1DIUA

Dihydrofolate reductase (e.c.1.5.1.3) complex with brodimoprim-4,6-dicarboxylate
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
162
structure length
162
Chain Sequence
TAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTNVVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLAGSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a brodimoprim analogue in its complex with Lactobacillus casei dihydrofolate reductase.
pubmed doi rcsb
molecule keywords DIHYDROFOLATE REDUCTASE
molecule tags Oxidoreductase
source organism Lactobacillus casei
total genus 41
structure length 162
sequence length 162
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 1995-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 1diuA00
5HT5A 3ZPGA 5E8QA 4KYAA 4PTJA 4P3QA 3SA1A 4LAHX 4M6KA 2FZHA 4DP3A 1HFPA 2W3BA 3JVXA 2INQA 1LY4A 3JWFA 1DR3A 3D80A 1DR4A 4M6JA 4Q0DA 4KY8A 3EEMA 3QYLA 1MVTA 4H97A 8DFRA 1RH3A 4EJ1A 3KJRA 4ELFA 5HVEA 1D1GA 1M78A 1DLSA 4H98A 3SRSX 3QFXA 1RF7A 3F0UX 3IROA 3LG4A 3EELA 3IA5A 1YHOA 5HSUA 3SQYX 4XT8A 3FY9X 4QI9A 1IA4A 3QL3A 1DISA 3SRUX 3SGYA 3S7AA 3QLRA 2G6VA 3UM6A 4ELHA 1KLKA 3FYWX 4DFRA 1DIUA 3KFYA 3D84X 3VCOA 1RG7A 3NZDA 1U70A 4ECKA 1AO8A 1DHIA 3TQBA 3NXOA 3FL8A 4XT7A 3NZ6X 4LAEX 1DYJA 2HM9A 3TQ8A 3IA4A 4P66A 3GI2A 3NXXA 2FZIA 3JWKA 4I1NA 4Q0EA 4XT4A 4KM2A 4QLGA 1HFRA 1KMVA 4QJZD 4DPDA 1S3UA 3M08A 3GHWA 3F0XX 3EX8A 3QLZA 3JSUA 3JWMA 4HA9A 1DHFA 5HVBA 1SEJA 1DAJA 3FQ0A 1J3IA 1M79A 1PDBA 2B3ZA 3FRDX 5HQZA 2GD9A 1DYRA 4NX6A 1DYHA 5U26A 3K74A 4XRBA 2DHFA 3NXTA 5HSRA 5JA3A 3S3VA 5HQYA 1DYIA 3EIGA 4KAKA 2D0KA 3FQCA 3UM5A 2ANQA 1DHJA 5ECXA 4QHVA 3K47A 4Q6AA 3UM8A 4KL9A 3KJSA 4TU5X 4G95A 1RD7A 1DF7A 1S3YA 3DG8A 3FQOA 3S9UA 3OCHA 2O7PA 4LEKX 4H96A 1RX2A 4QLFA 4KM0A 2QK8A 4KJKA 2W3WA 3JTWA 2DRCA 4ELEA 4KBNA 4FHBA 3N0HA 5ECCA 5HUIA 3EEKA 5JG0X 4RGCA 2C2TA 2W3MA 1DG5A 3DAUA 3NZCX 3SR5X 3KY8A 4Q67A 2W9SA 4P3RA 4X5HA 1BZFA 2BLBA 4XT6A 4QJCA 1DR6A 1HFQA 3FQZA 4ELGA 1DRFA 3F91A 1TDRA 3JW5A 4X5FA 3CL9A 3JWCA 1MVSA 2XW7A 1PD9A 4ELBA 1RX4A 2W9TA 3DRCA 1PD8A 3JW3A 3QYOA 5HI6A 3SRRX 4KJLA 4M6LA 1QZFA 1DR2A 1U71A 3RG9A 4HOGA 2AZNA 3E0BA 2OBCA 3NTZA 3QGTA 4KJJA 3K2HA 1JOMA 5U27A 4DPHA 2BLCA 3CSEA 3ROAA 4X5JA 2L28A 2OIPA 3FY8X 5FDAA 3INVA 4PTHA 3QLWA 4FGHA 3IRNA 1OHJA 3FREX 3GHVA 4KFJA 3SH2A 1LUDA 2P4GA 3KGYA 2H2QA 1RB2A 