB A;  4G3M A;  3NXX A;  1J3J A;  1D1G A;  3DAU A;  3INV A;  1DYJ A;  1TDR A;  4PST A;  4X5H A;  4I1N A;  3F0Q X;  2KGK A;  5HVE A;  1DRE A;  3FQV A;  1DRF A;  1VDR A;  3R33 A;  3QL3 A;  5ECC A;  4XT5 A;  3CLB A;  3KJR A;  4XRB A;  3F91 A;  2W9S A;  5FDA A;  3TD8 A;  3TQA A;  3F0V X;  1J3K A;  3VCO A;  1DYI A;  4X5F A;  4M6K A;  1S3U A;  3DL5 A;  3SRU X;  3JTW A;  4EIZ A;  2D0K A;  4GH8 A;  5DFR A;  4KAK A;  3I8A X;  3NRR A;  3NXT A;  1OHK A;  3S3V A;  4M2X A;  1DRB A;  4QI9 A;  3NTZ A;  3NZC X;  3D80 A;  3QLW A;  4QLF A;  3M08 A;  2HM9 A;  3SRW X;  4ELE A;  1DHJ A;  2ANO A;  2QK8 A;  3IX9 A;  4XT6 A;  3FYW X;  1PD8 A;  3OCH A;  1DYH A;  1DG8 A;  4EIG A;  4PTJ A;  4PSS A;  3EX8 A;  3FRD X;  4TU5 X;  3S9U A;  3FY9 X;  4KEB A;  3FQ0 A;  3GHC A;  5ECX A;  3E0B A;  3F0S X;  3GI2 A;  3NZ6 X;  4H95 A;  4P3R A;  3CSE A;  5HF2 X;  3F0B X;  5HI6 A;  1JUV A;  3DAT A;  4IXF X;  1RE7 A;  3K2H A;  3KGY A;  3FQC A;  1RA1 A;  4HA9 A;  1RC4 A;  1BZF A;  1AO8 A;  1DLS A;  3F0X X;  2C2T A;  3QYO A;  1LUD A;  2AZN A;  4ELH A;  1DRA A;  3SH2 A;  3JWM A;  3NZA X;  4M6L A;  4CD2 A;  4LAE X;  2B3Z A;  5HVB A;  3QLR A;  1RA8 A;  1RX7 A;  1YHO A;  2ITH A;  4HOE A;  2BLB A;  3CL9 A;  3NZ9 X;  1PDB A;  4KY4 A;  3TQB A;  3IA5 A;  3FRB X;  3QGT A;  1AI9 A;  3KY8 A;  3I3R A;  1DHI A;  4LEK X;  8DFR A;  4Q6A A;  1JOL A;  3QLY A;  1JOM A;  3DFR A;  4KJL A;  1KMV A;  1DDS A; 
#chains in the Genus database with same CATH homology
 1MVS A;  1IA1 A;  3EEK A;  4HA7 A;  5CCC A;  2CIG A;  1DRH A;  4EIL A;  4ELF A;  3FQZ A;  1DR5 A;  3JWK A;  1RX6 A;  3ZPG A;  3F8Z A;  4XEC X;  1U71 A;  4QLE A;  4NX6 A;  4Q67 A;  1DF7 A;  2HQP A;  1DIS A;  4HOF A;  1LY4 A;  4XT7 A;  1HFR A;  3QL0 A;  6DFR A;  4X5J A;  5HT5 A;  2FZH A;  5U27 A;  3D84 X;  4H97 A;  2BLC A;  5HSU A;  3F0U X;  1RX9 A;  1DR1 A;  1IA4 A;  3SAI A;  4KNE A;  1DR6 A;  3TQ9 A;  4DFR A;  1U72 A;  5HT4 A;  3EEM A;  3HBB A;  3QLZ A;  4KYA A;  2HXV A;  3JWC A;  5CC9 A;  1LY3 A;  2DHF A;  2O7P A;  3GHV A;  3SGY A;  1DR4 A;  4P3Q A;  7DFR A;  1DLR A;  4ECK A;  3NXY A;  2BLA A;  3DGA A;  3NXV A;  2C2S A;  4Q0D A;  1RB2 A;  3SA2 A;  3KJS A;  1RA9 A;  1KLK A;  2FZJ A;  5HPB A;  2P4G A;  4Q0E A;  2INQ A;  2W9G A;  4M6J A;  2GD9 A;  3SRS X;  1RG7 A;  3FQF A;  1DR3 A;  4ELG A;  1RX2 A;  3UM5 A;  4QJC A;  4HOG A;  3IRN A;  4G8Z X;  3DL6 A;  1DR2 A;  3JVX A;  4KY8 A;  4G95 A;  4I13 A;  1AOE A;  4DDR A;  5EAJ A;  1PD9 A;  1BOZ A;  4X5G A;  5HQZ A;  5HUI A;  1IA2 A;  2D5N A;  2W3W A;  3QYL A;  1S3W A;  4KJJ A;  3SR5 X;  3LG4 A;  4OR7 A;  4PSY A;  2DRC A;  4FGG A;  4ELB A;  1M7A A;  1RX1 A;  5DXV A;  3L3R A;  3F8Y A;  4P66 A;  3ROA A;  3FS6 A;  3EEL A;  1RH3 A;  3SQY X;  1RA2 A;  3IRO A;  4H96 A;  4EJ1 A;  1OHJ A;  3FRF X;  3SRR