1AO8A

Dihydrofolate reductase complexed with methotrexate, nmr, 21 structures
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
162
structure length
162
Chain Sequence
TAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTNVVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLAGSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the complex of Lactobacillus casei dihydrofolate reductase with methotrexate.
pubmed doi rcsb
molecule keywords DIHYDROFOLATE REDUCTASE
molecule tags Oxidoreductase
source organism Lactobacillus casei
total genus 30
structure length 162
sequence length 162
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 1997-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 1ao8A00
2FZIA 2HXVA 4PSSA 8DFRA 3ZPGA 4P3RA 1RA3A 4XECX 1M79A 3FYWX 3EEKA 4ELGA 4XT5A 4IXGX 4EJ1A 4RGCA 1DLRA 1DR5A 4P3QA 1S3WA 4FGGA 3RO9A 1S3YA 3F0VX 1RX9A 1DG8A 3F0XX 3DFRA 4ELFA 4P68A 4KYAA 3Q1HA 1DYHA 3FS6A 3FQZA 1HFPA 3FQOA 4QJCA 4ELEA 4NX7A 2DHFA 2XW7A 4H95A 3GYFA 3SRUX 4EILA 1AI9A 1DISA 3CLBA 5CCCA 3M08A 3INVA 3M09A 4KL9A 1LY3A 3JW3A 1RX1A 5E8QA 3SH2A 1U72A 4EIZA 3DGAA 3IRNA 4KFJA 2W3VA 3DRCA 4XT6A 1S3VA 7DFRA 3D80A 4LAEX 2W3AA 5HVBA 3NZDA 1CZ3A 3FQCA 3FREX 3QLWA 1RD7A 4KJJA 3TQ9A 1U71A 4H97A 3QL3A 4M7VA 4KLXA 3ZPCA 4G95A 3F8YA 3QLSA 4XT8A 2D5NA 5EAJA 3RG9A 4DP3A 1DR2A 1DRBA 2GD9A 1PDBA 4H96A 3CSEA 3KJSA 1MVSA 4X5GA 4M6JA 3QL0A 5ECXA 5DXVA 5HUIA 2O7PA 4KJLA 3QYLA 4ELBA 3NZBX 4HA7A 3NTZA 1RX5A 3L3RA 2ANQA 4OR7A 4OSGA 4PSYA 3E0BA 4ELHA 4EIGA 3FYVX 3JVXA 2OIPA 5DFRA 4PDJA 1DR6A 2LF1A 5HSRA 3GHWA 1AOEA 1RG7A 4M2XA 4QLEA 2W3BA 1DDSA 3NZAX 5HI6A 1BOZA 1DYRA 1RX6A 1M7AA 3ROAA 3VCOA 2C2TA 3KGYA 3KJRA 4Q0DA 2ANOA 4QHVA 3TQ8A 4KM2A 4PSTA 1DYJA 3FQFA 5CC9A 5JA3A 5U26A 3JW5A 5HT4A 3DATA 5HF0X 3QLXA 3UM8A 5HPBA 2G6VA 4Q6AA 4KNEA 4G3MA 1DF7A 3R33A 3JWKA 2CIGA 2BLAA 1DYIA 4IXED 1JUVA 1YHOA 3HJ3A 1S3UA 2KGKA 1DR1A 3NZ9X 3JWMA 3SR5X 3NXOA 3EX8A 3SAIA 3NXVA 3F0UX 1KMVA 3DL6A 3F8ZA 3DAUA 2B3ZA 3K2HA 5JG0X 2W9HA 2QK8A 1J3IA 1RH3A 4FGHA 3K74A 3GHCA 3N0HA 1DIUA 1RA8A 3K47A 1VJ3A 3NRRA 2CD2A 4HOFA 4Q0EA 1JOLA 4PTHA 1DRHA 3FRFX 4G8ZX 1TDRA 1RF7A 1PD9A 1RE7A 4KD7A 4M6KA 1IA2A 1DR4A 2INQA 2W3WA 4X5JA 1RX8A 4FHBA 4KJKA 1VDRA 1BZFA 3S9UA 1KMSA 1RX4A 3QLYA 4DPDA 2JYBA 4XT7A 6DFRA 1JOMA 1DRFA 2W9SA 3IROA 3CD2A 4Q67A 3SA2A 1SEJA 1QZFA 4KAKA 4HOEA 5ECCA 1HFQA 1U70A 3FY8X 3OCHA 3SRRX 3S3VA 5HSUA 4KM0A 3IRMA 4KY8A 3NZCX 3SA1A 1D1GA 2ZZAA 3HBBA 3NZ6X 3JWCA 3NXXA 2BLCA 4TU5X 3UM6A 4P66A 3JTWA 2W3MA 4PTJA 1RB3A 3FQVA 2ITHA 4IXFX 5HVEA 1DR7A 3D84X 3I3RA 2H2QA 2C2SA 3JSUA 3QFXA 4XRBA 3IX9A 1DR3A 1MVTA 3IA4A 4X5FA 2OBCA 1OHJA 3IA5A 4HA9A 1DDRA 