1BZFA

Nmr solution structure and dynamics of the complex of lactobacillus casei dihydrofolate reductase with the new lipophilic antifolate drug trimetrexate, 22 structures
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
162
structure length
162
Chain Sequence
TAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTNVVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLAGSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics in solution of the complex of Lactobacillus casei dihydrofolate reductase with the new lipophilic antifolate drug trimetrexate.
pubmed rcsb
molecule keywords DIHYDROFOLATE REDUCTASE
molecule tags Oxidoreductase
source organism Lactobacillus casei
total genus 32
structure length 162
sequence length 162
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 1998-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 1bzfA00
3I3RA 3NZAX 4M7UA 1E26A 3CSEA 2GD9A 4KJLA 4Q67A 3HBBA 4M6KA 3S9UA 1RA1A 4ELEA 1DR5A 2BLAA 5HT5A 1HFQA 5EAJA 1DHIA 2FZJA 3ROAA 1BZFA 3SA2A 3QYLA 2KGKA 5ECXA 4XT4A 3DAUA 1HFPA 3FQCA 5FDAA 1RX5A 4M6JA 4CD2A 2ANOA 3F0SX 4TU5X 3IX9A 4QJCA 3SGYA 4ELGA 4KJJA 1RH3A 1DISA 3DL6A 4HOEA 3IA5A 3FYVX 3EX8A 1VDRA 1S3UA 3F0XX 6DFRA 3INVA 3I8AX 2ANQA 5CCCA 3DGAA 4XE6X 3UM5A 5E8QA 5U27A 1RA3A 3TQBA 5HVBA 3ZPGA 1JOLA 3ZPCA 4OR7A 3SRQX 3FQZA 2CIGA 3QLWA 1U71A 3QLRA 1D1GA 2XW7A 4KLXA 4KY4A 3CLBA 3JVXA 3DL5A 3JWMA 3DG8A 4KD7A 4XECX 1DR2A 1CD2A 3FQOA 3TQ9A 4QHVA 1RC4A 2DHFA 3IROA 3QG2A 5HUIA 5HSUA 5JA3A 1DDRA 4KAKA 1BOZA 4P3RA 1DLSA 3FY9X 3M08A 4X5FA 3EELA 3N0HA 1M79A 4PSYA 3QLXA 3IRMA 4NX6A 3S3VA 5ECCA 3L3RA 1PD8A 3OAFA 1KMSA 3KGYA 3NZ9X 1J3IA 3NZDA 3QLYA 1RG7A 3JWCA 3QLSA 3SA1A 1IA1A 4LAHX 1DYJA 2BLBA 2D0KA 3QYOA 1S3WA 4XT6A 3VCOA 4QI9A 3FYWX 3QL0A 1MVSA 3S7AA 3SRSX 3JW3A 4QJZD 4Q0EA 1U70A 4PDJA 4DPHA 3M09A 3FL8A 1DREA 2W3WA 7DFRA 3NZCX 4KYAA 3R33A 3LG4A 2DRCA 4Q0DA 3CL9A 3F0QX 3NZBX 1DR4A 1DLRA 5HT4A 4X5IA 3TD8A 1DRFA 1RX2A 3KY8A 3Q1HA 3JTWA 3NU0A 4EILA 4QLFA 2JYBA 3FQ0A 3EIGA 1DG8A 1RB2A 3SR5X 3FRDX 4XRBA 3FRFX 1DYHA 4XT5A 4LAEX 1DYIA 3IRNA 1RF7A 4KJKA 2P4GA 1U72A 2HQPA 4EJ1A 1DG5A 4QLEA 1S3YA 1YHOA 3SQYX 3FS6A 5HF0X 2W3BA 3NXVA 4DFRA 1SEJA 5DXVA 1RX3A 5HVEA 3GHCA 3E0BA 1LY3A 1MVTA 1RE7A 3F91A 1PD9A 3NXYA 2ZZAA 5HF2X 1DHJA 4H96A 4I1NA 4P66A 4XT7A 4M2XA 2W9HA 5HQZA 8DFRA 4Q6AA 3NXOA 3JSUA 1DG7A 1DRHA 1RA8A 1DHFA 4PTHA 4KM0A 2W3AA 3SRWX 1S3VA 3FY8X 4H95A 1RB3A 3K74A 4IXED 1OHJA 1DR1A 1M78A 3SRRX 2W9SA 4KM2A 4EIZA 1AO8A 1DR7A 4KFJA 4FHBA 1J3KA 1TDRA 3GHVA 1LUDA 3K2HA 1KLKA 3QLZA 4I13A 4M6LA 1DRBA 3DFRA 4P68A 4QLGA 3CD2A 2G6VA 1LY4A 5HQYA 1RA2A 1DR3A 4X5JA 1AOEA 3FQVA 5HI6A 2HM9A 3RO9A 2OBCA 1RX1A 1DF7A 