X;  2LF1 A;  1RB3 A;  1SEJ A;  3RO9 A;  4M7V A;  1MVT A;  5JA3 A;  4XE6 X;  2G6V A;  2W3B A;  5HQY A;  3KFY A;  1RF7 A;  4KM0 A;  4IXG X;  3JSU A;  4QLG A;  3NZB X;  1KMS A;  1RX8 A;  4QJZ D;  1S3V A;  3UM6 A;  4NX7 A;  3HJ3 A;  3GYF A;  4KFJ A;  4H98 A;  1DDR A;  2CD2 A;  3IRM A;  4FGH A;  3FRE X;  2JYB A;  2ANQ A;  4KLX A;  5E8Q A;  1DG5 A;  1RA3 A;  4XT8 A;  1DR7 A;  5U26 A;  3N0H A;  2W3A A;  3IA4 A;  4LAG X;  1CD2 A;  3JW3 A;  1M78 A;  2ZZA A;  4RGC A;  5JG0 X;  2L28 A;  3FL8 A;  3K47 A;  3TQ8 A;  4OSG A;  1S3Y A;  1DHF A;  3FRA X;  2BL9 A;  3RG9 A;  2W9T A;  3K74 A;  3NXO A;  3QFX A;  4KBN A;  1M79 A;  1RX5 A;  3GHW A;  1RX3 A;  3S7A A;  3QLX A;  3FY8 X;  5HSR A;  2FZI A;  3CD2 A;  1QZF A;  3ZPC A;  1DIU A;  3JWF A;  3FYV X;  3FL9 A;  4DPD A;  3QG2 A;  4PDJ A;  3Q1H A;  3JW5 A;  4M7U A;  3SA1 A;  2W3V A;  4DPH A;  3OAF A;  2W3M A;  2OBC A;  3UM8 A;  1IA3 A;  3NZD A;  3NU0 A;  3SRQ X;  1HFQ A;  4KM2 A;  1RD7 A;  3K45 A;  1DYR A;  4PTH A;  1HFP A;  1VJ3 A;  4P68 A;  3DG8 A;  4KD7 A;  1DAJ A;  1ZDR A;  1U70 A;  1E26 A;  1RX4 A;  4KL9 A;  4XT4 A;  4LAH X;  2H2Q A;  3M09 A;  4DP3 A;  4KJK A;  2XW7 A;  3FQO A;  2W9H A;  1CZ3 A;  5HF0 X;  3DRC A;  4IXE D;  3EEJ A;  1J3I A;  3QLS A;  3NXR A;  4QHV A;  4X5I A;  2OIP A;  1DG7 A;  3EIG A;  4FHB A;  4G3M A;  3NXX A;  1J3J A;  1D1G A;  3DAU A;  3INV A;  1DYJ A;  1TDR A;  4PST A;  4X5H A;  4I1N A;  3F0Q X;  2KGK A;  5HVE A;  1DRE A;  3FQV A;  1DRF A;  1VDR A;  3R33 A;  3QL3 A;  5ECC A;  4XT5 A;  3CLB A;  3KJR A;  4XRB A;  3F91 A;  2W9S A;  5FDA A;  3TD8 A;  3TQA A;  3F0V X;  1J3K A;  3VCO A;  1DYI A;  4X5F A;  4M6K A;  1S3U A;  3DL5 A;  3SRU X;  3JTW A;  4EIZ A;  2D0K A;  4GH8 A;  5DFR A;  4KAK A;  3I8A X;  3NRR A;  3NXT A;  1OHK A;  3S3V A;  4M2X A;  1DRB A;  4QI9 A;  3NTZ A;  3NZC X;  3D80 A;  3QLW A;  4QLF A;  3M08 A;  2HM9 A;  3SRW X;  4ELE A;  1DHJ A;  2ANO A;  2QK8 A;  3IX9 A;  4XT6 A;  3FYW X;  1PD8 A;  3OCH A;  1DYH A;  1DG8 A;  4EIG A;  4PTJ A;  4PSS A;  3EX8 A;  3FRD X;  4TU5 X;  3S9U A;  3FY9 X;  4KEB A;  3FQ0 A;  3GHC A;  5ECX A;  3E0B A;  3F0S X;  3GI2 A;  3NZ6 X;  4H95 A;  4P3R A;  3CSE A;  5HF2 X;  3F0B X;  5HI6 A;  1JUV A;  3DAT A;  4IXF X;  1RE7 A;  3K2H A;  3KGY A;  3FQC A;  1RA1 A;  4HA9 A;  1RC4 A;  1BZF A;  1AO8 A;  1DLS A;  3F0X X;  2C2T A;  3QYO A;  1LUD A;  2AZN A;  4ELH A;  1DRA A;  3SH2 A;  3JWM A;  3NZA X;  4M6L A;  4CD2 A;  4LAE X;  2B3Z A;  5HVB A;  3QLR A;  1RA8 A;  1RX7 A;  1YHO A;  2ITH A;  4HOE A;  2BLB A;  3CL9 A;  3NZ9 X;  1PDB A;  4KY4 A;  3TQB A;  3IA5 A;  3FRB X;  3QGT A;  1AI9 A;  3KY8 A;  3I3R A;  1DHI A;  4LEK X;  8DFR A;  4Q6A A;  1JOL A;  3QLY A;  1JOM A;  3DFR A;  4KJL A;  1KMV A;  1DDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...