1HFRA 1LY4A 2HQPA 3OAFA 3S7AA 2D0KA 3F0QX 2AZNA 3EEJA 1OHKA 4M6LA 3QLRA 1DG5A 2FZJA 3FL8A 3TQBA 4DDRA 3FRDX 3QGTA 4HOGA 3UM5A 1DLSA 1DG7A 3NXYA 4QLFA 4KY4A 4KBNA 1LUDA 2L28A 4I13A 1DAJA 2DRCA 3GHVA 4GH8A 5FDAA 2W9TA 1AO8A 4M7UA 3K45A 1IA1A 2BLBA 1IA4A 1RA2A 1RX3A 2W9GA 4DPHA 4X5HA 1J3JA 4LAGX 3FY9X 3SQYX 5HF2X 3EELA 3SRSX 4KEBA 4CD2A 3F91A 3FL9A 3SRWX 5HQYA 3CL9A 4XT4A 1DHJA 3KFYA 3QYOA 3FRBX 4QI9A 1DREA 4H98A 1J3KA 5U27A 3SGYA 1DHIA 3SRQX 2BL9A 1E26A 3I8AX 3F0SX 3EIGA 4LEKX 4QLGA 1KLKA 3DL5A 3EEMA 3FRAX 4ECKA 3JWFA 3FQ0A 4XE6X 5HQZA 3QLZA 4LAHX 2HM9A 3NXTA 3KY8A 1RB2A 1ZDRA 1RA1A 3NXRA 1DHFA 1M78A 1RC4A 4I1NA 2P4GA 3LG4A 3TQAA 1CD2A 1RX2A 4X5IA 3TD8A 3F0BX 1PD8A 3DG8A 1RX7A 4DFRA 4NX6A 5HT5A 3NU0A 3GI2A 3QG2A 1RA9A 4QJZD 1IA3A 2FZHA 1DRAA
chains in the Genus database with same CATH superfamily
2FZIA 2HXVA 4PSSA 8DFRA 3ZPGA 4P3RA 1RA3A 4XECX 1M79A 3FYWX 3EEKA 4ELGA 4XT5A 4IXGX 4EJ1A 4RGCA 1DLRA 1DR5A 4P3QA 1S3WA 4FGGA 3RO9A 1S3YA 3F0VX 1RX9A 1DG8A 3F0XX 3DFRA 4ELFA 4P68A 4KYAA 3Q1HA 1DYHA 3FS6A 3FQZA 1HFPA 3FQOA 4QJCA 4ELEA 4NX7A 2DHFA 2XW7A 4H95A 3GYFA 3SRUX 4EILA 1AI9A 1DISA 3CLBA 5CCCA 3M08A 3INVA 3M09A 4KL9A 1LY3A 3JW3A 1RX1A 5E8QA 3SH2A 1U72A 4EIZA 3DGAA 3IRNA 4KFJA 2W3VA 3DRCA 4XT6A 1S3VA 7DFRA 3D80A 4LAEX 2W3AA 5HVBA 3NZDA 1CZ3A 3FQCA 3FREX 3QLWA 1RD7A 4KJJA 3TQ9A 1U71A 4H97A 3QL3A 4M7VA 4KLXA 3ZPCA 4G95A 3F8YA 3QLSA 4XT8A 2D5NA 5EAJA 3RG9A 4DP3A 1DR2A 1DRBA 2GD9A 1PDBA 4H96A 3CSEA 3KJSA 1MVSA 4X5GA 4M6JA 3QL0A 5ECXA 5DXVA 5HUIA 2O7PA 4KJLA 3QYLA 4ELBA 3NZBX 4HA7A 3NTZA 1RX5A 3L3RA 2ANQA 4OR7A 4OSGA 4PSYA 3E0BA 4ELHA 4EIGA 3FYVX 3JVXA 2OIPA 5DFRA 4PDJA 1DR6A 2LF1A 5HSRA 3GHWA 1AOEA 1RG7A 4M2XA 4QLEA 2W3BA 1DDSA 3NZAX 5HI6A 1BOZA 1DYRA 1RX6A 1M7AA 3ROAA 3VCOA 2C2TA 3KGYA 3KJRA 4Q0DA 2ANOA 4QHVA 3TQ8A 4KM2A 4PSTA 1DYJA 3FQFA 5CC9A 5JA3A 5U26A 3JW5A 5HT4A 3DATA 5HF0X 3QLXA 3UM8A 5HPBA 2G6VA 4Q6AA 4KNEA 4G3MA 1DF7A 3R33A 3JWKA 2CIGA 2BLAA 1DYIA 4IXED 1JUVA 1YHOA 3HJ3A 1S3UA 2KGKA 1DR1A 3NZ9X 3JWMA 3SR5X 3NXOA 3EX8A 3SAIA 3NXVA 3F0UX 1KMVA 3DL6A 3F8ZA 3DAUA 2B3ZA 3K2HA 5JG0X 2W9HA 2QK8A 1J3IA 1RH3A 4FGHA 3K74A 3GHCA 3N0HA 1DIUA 1RA8A 3K47A 1VJ3A 3NRRA 2CD2A 4HOFA 4Q0EA 1JOLA 4PTHA 1DRHA 3FRFX 4G8ZX 1TDRA 1RF7A 1PD9A 1RE7A 4KD7A 4M6KA 1IA2A 1DR4A 2INQA 2W3WA 4X5JA 1RX8A 4FHBA 4KJKA 1VDRA 1BZFA 3S9UA 1KMSA 1RX4A 3QLYA 4DPDA 2JYBA 4XT7A 6DFRA 1JOMA 1DRFA 2W9SA 3IROA 3CD2A 4Q67A 3SA2A 1SEJA 1QZFA 4KAKA 4HOEA 5ECCA 1HFQA 1U70A 3FY8X 3OCHA 3SRRX 3S3VA 5HSUA 4KM0A 3IRMA 4KY8A 3NZCX 3SA1A 1D1GA 2ZZAA 3HBBA 3NZ6X 3JWCA 3NXXA 2BLCA 4TU5X 3UM6A 4P66A 3JTWA 2W3MA 4PTJA 1RB3A 3FQVA 2ITHA 4IXFX 5HVEA 1DR7A 3D84X 3I3RA 