2BL9A 3TQ8A 3FL9A 3FREX 4G95A 1DRAA 3NXXA 3KJSA 4FGGA 4H98A 2FZHA 2C2TA 1J3JA 3JWFA 3UM8A 1IA4A 1JOMA 4H97A 2B3ZA 4KNEA 3KJRA 2W9GA 4ELFA 5CC9A 3NRRA 4ELBA 2OIPA 2C2SA 3K45A 1RX8A 2FZIA 3NZ6X 3JW5A 1DR6A 4FGHA 4HOFA 1M7AA 2QK8A 3D80A 5HSRA 4KEBA 2BLCA 3NTZA 1AI9A 1KMVA 3UM6A 4LEKX 1QZFA 3SH2A 1ZDRA 5JG0X 2W3MA 2W9TA 1CZ3A 4HA7A 1DAJA 1DYRA 2HXVA 2W3VA 4G8ZX 4X5GA 3QGTA 5HPBA 1RX7A 4DDRA 4IXFX 3TQAA 4KBNA 1RX4A 3SRUX 3F8YA 1DIUA 3F0VX 3HJ3A 2LF1A 4KL9A 3QL3A 4GH8A 2INQA 1VJ3A 1RX6A 1DDSA 4X5HA 4EIGA 1IA3A 1IA2A 3FRAX 4DP3A 4LAGX 3DRCA 3IA4A 5DFRA 3RG9A 4G3MA 1HFRA 3D84X 4NX7A 3JWKA 4DPDA 3DATA 2L28A 1OHKA 4ECKA 3EEMA 3EEJA 1RX9A 3KFYA 3K47A 3SAIA 2CD2A 4IXGX 4KY8A 2ITHA 4XT8A 3F8ZA 4PSSA 3GI2A 4ELHA 3F0UX 3NXRA 3FQFA 4P3QA 4PSTA 2H2QA 1PDBA 4OSGA 4PTJA 3EEKA 3OCHA 3QFXA 2O7PA 3F0BX 4HA9A 2AZNA 3NXTA 4M7VA 3FRBX 4HOGA 3GYFA 4RGCA 3GHWA 1RA9A 2D5NA 1RD7A 1JUVA 5U26A
chains in the Genus database with same CATH superfamily
3I3RA 3NZAX 4M7UA 1E26A 3CSEA 2GD9A 4KJLA 4Q67A 3HBBA 4M6KA 3S9UA 1RA1A 4ELEA 1DR5A 2BLAA 5HT5A 1HFQA 5EAJA 1DHIA 2FZJA 3ROAA 1BZFA 3SA2A 3QYLA 2KGKA 5ECXA 4XT4A 3DAUA 1HFPA 3FQCA 5FDAA 1RX5A 4M6JA 4CD2A 2ANOA 3F0SX 4TU5X 3IX9A 4QJCA 3SGYA 4ELGA 4KJJA 1RH3A 1DISA 3DL6A 4HOEA 3IA5A 3FYVX 3EX8A 1VDRA 1S3UA 3F0XX 6DFRA 3INVA 3I8AX 2ANQA 5CCCA 3DGAA 4XE6X 3UM5A 5E8QA 5U27A 1RA3A 3TQBA 5HVBA 3ZPGA 1JOLA 3ZPCA 4OR7A 3SRQX 3FQZA 2CIGA 3QLWA 1U71A 3QLRA 1D1GA 2XW7A 4KLXA 4KY4A 3CLBA 3JVXA 3DL5A 3JWMA 3DG8A 4KD7A 4XECX 1DR2A 1CD2A 3FQOA 3TQ9A 4QHVA 1RC4A 2DHFA 3IROA 3QG2A 5HUIA 5HSUA 5JA3A 1DDRA 4KAKA 1BOZA 4P3RA 1DLSA 3FY9X 3M08A 4X5FA 3EELA 3N0HA 1M79A 4PSYA 3QLXA 3IRMA 4NX6A 3S3VA 5ECCA 3L3RA 1PD8A 3OAFA 1KMSA 3KGYA 3NZ9X 1J3IA 3NZDA 3QLYA 1RG7A 3JWCA 3QLSA 3SA1A 1IA1A 4LAHX 1DYJA 2BLBA 2D0KA 3QYOA 1S3WA 4XT6A 3VCOA 4QI9A 3FYWX 3QL0A 1MVSA 3S7AA 3SRSX 3JW3A 4QJZD 4Q0EA 1U70A 4PDJA 4DPHA 3M09A 3FL8A 1DREA 2W3WA 7DFRA 3NZCX 4KYAA 3R33A 3LG4A 2DRCA 4Q0DA 3CL9A 3F0QX 3NZBX 1DR4A 1DLRA 5HT4A 4X5IA 3TD8A 1DRFA 1RX2A 3KY8A 3Q1HA 3JTWA 3NU0A 4EILA 4QLFA 2JYBA 3FQ0A 3EIGA 1DG8A 1RB2A 3SR5X 3FRDX 4XRBA 3FRFX 1DYHA 4XT5A 4LAEX 1DYIA 3IRNA 1RF7A 4KJKA 2P4GA 1U72A 2HQPA 4EJ1A 1DG5A 4QLEA 1S3YA 1YHOA 3SQYX 3FS6A 5HF0X 2W3BA 3NXVA 4DFRA 1SEJA 5DXVA 1RX3A 5HVEA 3GHCA 3E0BA 1LY3A 1MVTA 1RE7A 3F91A 1PD9A 3NXYA 2ZZAA 5HF2X 1DHJA 4H96A 4I1NA 4P66A 4XT7A 4M2XA 2W9HA 5HQZA 8DFRA 4Q6AA 3NXOA 3JSUA 1DG7A 1DRHA 1RA8A 1DHFA 4PTHA 4KM0A 2W3AA 3SRWX 1S3VA 3FY8X 4H95A 1RB3A 3K74A 4IXED 1OHJA 1DR1A 1M78A 3SRRX 2W9SA 4KM2A 4EIZA 1AO8A 1DR7A 4KFJA 4FHBA 1J3KA 1TDRA 3GHVA 1LUDA 3K2HA 1KLKA 3QLZA 4I13A 4M6LA 1DRBA 3DFRA 4P68A 4QLGA 3CD2A 2G6VA 1LY4A 