2H2QA 2C2SA 3JSUA 3QFXA 4XRBA 3IX9A 1DR3A 1MVTA 3IA4A 4X5FA 2OBCA 1OHJA 3IA5A 4HA9A 1DDRA 1HFRA 1LY4A 2HQPA 3OAFA 3S7AA 2D0KA 3F0QX 2AZNA 3EEJA 1OHKA 4M6LA 3QLRA 1DG5A 2FZJA 3FL8A 3TQBA 4DDRA 3FRDX 3QGTA 4HOGA 3UM5A 1DLSA 1DG7A 3NXYA 4QLFA 4KY4A 4KBNA 1LUDA 2L28A 4I13A 1DAJA 2DRCA 3GHVA 4GH8A 5FDAA 2W9TA 1AO8A 4M7UA 3K45A 1IA1A 2BLBA 1IA4A 1RA2A 1RX3A 2W9GA 4DPHA 4X5HA 1J3JA 4LAGX 3FY9X 3SQYX 5HF2X 3EELA 3SRSX 4KEBA 4CD2A 3F91A 3FL9A 3SRWX 5HQYA 3CL9A 4XT4A 1DHJA 3KFYA 3QYOA 3FRBX 4QI9A 1DREA 4H98A 1J3KA 5U27A 3SGYA 1DHIA 3SRQX 2BL9A 1E26A 3I8AX 3F0SX 3EIGA 4LEKX 4QLGA 1KLKA 3DL5A 3EEMA 3FRAX 4ECKA 3JWFA 3FQ0A 4XE6X 5HQZA 3QLZA 4LAHX 2HM9A 3NXTA 3KY8A 1RB2A 1ZDRA 1RA1A 3NXRA 1DHFA 1M78A 1RC4A 4I1NA 2P4GA 3LG4A 3TQAA 1CD2A 1RX2A 4X5IA 3TD8A 3F0BX 1PD8A 3DG8A 1RX7A 4DFRA 4NX6A 5HT5A 3NU0A 3GI2A 3QG2A 1RA9A 4QJZD 1IA3A 2FZHA 1DRAA
chains in the Genus database with same CATH topology
2FZIA 2HXVA 4PSSA 8DFRA 3ZPGA 4P3RA 1RA3A 4XECX 1M79A 3FYWX 3EEKA 4ELGA 4XT5A 4IXGX 4EJ1A 4RGCA 1DLRA 1DR5A 4P3QA 1S3WA 4FGGA 3RO9A 1S3YA 3F0VX 1RX9A 1DG8A 3F0XX 3DFRA 4ELFA 4P68A 4KYAA 3Q1HA 1DYHA 3FS6A 3FQZA 1HFPA 3FQOA 4QJCA 4ELEA 4NX7A 2DHFA 2XW7A 4H95A 3GYFA 3SRUX 4EILA 1AI9A 1DISA 3CLBA 5CCCA 3M08A 3INVA 3M09A 4KL9A 1LY3A 3JW3A 1RX1A 5E8QA 3SH2A 1U72A 4EIZA 3DGAA 3IRNA 4KFJA 2W3VA 3DRCA 4XT6A 1S3VA 7DFRA 3D80A 4LAEX 2W3AA 5HVBA 3NZDA 1CZ3A 3FQCA 3FREX 3QLWA 1RD7A 4KJJA 3TQ9A 1U71A 4H97A 3QL3A 4M7VA 4KLXA 3ZPCA 4G95A 3F8YA 3QLSA 4XT8A 2D5NA 5EAJA 3RG9A 4DP3A 1DR2A 1DRBA 2GD9A 1PDBA 4H96A 3CSEA 3KJSA 1MVSA 4X5GA 4M6JA 3QL0A 5ECXA 5DXVA 5HUIA 2O7PA 4KJLA 3QYLA 4ELBA 3NZBX 4HA7A 3NTZA 1RX5A 3L3RA 2ANQA 4OR7A 4OSGA 4PSYA 3E0BA 4ELHA 4EIGA 3FYVX 3JVXA 2OIPA 5DFRA 4PDJA 1DR6A 2LF1A 5HSRA 3GHWA 1AOEA 1RG7A 4M2XA 4QLEA 2W3BA 1DDSA 3NZAX 5HI6A 1BOZA 1DYRA 1RX6A 1M7AA 3ROAA 3VCOA 2C2TA 3KGYA 3KJRA 4Q0DA 2ANOA 4QHVA 3TQ8A 4KM2A 4PSTA 1DYJA 3FQFA 5CC9A 5JA3A 5U26A 3JW5A 5HT4A 3DATA 5HF0X 3QLXA 3UM8A 5HPBA 2G6VA 4Q6AA 4KNEA 4G3MA 1DF7A 3R33A 3JWKA 2CIGA 2BLAA 1DYIA 4IXED 1JUVA 1YHOA 3HJ3A 1S3UA 2KGKA 1DR1A 3NZ9X 3JWMA 3SR5X 3NXOA 3EX8A 3SAIA 3NXVA 3F0UX 1KMVA 3DL6A 3F8ZA 3DAUA 2B3ZA 3K2HA 5JG0X 2W9HA 2QK8A 1J3IA 1RH3A 4FGHA 3K74A 3GHCA 3N0HA 1DIUA 1RA8A 3K47A 1VJ3A 3NRRA 2CD2A 4HOFA 4Q0EA 1JOLA 4PTHA 1DRHA 3FRFX 4G8ZX 1TDRA 1RF7A 1PD9A 1RE7A 4KD7A 4M6KA 1IA2A 1DR4A 2INQA 2W3WA 4X5JA 1RX8A 4FHBA 4KJKA 1VDRA 1BZFA 3S9UA 1KMSA 1RX4A 3QLYA 4DPDA 2JYBA 4XT7A 6DFRA 1JOMA 1DRFA 2W9SA 3IROA 3CD2A 4Q67A 3SA2A 1SEJA 1QZFA 4KAKA 4HOEA 5ECCA 1HFQA 1U70A 3FY8X 3OCHA 3SRRX 3S3VA 5HSUA 4KM0A 3IRMA 4KY8A 3NZCX 3SA1A 1D1GA 2ZZAA 3HBBA 3NZ6X 3JWCA 3NXXA 2BLCA 4TU5X 3UM6A 4P66A 3JTWA 2W3MA 4PTJA 1RB3A 3FQVA 2ITHA 4IXFX 5HVEA 1DR7A 3D84X 3I3RA 2H2QA 2C2SA 3JSUA 3QFXA 4XRBA 3IX9A 1DR3A 1MVTA 3IA4A 4X5FA 2OBCA 1OHJA 3IA5A 4HA9A 1DDRA 1HFRA 1LY4A 2HQPA 3OAFA 3S7AA 2D0KA 3F0QX 2AZNA 3EEJA 1OHKA 4M6LA 3QLRA 1DG5A 2FZJA 3FL8A 3TQBA 4DDRA 3FRDX 3QGTA 4HOGA 3UM5A 1DLSA 1DG7A 3NXYA 4QLFA 4KY4A 4KBNA 1LUDA 2L28A 4I13A 1DAJA 2DRCA 3GHVA 4GH8A 5FDAA 2W9TA 1AO8A 4M7UA 3K45A 1IA1A 2BLBA 1IA4A 1RA2A 1RX3A 2W9GA 4DPHA 4X5HA 1J3JA 4LAGX 3FY9X 3SQYX 5HF2X 3EELA 3SRSX 4KEBA 4CD2A 3F91A 3FL9A 3SRWX 5HQYA 3CL9A 4XT4A 1DHJA 3KFYA 3QYOA 3FRBX 4QI9A 1DREA 4H98A 1J3KA 5U27A 3SGYA 1DHIA 3SRQX 2BL9A 1E26A 3I8AX 3F0SX 3EIGA 4LEKX 4QLGA 1KLKA 3DL5A 3EEMA 3FRAX 4ECKA 3JWFA 3FQ0A 4XE6X 5HQZA 3QLZA 4LAHX 2HM9A 3NXTA 3KY8A 1RB2A 1ZDRA 1RA1A 3NXRA 1DHFA 1M78A 1RC4A 4I1NA 2P4GA 3LG4A 3TQAA 1CD2A 1RX2A 4X5IA 3TD8A 3F0BX 1PD8A 3DG8A 1RX7A 4DFRA 4NX6A 5HT5A 3NU0A 3GI2A 3QG2A 1RA9A 4QJZD 1IA3A 2FZHA 1DRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FZI A;  2HXV A;  4PSS A;  8DFR A;  3ZPG A;  4P3R A;  1RA3 A;  4XEC X;  1M79 A;  3FYW X;  3EEK A;  4ELG A;  4XT5 A;  4IXG X;  4EJ1 A;  4RGC A;  1DLR A;  1DR5 A;  4P3Q A;  1S3W A;  4FGG A;  3RO9 A;  1S3Y A;  3F0V X;  1RX9 A;  1DG8 A;  3F0X X;  3DFR A;  4ELF A;  4P68 A;  4KYA A;  3Q1H A;  1DYH A;  3FS6 A;  3FQZ A;  1HFP A;  3FQO A;  4QJC A;  4ELE A;  4NX7 A;  2DHF A;  2XW7 A;  4H95 A;  3GYF A;  3SRU X;  4EIL A;  1AI9 A;  1DIS A;  3CLB A;  5CCC A;  3M08 A;  3INV A;  3M09 A;  4KL9 A;  1LY3 A;  3JW3 A;  1RX1 A;  5E8Q A;  3SH2 A;  1U72 A;  4EIZ A;  3DGA A;  3IRN A;  4KFJ A;  2W3V A;  3DRC A;  4XT6 A;  1S3V A;  7DFR A;  3D80 A;  4LAE X;  2W3A A;  5HVB A;  3NZD A;  1CZ3 A;  3FQC A;  3FRE X;  3QLW A;  1RD7 A;  4KJJ A;  3TQ9 A;  1U71 A;  4H97 A;  3QL3 A;  4M7V A;  4KLX A;  3ZPC A;  4G95 A;  3F8Y A;  3QLS A;  4XT8 A;  2D5N A;  5EAJ A;  3RG9 A;  4DP3 A;  1DR2 A;  1DRB A;  2GD9 A;  1PDB A;  4H96 A;  3CSE A;  3KJS A;  1MVS A;  4X5G A;  4M6J A;  3QL0 A;  5ECX A;  5DXV A;  5HUI A;  2O7P A;  4KJL A;  3QYL A;  4ELB A;  3NZB X;  4HA7 A;  3NTZ A;  1RX5 A;  3L3R A;  2ANQ A;  4OR7 A;  4OSG A;  4PSY A;  3E0B A;  4ELH A;  4EIG A;  3FYV X;  3JVX A;  2OIP A;  5DFR A;  4PDJ A;  1DR6 A;  2LF1 A;  5HSR A;  3GHW A;  1AOE A;  1RG7 A;  4M2X A;  4QLE A;  2W3B A;  1DDS A;  3NZA X;  5HI6 A;  1BOZ A;  1DYR A;  1RX6 A;  1M7A A;  3ROA A;  3VCO A;  2C2T A;  3KGY A;  3KJR A;  4Q0D A;  2ANO A;  4QHV A;  3TQ8 A;  4KM2 A;  4PST A;  1DYJ A;  3FQF A;  5CC9 A;  5JA3 A;  5U26 A;  3JW5 A;  5HT4 A;  3DAT A;  5HF0 X;  3QLX A;  3UM8 A;  5HPB A;  2G6V A;  4Q6A A;  4KNE A;  4G3M A;  1DF7 A;  3R33 A;  3JWK