5HQYA 1RA2A 1DR3A 4X5JA 1AOEA 3FQVA 5HI6A 2HM9A 3RO9A 2OBCA 1RX1A 1DF7A 2BL9A 3TQ8A 3FL9A 3FREX 4G95A 1DRAA 3NXXA 3KJSA 4FGGA 4H98A 2FZHA 2C2TA 1J3JA 3JWFA 3UM8A 1IA4A 1JOMA 4H97A 2B3ZA 4KNEA 3KJRA 2W9GA 4ELFA 5CC9A 3NRRA 4ELBA 2OIPA 2C2SA 3K45A 1RX8A 2FZIA 3NZ6X 3JW5A 1DR6A 4FGHA 4HOFA 1M7AA 2QK8A 3D80A 5HSRA 4KEBA 2BLCA 3NTZA 1AI9A 1KMVA 3UM6A 4LEKX 1QZFA 3SH2A 1ZDRA 5JG0X 2W3MA 2W9TA 1CZ3A 4HA7A 1DAJA 1DYRA 2HXVA 2W3VA 4G8ZX 4X5GA 3QGTA 5HPBA 1RX7A 4DDRA 4IXFX 3TQAA 4KBNA 1RX4A 3SRUX 3F8YA 1DIUA 3F0VX 3HJ3A 2LF1A 4KL9A 3QL3A 4GH8A 2INQA 1VJ3A 1RX6A 1DDSA 4X5HA 4EIGA 1IA3A 1IA2A 3FRAX 4DP3A 4LAGX 3DRCA 3IA4A 5DFRA 3RG9A 4G3MA 1HFRA 3D84X 4NX7A 3JWKA 4DPDA 3DATA 2L28A 1OHKA 4ECKA 3EEMA 3EEJA 1RX9A 3KFYA 3K47A 3SAIA 2CD2A 4IXGX 4KY8A 2ITHA 4XT8A 3F8ZA 4PSSA 3GI2A 4ELHA 3F0UX 3NXRA 3FQFA 4P3QA 4PSTA 2H2QA 1PDBA 4OSGA 4PTJA 3EEKA 3OCHA 3QFXA 2O7PA 3F0BX 4HA9A 2AZNA 3NXTA 4M7VA 3FRBX 4HOGA 3GYFA 4RGCA 3GHWA 1RA9A 2D5NA 1RD7A 1JUVA 5U26A
chains in the Genus database with same CATH topology
3I3RA 3NZAX 4M7UA 1E26A 3CSEA 2GD9A 4KJLA 4Q67A 3HBBA 4M6KA 3S9UA 1RA1A 4ELEA 1DR5A 2BLAA 5HT5A 1HFQA 5EAJA 1DHIA 2FZJA 3ROAA 1BZFA 3SA2A 3QYLA 2KGKA 5ECXA 4XT4A 3DAUA 1HFPA 3FQCA 5FDAA 1RX5A 4M6JA 4CD2A 2ANOA 3F0SX 4TU5X 3IX9A 4QJCA 3SGYA 4ELGA 4KJJA 1RH3A 1DISA 3DL6A 4HOEA 3IA5A 3FYVX 3EX8A 1VDRA 1S3UA 3F0XX 6DFRA 3INVA 3I8AX 2ANQA 5CCCA 3DGAA 4XE6X 3UM5A 5E8QA 5U27A 1RA3A 3TQBA 5HVBA 3ZPGA 1JOLA 3ZPCA 4OR7A 3SRQX 3FQZA 2CIGA 3QLWA 1U71A 3QLRA 1D1GA 2XW7A 4KLXA 4KY4A 3CLBA 3JVXA 3DL5A 3JWMA 3DG8A 4KD7A 4XECX 1DR2A 1CD2A 3FQOA 3TQ9A 4QHVA 1RC4A 2DHFA 3IROA 3QG2A 5HUIA 5HSUA 5JA3A 1DDRA 4KAKA 1BOZA 4P3RA 1DLSA 3FY9X 3M08A 4X5FA 3EELA 3N0HA 1M79A 4PSYA 3QLXA 3IRMA 4NX6A 3S3VA 5ECCA 3L3RA 1PD8A 3OAFA 1KMSA 3KGYA 3NZ9X 1J3IA 3NZDA 3QLYA 1RG7A 3JWCA 3QLSA 3SA1A 1IA1A 4LAHX 1DYJA 2BLBA 2D0KA 3QYOA 1S3WA 4XT6A 3VCOA 4QI9A 3FYWX 3QL0A 1MVSA 3S7AA 3SRSX 3JW3A 4QJZD 4Q0EA 1U70A 4PDJA 4DPHA 3M09A 3FL8A 1DREA 2W3WA 7DFRA 3NZCX 4KYAA 3R33A 3LG4A 2DRCA 4Q0DA 3CL9A 3F0QX 3NZBX 1DR4A 1DLRA 5HT4A 4X5IA 3TD8A 1DRFA 1RX2A 3KY8A 3Q1HA 3JTWA 3NU0A 4EILA 4QLFA 2JYBA 3FQ0A 3EIGA 1DG8A 1RB2A 3SR5X 3FRDX 4XRBA 3FRFX 1DYHA 4XT5A 4LAEX 1DYIA 3IRNA 1RF7A 4KJKA 2P4GA 1U72A 2HQPA 4EJ1A 1DG5A 4QLEA 1S3YA 1YHOA 3SQYX 3FS6A 5HF0X 2W3BA 3NXVA 4DFRA 1SEJA 5DXVA 1RX3A 5HVEA 3GHCA 3E0BA 1LY3A 1MVTA 1RE7A 3F91A 1PD9A 3NXYA 2ZZAA 5HF2X 1DHJA 4H96A 4I1NA 4P66A 4XT7A 4M2XA 2W9HA 5HQZA 8DFRA 4Q6AA 3NXOA 3JSUA 1DG7A 1DRHA 1RA8A 1DHFA 4PTHA 4KM0A 2W3AA 3SRWX 1S3VA 3FY8X 4H95A 1RB3A 3K74A 4IXED 1OHJA 1DR1A 1M78A 3SRRX 2W9SA 4KM2A 4EIZA 1AO8A 1DR7A 4KFJA 4FHBA 1J3KA 1TDRA 3GHVA 1LUDA 3K2HA 