A;  2CIG A;  2BLA A;  1DYI A;  4IXE D;  1JUV A;  1YHO A;  3HJ3 A;  1S3U A;  2KGK A;  1DR1 A;  3NZ9 X;  3JWM A;  3SR5 X;  3NXO A;  3EX8 A;  3SAI A;  3NXV A;  3F0U X;  1KMV A;  3DL6 A;  3F8Z A;  3DAU A;  2B3Z A;  3K2H A;  5JG0 X;  2W9H A;  2QK8 A;  1J3I A;  1RH3 A;  4FGH A;  3K74 A;  3GHC A;  3N0H A;  1DIU A;  1RA8 A;  3K47 A;  1VJ3 A;  3NRR A;  2CD2 A;  4HOF A;  4Q0E A;  1JOL A;  4PTH A;  1DRH A;  3FRF X;  4G8Z X;  1TDR A;  1RF7 A;  1PD9 A;  1RE7 A;  4KD7 A;  4M6K A;  1IA2 A;  1DR4 A;  2INQ A;  2W3W A;  4X5J A;  1RX8 A;  4FHB A;  4KJK A;  1VDR A;  1BZF A;  3S9U A;  1KMS A;  1RX4 A;  3QLY A;  4DPD A;  2JYB A;  4XT7 A;  6DFR A;  1JOM A;  1DRF A;  2W9S A;  3IRO A;  3CD2 A;  4Q67 A;  3SA2 A;  1SEJ A;  1QZF A;  4KAK A;  4HOE A;  5ECC A;  1HFQ A;  1U70 A;  3FY8 X;  3OCH A;  3SRR X;  3S3V A;  5HSU A;  4KM0 A;  3IRM A;  4KY8 A;  3NZC X;  3SA1 A;  1D1G A;  2ZZA A;  3HBB A;  3NZ6 X;  3JWC A;  3NXX A;  2BLC A;  4TU5 X;  3UM6 A;  4P66 A;  3JTW A;  2W3M A;  4PTJ A;  1RB3 A;  3FQV A;  2ITH A;  4IXF X;  5HVE A;  1DR7 A;  3D84 X;  3I3R A;  2H2Q A;  2C2S A;  3JSU A;  3QFX A;  4XRB A;  3IX9 A;  1DR3 A;  1MVT A;  3IA4 A;  4X5F A;  2OBC A;  1OHJ A;  3IA5 A;  4HA9 A;  1DDR A;  1HFR A;  1LY4 A;  2HQP A;  3OAF A;  3S7A A;  2D0K A;  3F0Q X;  2AZN A;  3EEJ A;  1OHK A;  4M6L A;  3QLR A;  1DG5 A;  2FZJ A;  3FL8 A;  3TQB A;  4DDR A;  3FRD X;  3QGT A;  4HOG A;  3UM5 A;  1DLS A;  1DG7 A;  3NXY A;  4QLF A;  4KY4 A;  4KBN A;  1LUD A;  2L28 A;  4I13 A;  1DAJ A;  2DRC A;  3GHV A;  4GH8 A;  5FDA A;  2W9T A;  1AO8 A;  4M7U A;  3K45 A;  1IA1 A;  2BLB A;  1IA4 A;  1RA2 A;  1RX3 A;  2W9G A;  4DPH A;  4X5H A;  1J3J A;  4LAG X;  3FY9 X;  3SQY X;  5HF2 X;  3EEL A;  3SRS X;  4KEB A;  4CD2 A;  3F91 A;  3FL9 A;  3SRW X;  5HQY A;  3CL9 A;  4XT4 A;  1DHJ A;  3KFY A;  3QYO A;  3FRB X;  4QI9 A;  1DRE A;  4H98 A;  1J3K A;  5U27 A;  3SGY A;  1DHI A;  3SRQ X;  2BL9 A;  1E26 A;  3I8A X;  3F0S X;  3EIG A;  4LEK X;  4QLG A;  1KLK A;  3DL5 A;  3EEM A;  3FRA X;  4ECK A;  3JWF A;  3FQ0 A;  4XE6 X;  5HQZ A;  3QLZ A;  4LAH X;  2HM9 A;  3NXT A;  3KY8 A;  1RB2 A;  1ZDR A;  1RA1 A;  3NXR A;  1DHF A;  1M78 A;  1RC4 A;  4I1N A;  2P4G A;  3LG4 A;  3TQA A;  1CD2 A;  1RX2 A;  4X5I A;  3TD8 A;  3F0B X;  1PD8 A;  3DG8 A;  1RX7 A;  4DFR A;  4NX6 A;  5HT5 A;  3NU0 A;  3GI2 A;  3QG2 A;  1RA9 A;  4QJZ D;  1IA3 A;  2FZH A;  1DRA A; 
#chains in the Genus database with same CATH topology
 2FZI A;  2HXV A;  4PSS A;  8DFR A;  3ZPG A;  4P3R A;  1RA3 A;  4XEC X;  1M79 A;  3FYW X;  3EEK A;  4ELG A;  4XT5 A;  4IXG X;  4EJ1 A;  4RGC A;  1DLR A;  1DR5 A;  4P3Q A;  1S3W A;  4FGG A;  3RO9 A;  1S3Y A;  3F0V X;  1RX9 A;  1DG8 A;  3F0X X;  3DFR A;  4ELF A;  4P68 A;  4KYA A;  3Q1H A;  1DYH A;  3FS6 A;  3FQZ A;  1HFP A;  3FQO A;  4QJC A;  4ELE A;  4NX7 A;  2DHF A;  2XW7 A;  4H95 A;  3GYF A;  3SRU X;  4EIL A;  1AI9 A;  1DIS A;  3CLB A;  5CCC A;  3M08 A;  3INV A;  3M09 A;  4KL9 A;  1LY3 A;  3JW3 A;  1RX1 A;  5E8Q A;  3SH2 A;  1U72 A;  4EIZ A;  3DGA A;  3IRN A;  4KFJ A;  2W3V A;  3DRC A;  4XT6 A;  1S3V A;  7DFR A;  3D80 A;  4LAE X;  2W3A A;  5HVB A;  3NZD A;  1CZ3 A;  3FQC A;  3FRE X;  3QLW A;  1RD7 A;  4KJJ A;  3TQ9 A;  1U71 A;  4H97 A;  3QL3 A;  4M7V A;  4KLX A;  3ZPC A;  4G95 A;  3F8Y A;  3QLS A;  4XT8 A;  2D5N A;  5EAJ A;  3RG9 A;  4DP3 A;  1DR2 A;  1DRB A;  2GD9 A;  1PDB A;  4H96 A;  3CSE A;  3KJS A;  1MVS A;  4X5G A;  4M6J A;  3QL0 A;  5ECX A;  5DXV A;  5HUI A;  2O7P A;  4KJL A;  3QYL A;  4ELB A;  3NZB X;  4HA7 A;  3NTZ A;  1RX5 A;  3L3R A;  2ANQ A;  4OR7 A;  4OSG A;  4PSY A;  3E0B A;  4ELH A;  4EIG A;  3FYV X;  3JVX A;  2OIP A;  5DFR A;  4PDJ A;  1DR6 A;  2LF1 A;  5HSR A;  3GHW A;  1AOE A;  1RG7 A;  4M2X A;  4QLE A;  2W3B A;  1DDS A;  3NZA X;  5HI6 A;  1BOZ A;  1DYR A;  1RX6 A;  1M7A A;  3ROA A;  3VCO A;  2C2T A;  3KGY A;  3KJR A;  4Q0D A;  2ANO A;  4QHV A;  3TQ8 A;  4KM2 A;  4PST A;  1DYJ A;  3FQF A;  5CC9 A;  5JA3 A;  5U26 A;  3JW5 A;  5HT4 A;  3DAT A;  5HF0 X;  3QLX A;  3UM8 A;  5HPB A;  2G6V A;  4Q6A A;  4KNE A;  4G3M A;  1DF7 A;  3R33 A;  3JWK A;  2CIG A;  2BLA A;  1DYI A;  4IXE D;  1JUV A;  1YHO A;  3HJ3 A;  1S3U A;  2KGK A;  1DR1 A;  3NZ9 X;  3JWM A;  3SR5 X;  3NXO A;  3EX8 A;  3SAI A;  3NXV A;  3F0U X;  1KMV A;  3DL6 A;  3F8Z A;  3DAU A;  2B3Z A;  3K2H A;  5JG0 X;  2W9H A;  2QK8 A;  1J3I A;  1RH3 A;  4FGH A;  3K74 A;  3GHC A;  3N0H A;  1DIU A;  1RA8 A;  3K47 A;  1VJ3 A;  3NRR A;  2CD2 A;  4HOF A;  4Q0E A;  1JOL A;  4PTH A;  1DRH A;  3FRF X;  4G8Z X;  1TDR A;  1RF7 A;  1PD9 A;  1RE7 A;  4KD7 A;  4M6K A;  1IA2 A;  1DR4 A;  2INQ A;  2W3W A;  4X5J A;  1RX8 A;  4FHB A;  4KJK A;  1VDR A;  1BZF A;  3S9U A;  1KMS A;  1RX4 A;  3QLY A;  4DPD A;  2JYB A;  4XT7 A;  6DFR A;  1JOM A;  1DRF A;  2W9S A;  3IRO A;  3CD2 A;  4Q67 A;  3SA2 A;  1SEJ A;  1QZF A;  4KAK A;  4HOE A;  5ECC A;  1HFQ A;  1U70 A;  3FY8 X;  3OCH A;  3SRR X;  3S3V A;  5HSU A;  4KM0 A;  3IRM A;  4KY8 A;  3NZC X;  3SA1 A;  1D1G A;  2ZZA A;  3HBB A;  3NZ6 X;  3JWC A;  3NXX A;  2BLC A;  4TU5 X;  3UM6 A;  4P66 A;  3JTW A;  2W3M A;  4PTJ A;  1RB3 A;  3FQV A;  2ITH A;  4IXF X;  5HVE A;  1DR7 A;  3D84 X;  3I3R A;  2H2Q A;  2C2S A;  3JSU A;  3QFX A;  4XRB A;  3IX9 A;  1DR3 A;  1MVT A;  3IA4 A;  4X5F A;  2OBC A;  1OHJ A;  3IA5 A;  4HA9 A;  1DDR A;  