1KLKA 3QLZA 4I13A 4M6LA 1DRBA 3DFRA 4P68A 4QLGA 3CD2A 2G6VA 1LY4A 5HQYA 1RA2A 1DR3A 4X5JA 1AOEA 3FQVA 5HI6A 2HM9A 3RO9A 2OBCA 1RX1A 1DF7A 2BL9A 3TQ8A 3FL9A 3FREX 4G95A 1DRAA 3NXXA 3KJSA 4FGGA 4H98A 2FZHA 2C2TA 1J3JA 3JWFA 3UM8A 1IA4A 1JOMA 4H97A 2B3ZA 4KNEA 3KJRA 2W9GA 4ELFA 5CC9A 3NRRA 4ELBA 2OIPA 2C2SA 3K45A 1RX8A 2FZIA 3NZ6X 3JW5A 1DR6A 4FGHA 4HOFA 1M7AA 2QK8A 3D80A 5HSRA 4KEBA 2BLCA 3NTZA 1AI9A 1KMVA 3UM6A 4LEKX 1QZFA 3SH2A 1ZDRA 5JG0X 2W3MA 2W9TA 1CZ3A 4HA7A 1DAJA 1DYRA 2HXVA 2W3VA 4G8ZX 4X5GA 3QGTA 5HPBA 1RX7A 4DDRA 4IXFX 3TQAA 4KBNA 1RX4A 3SRUX 3F8YA 1DIUA 3F0VX 3HJ3A 2LF1A 4KL9A 3QL3A 4GH8A 2INQA 1VJ3A 1RX6A 1DDSA 4X5HA 4EIGA 1IA3A 1IA2A 3FRAX 4DP3A 4LAGX 3DRCA 3IA4A 5DFRA 3RG9A 4G3MA 1HFRA 3D84X 4NX7A 3JWKA 4DPDA 3DATA 2L28A 1OHKA 4ECKA 3EEMA 3EEJA 1RX9A 3KFYA 3K47A 3SAIA 2CD2A 4IXGX 4KY8A 2ITHA 4XT8A 3F8ZA 4PSSA 3GI2A 4ELHA 3F0UX 3NXRA 3FQFA 4P3QA 4PSTA 2H2QA 1PDBA 4OSGA 4PTJA 3EEKA 3OCHA 3QFXA 2O7PA 3F0BX 4HA9A 2AZNA 3NXTA 4M7VA 3FRBX 4HOGA 3GYFA 4RGCA 3GHWA 1RA9A 2D5NA 1RD7A 1JUVA 5U26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3R A;  3NZA X;  4M7U A;  1E26 A;  3CSE A;  2GD9 A;  4KJL A;  4Q67 A;  3HBB A;  4M6K A;  3S9U A;  1RA1 A;  4ELE A;  1DR5 A;  2BLA A;  5HT5 A;  1HFQ A;  5EAJ A;  1DHI A;  2FZJ A;  3ROA A;  1BZF A;  3SA2 A;  3QYL A;  2KGK A;  5ECX A;  4XT4 A;  3DAU A;  1HFP A;  3FQC A;  5FDA A;  1RX5 A;  4M6J A;  4CD2 A;  2ANO A;  3F0S X;  4TU5 X;  3IX9 A;  4QJC A;  3SGY A;  4ELG A;  4KJJ A;  1RH3 A;  1DIS A;  3DL6 A;  4HOE A;  3IA5 A;  3FYV X;  3EX8 A;  1VDR A;  1S3U A;  3F0X X;  6DFR A;  3INV A;  3I8A X;  2ANQ A;  5CCC A;  3DGA A;  4XE6 X;  3UM5 A;  5E8Q A;  5U27 A;  1RA3 A;  3TQB A;  5HVB A;  3ZPG A;  1JOL A;  3ZPC A;  4OR7 A;  3SRQ X;  3FQZ A;  2CIG A;  3QLW A;  1U71 A;  3QLR A;  1D1G A;  2XW7 A;  4KLX A;  4KY4 A;  3CLB A;  3JVX A;  3DL5 A;  3JWM A;  3DG8 A;  4KD7 A;  4XEC X;  1DR2 A;  1CD2 A;  3FQO A;  3TQ9 A;  4QHV A;  1RC4 A;  2DHF A;  3IRO A;  3QG2 A;  5HUI A;  5HSU A;  5JA3 A;  1DDR A;  4KAK A;  1BOZ A;  4P3R A;  1DLS A;  3FY9 X;  3M08 A;  4X5F A;  3EEL A;  3N0H A;  1M79 A;  4PSY A;  3QLX A;  3IRM A;  4NX6 A;  3S3V A;  5ECC A;  3L3R A;  1PD8 A;  3OAF A;  1KMS A;  3KGY A;  3NZ9 X;  1J3I A;  3NZD A;  3QLY A;  1RG7 A;  3JWC A;  3QLS A;  3SA1 A;  1IA1 A;  4LAH X;  1DYJ A;  2BLB A;  2D0K A;  3QYO A;  1S3W A;  4XT6 A;  3VCO A;  4QI9 A;  3FYW X;  3QL0 A;  1MVS A;  3S7A A;  3SRS X;  3JW3 A;  4QJZ D;  4Q0E A;  1U70 A;  4PDJ A;  4DPH A;  3M09 A;  3FL8 A;  1DRE A;  2W3W A;  7DFR A;  3NZC X;  4KYA A;  3R33 A;  3LG4 A;  2DRC A;  4Q0D A;  3CL9 A;  3F0Q X;  3NZB X;  1DR4 A;  1DLR A;  5HT4 A;  4X5I A;  3TD8 A;  1DRF A;  1RX2 A;  3KY8 A;  3Q1H A;  3JTW A;  3NU0 A;  4EIL A;  4QLF A;  2JYB A;  3FQ0 A;  3EIG A;  1DG8 A;  1RB2 A;  3SR5 X;  3FRD X;  4XRB A;  3FRF X;  1DYH A;  4XT5 A;  4LAE X;  1DYI A;  3IRN A;  1RF7 A;  4KJK A;  2P4G A;  1U72 A;  2HQP A;  4EJ1 A;  1DG5 A;  4QLE A;  1S3Y A;  1YHO A;  3SQY X;  3FS6 A;  5HF0 X;  2W3B A;  3NXV A;  4DFR A;  1SEJ A;  5DXV A;  1RX3 A;  5HVE A;  3GHC A;  3E0B A;  1LY3 A;  1MVT A;  1RE7 A;  3F91 A;  1PD9 A;  3NXY A;  2ZZA A;  5HF2 X;  1DHJ A;  4H96 A;  4I1N A;  4P66 A;  4XT7 A;  4M2X A;  2W9H A;  5HQZ A;  8DFR A;  4Q6A A;  3NXO A;  3JSU A;  1DG7 A;  1DRH A;  1RA8 A;  1DHF A;  4PTH A;  4KM0 A;  2W3A A;  3SRW X;  1S3V A;  3FY8 X;  4H95 A;  1RB3 A;  3K74 A;  4IXE D;  1OHJ A;  1DR1 A;  1M78 A;  3SRR X;  2W9S A;  4KM2 A;  4EIZ A;  1AO8 A;  1DR7 A;  4KFJ A;  4FHB A;  1J3K A;  1TDR A;  3GHV A;  1LUD A;  3K2H A;  1KLK A;  3QLZ A;  4I13 A;  4M6L A;  1DRB A;  3DFR A;  4P68 A;  4QLG A;  3CD2 A;  2G6V A;  1LY4 A;  5HQY A;  1RA2 A;  1DR3 A;  4X5J A;  1AOE A;  3FQV A;  5HI6 A;  2HM9 A;  3RO9 A;  2OBC A;  1RX1 A;  1DF7 A;  2BL9 A;  3TQ8 A;  3FL9 A;  3FRE X;  4G95 A;  1DRA A;  3NXX A;  3KJS A;  4FGG A;  4H98 A;  2FZH A;  2C2T A;  1J3J A;  3JWF A;  3UM8 A;  1IA4 A;  1JOM A;  4H97 A;  2B3Z A;  4KNE A;  3KJR A;  2W9G A;  4ELF A;  5CC9 A;  3NRR A;  4ELB A;  2OIP A;  2C2S A;  3K45 A;  1RX8 A;  2FZI A;  3NZ6 X;  3JW5 A;  1DR6 A;  4FGH A;  4HOF A;  1M7A A;  2QK8 A;  3D80 A;  5HSR A;  4KEB A;  2BLC A;  3NTZ A;  1AI9 A;  1KMV A;  3UM6 A;  4LEK X;  1QZF A;  3SH2 A;  1ZDR A;  5JG0 X;  2W3M A;  2W9T A;  1CZ3 A;  4HA7 A;  1DAJ A;  1DYR A;  2HXV A;  2W3V A;  4G8Z X;  4X5G A;  3QGT A;  5HPB A;  1RX7 A;  4DDR A;  4IXF X;  3TQA A;  4KBN A;  1RX4 A;  3SRU X;  3F8Y A;  1DIU A;  3F0V X;  3HJ3 A;  2LF1 A;  4KL9 A;  3QL3 A;  4GH8 A;  2INQ A;  1VJ3 A;  1RX6 A;  1DDS A;  4X5H A;  4EIG A;  1IA3 A;  1IA2 A;  3FRA X;  4DP3 A;  4LAG X;  3DRC A;  3IA4 A;  5DFR A;  3RG9 A;  4G3M A;  1HFR A;  3D84 X;  4NX7 A;  3JWK A;  4DPD A;  3DAT A;  2L28 A;  1OHK A;  4ECK A;  3EEM A;  3EEJ A;  1RX9 A;  3KFY A;  3K47 A;  3SAI A;  2CD2 A;  4IXG X;  4KY8 A;  2ITH A;  4XT8 A;  3F8Z A;  4PSS A;  3GI2 A;  4ELH A;  3F0U X;  3NXR A;  3FQF A;  4P3Q A;  4PST A;  2H2Q A;  1PDB A;  4OSG A;  4PTJ A;  3EEK A;  3OCH A;  3QFX A;  2O7P A;  3F0B X;  4HA9 A;  2AZN A;  3NXT A;  4M7V A;  3FRB X;  4HOG A;  3GYF A;  4RGC A;  3GHW A;  1RA9 A;  2D5N A;  1RD7 A;  1JUV A;  5U26 A; 
#chains in the Genus database with same CATH topology