1HFR A;  1LY4 A;  2HQP A;  3OAF A;  3S7A A;  2D0K A;  3F0Q X;  2AZN A;  3EEJ A;  1OHK A;  4M6L A;  3QLR A;  1DG5 A;  2FZJ A;  3FL8 A;  3TQB A;  4DDR A;  3FRD X;  3QGT A;  4HOG A;  3UM5 A;  1DLS A;  1DG7 A;  3NXY A;  4QLF A;  4KY4 A;  4KBN A;  1LUD A;  2L28 A;  4I13 A;  1DAJ A;  2DRC A;  3GHV A;  4GH8 A;  5FDA A;  2W9T A;  1AO8 A;  4M7U A;  3K45 A;  1IA1 A;  2BLB A;  1IA4 A;  1RA2 A;  1RX3 A;  2W9G A;  4DPH A;  4X5H A;  1J3J A;  4LAG X;  3FY9 X;  3SQY X;  5HF2 X;  3EEL A;  3SRS X;  4KEB A;  4CD2 A;  3F91 A;  3FL9 A;  3SRW X;  5HQY A;  3CL9 A;  4XT4 A;  1DHJ A;  3KFY A;  3QYO A;  3FRB X;  4QI9 A;  1DRE A;  4H98 A;  1J3K A;  5U27 A;  3SGY A;  1DHI A;  3SRQ X;  2BL9 A;  1E26 A;  3I8A X;  3F0S X;  3EIG A;  4LEK X;  4QLG A;  1KLK A;  3DL5 A;  3EEM A;  3FRA X;  4ECK A;  3JWF A;  3FQ0 A;  4XE6 X;  5HQZ A;  3QLZ A;  4LAH X;  2HM9 A;  3NXT A;  3KY8 A;  1RB2 A;  1ZDR A;  1RA1 A;  3NXR A;  1DHF A;  1M78 A;  1RC4 A;  4I1N A;  2P4G A;  3LG4 A;  3TQA A;  1CD2 A;  1RX2 A;  4X5I A;  3TD8 A;  3F0B X;  1PD8 A;  3DG8 A;  1RX7 A;  4DFR A;  4NX6 A;  5HT5 A;  3NU0 A;  3GI2 A;  3QG2 A;  1RA9 A;  4QJZ D;  1IA3 A;  2FZH A;  1DRA A; 
#chains in the Genus database with same CATH homology
 2FZI A;  2HXV A;  4PSS A;  8DFR A;  3ZPG A;  4P3R A;  1RA3 A;  4XEC X;  1M79 A;  3FYW X;  3EEK A;  4ELG A;  4XT5 A;  4IXG X;  4EJ1 A;  4RGC A;  1DLR A;  1DR5 A;  4P3Q A;  1S3W A;  4FGG A;  3RO9 A;  1S3Y A;  3F0V X;  1RX9 A;  1DG8 A;  3F0X X;  3DFR A;  4ELF A;  4P68 A;  4KYA A;  3Q1H A;  1DYH A;  3FS6 A;  3FQZ A;  1HFP A;  3FQO A;  4QJC A;  4ELE A;  4NX7 A;  2DHF A;  2XW7 A;  4H95 A;  3GYF A;  3SRU X;  4EIL A;  1AI9 A;  1DIS A;  3CLB A;  5CCC A;  3M08 A;  3INV A;  3M09 A;  4KL9 A;  1LY3 A;  3JW3 A;  1RX1 A;  5E8Q A;  3SH2 A;  1U72 A;  4EIZ A;  3DGA A;  3IRN A;  4KFJ A;  2W3V A;  3DRC A;  4XT6 A;  1S3V A;  7DFR A;  3D80 A;  4LAE X;  2W3A A;  5HVB A;  3NZD A;  1CZ3 A;  3FQC A;  3FRE X;  3QLW A;  1RD7 A;  4KJJ A;  3TQ9 A;  1U71 A;  4H97 A;  3QL3 A;  4M7V A;  4KLX A;  3ZPC A;  4G95 A;  3F8Y A;  3QLS A;  4XT8 A;  2D5N A;  5EAJ A;  3RG9 A;  4DP3 A;  1DR2 A;  1DRB A;  2GD9 A;  1PDB A;  4H96 A;  3CSE A;  3KJS A;  1MVS A;  4X5G A;  4M6J A;  3QL0 A;  5ECX A;  5DXV A;  5HUI A;  2O7P A;  4KJL A;  3QYL A;  4ELB A;  3NZB X;  4HA7 A;  3NTZ A;  1RX5 A;  3L3R A;  2ANQ A;  4OR7 A;  4OSG A;  4PSY A;  3E0B A;  4ELH A;  4EIG A;  3FYV X;  3JVX A;  2OIP A;  5DFR A;  4PDJ A;  1DR6 A;  2LF1 A;  5HSR A;  3GHW A;  1AOE A;  1RG7 A;  4M2X A;  4QLE A;  2W3B A;  1DDS A;  3NZA X;  5HI6 A;  1BOZ A;  1DYR A;  1RX6 A;  1M7A A;  3ROA A;  3VCO A;  2C2T A;  3KGY A;  3KJR A;  4Q0D A;  2ANO