 3I3R A;  3NZA X;  4M7U A;  1E26 A;  3CSE A;  2GD9 A;  4KJL A;  4Q67 A;  3HBB A;  4M6K A;  3S9U A;  1RA1 A;  4ELE A;  1DR5 A;  2BLA A;  5HT5 A;  1HFQ A;  5EAJ A;  1DHI A;  2FZJ A;  3ROA A;  1BZF A;  3SA2 A;  3QYL A;  2KGK A;  5ECX A;  4XT4 A;  3DAU A;  1HFP A;  3FQC A;  5FDA A;  1RX5 A;  4M6J A;  4CD2 A;  2ANO A;  3F0S X;  4TU5 X;  3IX9 A;  4QJC A;  3SGY A;  4ELG A;  4KJJ A;  1RH3 A;  1DIS A;  3DL6 A;  4HOE A;  3IA5 A;  3FYV X;  3EX8 A;  1VDR A;  1S3U A;  3F0X X;  6DFR A;  3INV A;  3I8A X;  2ANQ A;  5CCC A;  3DGA A;  4XE6 X;  3UM5 A;  5E8Q A;  5U27 A;  1RA3 A;  3TQB A;  5HVB A;  3ZPG A;  1JOL A;  3ZPC A;  4OR7 A;  3SRQ X;  3FQZ A;  2CIG A;  3QLW A;  1U71 A;  3QLR A;  1D1G A;  2XW7 A;  4KLX A;  4KY4 A;  3CLB A;  3JVX A;  3DL5 A;  3JWM A;  3DG8 A;  4KD7 A;  4XEC X;  1DR2 A;  1CD2 A;  3FQO A;  3TQ9 A;  4QHV A;  1RC4 A;  2DHF A;  3IRO A;  3QG2 A;  5HUI A;  5HSU A;  5JA3 A;  1DDR A;  4KAK A;  1BOZ A;  4P3R A;  1DLS A;  3FY9 X;  3M08 A;  4X5F A;  3EEL A;  3N0H A;  1M79 A;  4PSY A;  3QLX A;  3IRM A;  4NX6 A;  3S3V A;  5ECC A;  3L3R A;  1PD8 A;  3OAF A;  1KMS A;  3KGY A;  3NZ9 X;  1J3I A;  3NZD A;  3QLY A;  1RG7 A;  3JWC A;  3QLS A;  3SA1 A;  1IA1 A;  4LAH X;  1DYJ A;  2BLB A;  2D0K A;  3QYO A;  1S3W A;  4XT6 A;  3VCO A;  4QI9 A;  3FYW X;  3QL0 A;  1MVS A;  3S7A A;  3SRS X;  3JW3 A;  4QJZ D;  4Q0E A;  1U70 A;  4PDJ A;  4DPH A;  3M09 A;  3FL8 A;  1DRE A;  2W3W A;  7DFR A;  3NZC X;  4KYA A;  3R33 A;  3LG4 A;  2DRC A;  4Q0D A;  3CL9 A;  3F0Q X;  3NZB X;  1DR4 A;  1DLR A;  5HT4 A;  4X5I A;  3TD8 A;  1DRF A;  1RX2 A;  3KY8 A;  3Q1H A;  3JTW A;  3NU0 A;  4EIL A;  4QLF A;  2JYB A;  3FQ0 A;  3EIG A;  1DG8 A;  1RB2 A;  3SR5 X;  3FRD X;  4XRB A;  3FRF X;  1DYH A;  4XT5 A;  4LAE X;  1DYI A;  3IRN A;  1RF7 A;  4KJK A;  2P4G A;  1U72 A;  2HQP A;  4EJ1 A;  1DG5 A;  4QLE A;  1S3Y A;  1YHO A;  3SQY X;  3FS6 A;  5HF0 X;  2W3B A;  3NXV A;  4DFR A;  1SEJ A;  5DXV A;  1RX3 A;  5HVE A;  3GHC A;  3E0B A;  1LY3 A;  1MVT A;  1RE7 A;  3F91 A;  1PD9 A;  3NXY A;  2ZZA A;  5HF2 X;  1DHJ A;  4H96 A;  4I1N A;  4P66 A;  4XT7 A;  4M2X A;  2W9H A;  5HQZ A;  8DFR A;  4Q6A A;  3NXO A;  3JSU A;  1DG7 A;  1DRH A;  1RA8 A;  1DHF A;  4PTH A;  4KM0 A;  2W3A A;  3SRW X;  1S3V A;  3FY8 X;  4H95 A;  1RB3 A;  3K74 A;  4IXE D;  1OHJ A;  1DR1 A;  1M78 A;  3SRR X;  2W9S A;  4KM2 A;  4EIZ A;  1AO8 A;  1DR7 A;  4KFJ A;  4FHB A;  1J3K A;  1TDR A;  3GHV A;  1LUD A;  3K2H A;  1KLK A;  3QLZ A;  4I13 A;  4M6L A;  1DRB A;  3DFR A;  4P68 A;  4QLG A;  3CD2 A;  2G6V A;  1LY4 A;  5HQY A;  1RA2 A;  1DR3 A;  4X5J A;  1AOE A;  3FQV A;  5HI6 A;  2HM9 A;  3RO9 A;  2OBC A;  1RX1 A;  1DF7 A;  2BL9 A;  3TQ8 A;  3FL9 A;  3FRE X;  4G95 A;  1DRA A;  3NXX A;  3KJS A;  4FGG A;  4H98 A;  2FZH A;  2C2T A;  1J3J A;  3JWF A;  3UM8 A;  1IA4 A;  1JOM A;  4H97 A;  2B3Z A;  4KNE A;  3KJR A;  2W9G A;  4ELF A;  5CC9 A;  3NRR A;  4ELB A;  2OIP A;  2C2S A;  3K45 A;  1RX8 A;  2FZI A;  3NZ6 X;  3JW5 A;  1DR6 A;  4FGH A;  4HOF A;  1M7A A;  2QK8 A;  3D80 A;  5HSR A;  4KEB A;  2BLC A;  3NTZ A;  1AI9 A;  1KMV A;  3UM6 A;  4LEK X;  1QZF A;  3SH2 A;  1ZDR A;  5JG0 X;  2W3M A;  2W9T A;  1CZ3 A;  4HA7 A;  1DAJ A;  1DYR A;  2HXV A;  2W3V A;  4G8Z X;  4X5G A;  3QGT A;  5HPB A;  1RX7 A;  4DDR A;  4IXF X;  3TQA A;  4KBN A;  1RX4 A;  3SRU X;  3F8Y A;  1DIU A;  3F0V X;  3HJ3 A;  2LF1 A;  4KL9 A;  3QL3 A;  4GH8 A;  2INQ A;  1VJ3 A;  1RX6 A;  1DDS A;  4X5H A;  4EIG A;  1IA3 A;  1IA2 A;  3FRA X;  4DP3 A;  4LAG X;  3DRC A;  3IA4 A;  5DFR A;  3RG9 A;  4G3M A;  1HFR A;  3D84 X;  4NX7 A;  3JWK A;  4DPD A;  3DAT A;  2L28 A;  1OHK A;  4ECK A;  3EEM A;  3EEJ A;  1RX9 A;  3KFY A;  3K47 A;  3SAI A;  2CD2 A;  4IXG X;  4KY8 A;  2ITH A;  4XT8 A;  3F8Z A;  4PSS A;  3GI2 A;  4ELH A;  3F0U X;  3NXR A;  3FQF A;  4P3Q A;  4PST A;  2H2Q A;  1PDB A;  4OSG A;  4PTJ A;  3EEK A;  3OCH A;  3QFX A;  2O7P A;  3F0B X;  4HA9 A;  2AZN A;  3NXT A;  4M7V A;  3FRB X;  4HOG A;  3GYF A;  4RGC A;  3GHW A;  1RA9 A;  2D5N A;  1RD7 A;  1JUV A;  5U26 A; 
#chains in the Genus database with same CATH homology
 3I3R A;  3NZA X;  4M7U A;  1E26 A;  3CSE A;  2GD9 A;  4KJL A;  4Q67 A;  3HBB A;  4M6K A;  3S9U A;  1RA1 A;  4ELE A;  1DR5 A;  2BLA A;  5HT5 A;  1HFQ A;  5EAJ A;  1DHI A;  2FZJ A;  3ROA A;  1BZF A;  3SA2 A;  3QYL A;  2KGK A;  5ECX A;  4XT4 A;  3DAU A;  1HFP A;  3FQC A;  5FDA A;  1RX5 A;  4M6J A;  4CD2 A;  2ANO A;  3F0S X;  4TU5 X;  3IX9 A;  4QJC A;  3SGY A;  4ELG A;  4KJJ A;  1RH3 A;  1DIS A;  3DL6 A;  4HOE A;  3IA5 A;  3FYV X;  3EX8 A;  1VDR A;  1S3U A;  3F0X X;  6DFR A;  3INV A;  3I8A X;  2ANQ A;  5CCC A;  3DGA A;  4XE6 X;  3UM5 A;  5E8Q A;  5U27 A;  1RA3 A;  3TQB A;  5HVB A;  3ZPG A;  1JOL A;  3ZPC A;  4OR7 A;  3SRQ X;  3FQZ A;  2CIG A;  3QLW A;  1U71 A;  3QLR A;  1D1G A;  2XW7 A;  4KLX A;  4KY4 A;  3CLB A;  3JVX A;  3DL5 A;  3JWM A;  3DG8 A;  4KD7 A;  4XEC X;  1DR2 A;  1CD2 A;  3FQO A;  3TQ9 A;  4QHV A;  1RC4 A;  2DHF A;  3IRO A;  3QG2 A;  5HUI A;  5HSU A;  5JA3 A;  1DDR A;  4KAK A;  1BOZ A;  4P3R A;  1DLS A;  3FY9 X;  3M08 A;  4X5F A;  3EEL A;  3N0H A;  1M79 A;  4PSY A;  3QLX A;  3IRM A;  4NX6 A;  3S3V A;  5ECC A;  3L3R A;  1PD8 A;  3OAF A;  1KMS A;  3KGY A;  3NZ9 X;  1J3I A;  3NZD A;  3QLY A;  1RG7 A;  3JWC A;  3QLS A;  3SA1 A;  1IA1 A;  4LAH X;  1DYJ A;  2BLB A;  2D0K A;  3QYO A;  1S3W A;  4XT6 A;  3VCO A;  4QI9 A;  3FYW X;  3QL0 A;  1MVS A;  3S7A A;  3SRS X;  3JW3 A;  4QJZ D;  4Q0E A;  1U70 A;  4PDJ A;  4DPH A;  3M09 A;  3FL8 A;  