A;  4QHV A;  3TQ8 A;  4KM2 A;  4PST A;  1DYJ A;  3FQF A;  5CC9 A;  5JA3 A;  5U26 A;  3JW5 A;  5HT4 A;  3DAT A;  5HF0 X;  3QLX A;  3UM8 A;  5HPB A;  2G6V A;  4Q6A A;  4KNE A;  4G3M A;  1DF7 A;  3R33 A;  3JWK A;  2CIG A;  2BLA A;  1DYI A;  4IXE D;  1JUV A;  1YHO A;  3HJ3 A;  1S3U A;  2KGK A;  1DR1 A;  3NZ9 X;  3JWM A;  3SR5 X;  3NXO A;  3EX8 A;  3SAI A;  3NXV A;  3F0U X;  1KMV A;  3DL6 A;  3F8Z A;  3DAU A;  2B3Z A;  3K2H A;  5JG0 X;  2W9H A;  2QK8 A;  1J3I A;  1RH3 A;  4FGH A;  3K74 A;  3GHC A;  3N0H A;  1DIU A;  1RA8 A;  3K47 A;  1VJ3 A;  3NRR A;  2CD2 A;  4HOF A;  4Q0E A;  1JOL A;  4PTH A;  1DRH A;  3FRF X;  4G8Z X;  1TDR A;  1RF7 A;  1PD9 A;  1RE7 A;  4KD7 A;  4M6K A;  1IA2 A;  1DR4 A;  2INQ A;  2W3W A;  4X5J A;  1RX8 A;  4FHB A;  4KJK A;  1VDR A;  1BZF A;  3S9U A;  1KMS A;  1RX4 A;  3QLY A;  4DPD A;  2JYB A;  4XT7 A;  6DFR A;  1JOM A;  1DRF A;  2W9S A;  3IRO A;  3CD2 A;  4Q67 A;  3SA2 A;  1SEJ A;  1QZF A;  4KAK A;  4HOE A;  5ECC A;  1HFQ A;  1U70 A;  3FY8 X;  3OCH A;  3SRR X;  3S3V A;  5HSU A;  4KM0 A;  3IRM A;  4KY8 A;  3NZC X;  3SA1 A;  1D1G A;  2ZZA A;  3HBB A;  3NZ6 X;  3JWC A;  3NXX A;  2BLC A;  4TU5 X;  3UM6 A;  4P66 A;  3JTW A;  2W3M A;  4PTJ A;  1RB3 A;  3FQV A;  2ITH A;  4IXF X;  5HVE A;  1DR7 A;  3D84 X;  3I3R A;  2H2Q A;  2C2S A;  3JSU A;  3QFX A;  4XRB A;  3IX9 A;  1DR3 A;  1MVT A;  3IA4 A;  4X5F A;  2OBC A;  1OHJ A;  3IA5 A;  4HA9 A;  1DDR A;  1HFR A;  1LY4 A;  2HQP A;  3OAF A;  3S7A A;  2D0K A;  3F0Q X;  2AZN A;  3EEJ A;  1OHK A;  4M6L A;  3QLR A;  1DG5 A;  2FZJ A;  3FL8 A;  3TQB A;  4DDR A;  3FRD X;  3QGT A;  4HOG A;  3UM5 A;  1DLS A;  1DG7 A;  3NXY A;  4QLF A;  4KY4 A;  4KBN A;  1LUD A;  2L28 A;  4I13 A;  1DAJ A;  2DRC A;  3GHV A;  4GH8 A;  5FDA A;  2W9T A;  1AO8 A;  4M7U A;  3K45 A;  1IA1 A;  2BLB A;  1IA4 A;  1RA2 A;  1RX3 A;  2W9G A;  4DPH A;  4X5H A;  1J3J A;  4LAG X;  3FY9 X;  3SQY X;  5HF2 X;  3EEL A;  3SRS X;  4KEB A;  4CD2 A;  3F91 A;  3FL9 A;  3SRW X;  5HQY A;  3CL9 A;  4XT4 A;  1DHJ A;  3KFY A;  3QYO A;  3FRB X;  4QI9 A;  1DRE A;  4H98 A;  1J3K A;  5U27 A;  3SGY A;  1DHI A;  3SRQ X;  2BL9 A;  1E26 A;  3I8A X;  3F0S X;  3EIG A;  4LEK X;  4QLG A;  1KLK A;  3DL5 A;  3EEM A;  3FRA X;  4ECK A;  3JWF A;  3FQ0 A;  4XE6 X;  5HQZ A;  3QLZ A;  4LAH X;  2HM9 A;  3NXT A;  3KY8 A;  1RB2 A;  1ZDR A;  1RA1 A;  3NXR A;  1DHF A;  1M78 A;  1RC4 A;  4I1N A;  2P4G A;  3LG4 A;  3TQA A;  1CD2 A;  1RX2 A;  4X5I A;  3TD8 A;  3F0B X;  1PD8 A;  3DG8 A;  1RX7 A;  4DFR A;  4NX6 A;  5HT5 A;  3NU0 A;  3GI2 A;  3QG2 A;  1RA9 A;  4QJZ D;  1IA3 A;  2FZH A;  1DRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...