1DRE A;  2W3W A;  7DFR A;  3NZC X;  4KYA A;  3R33 A;  3LG4 A;  2DRC A;  4Q0D A;  3CL9 A;  3F0Q X;  3NZB X;  1DR4 A;  1DLR A;  5HT4 A;  4X5I A;  3TD8 A;  1DRF A;  1RX2 A;  3KY8 A;  3Q1H A;  3JTW A;  3NU0 A;  4EIL A;  4QLF A;  2JYB A;  3FQ0 A;  3EIG A;  1DG8 A;  1RB2 A;  3SR5 X;  3FRD X;  4XRB A;  3FRF X;  1DYH A;  4XT5 A;  4LAE X;  1DYI A;  3IRN A;  1RF7 A;  4KJK A;  2P4G A;  1U72 A;  2HQP A;  4EJ1 A;  1DG5 A;  4QLE A;  1S3Y A;  1YHO A;  3SQY X;  3FS6 A;  5HF0 X;  2W3B A;  3NXV A;  4DFR A;  1SEJ A;  5DXV A;  1RX3 A;  5HVE A;  3GHC A;  3E0B A;  1LY3 A;  1MVT A;  1RE7 A;  3F91 A;  1PD9 A;  3NXY A;  2ZZA A;  5HF2 X;  1DHJ A;  4H96 A;  4I1N A;  4P66 A;  4XT7 A;  4M2X A;  2W9H A;  5HQZ A;  8DFR A;  4Q6A A;  3NXO A;  3JSU A;  1DG7 A;  1DRH A;  1RA8 A;  1DHF A;  4PTH A;  4KM0 A;  2W3A A;  3SRW X;  1S3V A;  3FY8 X;  4H95 A;  1RB3 A;  3K74 A;  4IXE D;  1OHJ A;  1DR1 A;  1M78 A;  3SRR X;  2W9S A;  4KM2 A;  4EIZ A;  1AO8 A;  1DR7 A;  4KFJ A;  4FHB A;  1J3K A;  1TDR A;  3GHV A;  1LUD A;  3K2H A;  1KLK A;  3QLZ A;  4I13 A;  4M6L A;  1DRB A;  3DFR A;  4P68 A;  4QLG A;  3CD2 A;  2G6V A;  1LY4 A;  5HQY A;  1RA2 A;  1DR3 A;  4X5J A;  1AOE A;  3FQV A;  5HI6 A;  2HM9 A;  3RO9 A;  2OBC A;  1RX1 A;  1DF7 A;  2BL9 A;  3TQ8 A;  3FL9 A;  3FRE X;  4G95 A;  1DRA A;  3NXX A;  3KJS A;  4FGG A;  4H98 A;  2FZH A;  2C2T A;  1J3J A;  3JWF A;  3UM8 A;  1IA4 A;  1JOM A;  4H97 A;  2B3Z A;  4KNE A;  3KJR A;  2W9G A;  4ELF A;  5CC9 A;  3NRR A;  4ELB A;  2OIP A;  2C2S A;  3K45 A;  1RX8 A;  2FZI A;  3NZ6 X;  3JW5 A;  1DR6 A;  4FGH A;  4HOF A;  1M7A A;  2QK8 A;  3D80 A;  5HSR A;  4KEB A;  2BLC A;  3NTZ A;  1AI9 A;  1KMV A;  3UM6 A;  4LEK X;  1QZF A;  3SH2 A;  1ZDR A;  5JG0 X;  2W3M A;  2W9T A;  1CZ3 A;  4HA7 A;  1DAJ A;  1DYR A;  2HXV A;  2W3V A;  4G8Z X;  4X5G A;  3QGT A;  5HPB A;  1RX7 A;  4DDR A;  4IXF X;  3TQA A;  4KBN A;  1RX4 A;  3SRU X;  3F8Y A;  1DIU A;  3F0V X;  3HJ3 A;  2LF1 A;  4KL9 A;  3QL3 A;  4GH8 A;  2INQ A;  1VJ3 A;  1RX6 A;  1DDS A;  4X5H A;  4EIG A;  1IA3 A;  1IA2 A;  3FRA X;  4DP3 A;  4LAG X;  3DRC A;  3IA4 A;  5DFR A;  3RG9 A;  4G3M A;  1HFR A;  3D84 X;  4NX7 A;  3JWK A;  4DPD A;  3DAT A;  2L28 A;  1OHK A;  4ECK A;  3EEM A;  3EEJ A;  1RX9 A;  3KFY A;  3K47 A;  3SAI A;  2CD2 A;  4IXG X;  4KY8 A;  2ITH A;  4XT8 A;  3F8Z A;  4PSS A;  3GI2 A;  4ELH A;  3F0U X;  3NXR A;  3FQF A;  4P3Q A;  4PST A;  2H2Q A;  1PDB A;  4OSG A;  4PTJ A;  3EEK A;  3OCH A;  3QFX A;  2O7P A;  3F0B X;  4HA9 A;  2AZN A;  3NXT A;  4M7V A;  3FRB X;  4HOG A;  3GYF A;  4RGC A;  3GHW A;  1RA9 A;  2D5N A;  1RD7 A;  1JUV A;  5U26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...