3IX9A 5DXVA 4PSSA 2ITHA 1LY3A 1RX7A 2W3AA 3SAIA 3R33A 4PSTA 3NU0A 4QLEA 1DDSA 4CD2A 2C2SA 1RB3A 4GH8A 4KNEA 3FQFA 1CZ3A 2CD2A 1DRAA 1AI9A 4EILA 4HOFA 1DR7A 2HQPA 2LF1A 1DLRA 4M2XA 4HOEA 2FZJA 3DATA 2W3VA 4OR7A 1JOLA 3QL0A 3FRBX 3DL5A 3Q1HA 3FRAX 3GHCA 5HF0X 3TQ9A 3FL9A 1ZDRA 4PSYA 2JYBA 3QG2A 4M7VA 3NZ9X 4HA7A 5CCCA 3F0VX 3EEJA 6DFRA 3F0BX 3F8YA 4KD7A 1S3WA 3HBBA 3FS6A 4XECX 4M7UA 3NZAX 1RE7A 7DFRA 3QLXA 1RX9A 3CLBA 1RA9A 1BOZA 1RA2A 4DDRA 3TD8A 1JUVA 4IXED 3RO9A 3HJ3A 1KMSA 4X5GA 2ANOA 1J3KA 3QLSA 3NXRA 1U72A 1OHKA 3I8AX 3DFRA 1E26A 1VDRA 3F0QX 3DGAA 3I3RA 3NXYA 3K45A 4NX7A 4XT5A 4KLXA 3L3RA 1RA1A 4G8ZX 1S3VA 4OSGA 4KY4A 3NZBX 3OAFA 4G3MA 1RX8A 3ZPCA 2BLAA 4EIGA 3CD2A 1IA1A 3SA2A 5DFRA 3NRRA 5CC9A 1DRHA 4KEBA 1IA2A 3FYVX 3SRWX 4H95A 2W9GA 3NXVA 2HXVA 1RC4A 2CIGA 4X5IA 5HT4A 1DR1A 3FQVA 1J3JA 2BL9A 4IXGX 1RX6A 2ZZAA 4PDJA 1M7AA 1RA3A 1DREA 1RX1A 4EIZA 3TQAA 3IRMA 3SRQX 3F0SX 3DL6A 4P68A 3FRFX 1CD2A 4XE6X 4IXFX 1RX5A 4I13A 3QLYA 1DDRA 2KGKA 1DRBA 1IA3A 4LAGX 5EAJA 1AOEA 5HF2X 3M09A 3F8ZA 5HPBA 2W9HA 1VJ3A 2D5NA 4FGGA 1RA8A 1DG7A 1DR5A 1RX3A 1DG8A 3GYFA
chains in the Genus database with same CATH superfamily
5HT5A 3ZPGA 5E8QA 4KYAA 4PTJA 4P3QA 3SA1A 4LAHX 4M6KA 2FZHA 4DP3A 1HFPA 2W3BA 3JVXA 2INQA 1LY4A 3JWFA 1DR3A 3D80A 1DR4A 4M6JA 4Q0DA 4KY8A 3EEMA 3QYLA 1MVTA 4H97A 8DFRA 1RH3A 4EJ1A 3KJRA 4ELFA 5HVEA 1D1GA 1M78A 1DLSA 4H98A 3SRSX 3QFXA 1RF7A 3F0UX 3IROA 3LG4A 3EELA 3IA5A 1YHOA 5HSUA 3SQYX 4XT8A 3FY9X 4QI9A 1IA4A 3QL3A 1DISA 3SRUX 3SGYA 3S7AA 3QLRA 2G6VA 3UM6A 4ELHA 1KLKA 3FYWX 4DFRA 1DIUA 3KFYA 3D84X 3VCOA 1RG7A 3NZDA 1U70A 4ECKA 1AO8A 1DHIA 3TQBA 3NXOA 3FL8A 4XT7A 3NZ6X 4LAEX 1DYJA 2HM9A 3TQ8A 3IA4A 4P66A 3GI2A 3NXXA 2FZIA 3JWKA 4I1NA 4Q0EA 4XT4A 4KM2A 4QLGA 1HFRA 1KMVA 4QJZD 4DPDA 1S3UA 3M08A 3GHWA 3F0XX 3EX8A 3QLZA 3JSUA 3JWMA 4HA9A 1DHFA 5HVBA 1SEJA 1DAJA 3FQ0A 1J3IA 1M79A 1PDBA 2B3ZA 3FRDX 5HQZA 2GD9A 1DYRA 4NX6A 1DYHA 5U26A 3K74A 4XRBA 2DHFA 3NXTA 5HSRA 5JA3A 3S3VA 5HQYA 1DYIA 3EIGA 4KAKA 2D0KA 3FQCA 3UM5A 2ANQA 1DHJA 5ECXA 4QHVA 3K47A 4Q6AA 3UM8A 4KL9A 3KJSA 4TU5X 4G95A 1RD7A 1DF7A 1S3YA 3DG8A 3FQOA 3S9UA 3OCHA 2O7PA 4LEKX 4H96A 1RX2A 4QLFA 4KM0A 2QK8A 4KJKA 2W3WA 3JTWA 2DRCA 4ELEA 4KBNA 4FHBA 3N0HA 5ECCA 5HUIA 3EEKA 5JG0X 4RGCA 2C2TA 2W3MA 1DG5A 3DAUA 3NZCX 3SR5X 3KY8A 4Q67A 2W9SA 4P3RA 4X5HA 1BZFA 2BLBA 4XT6A 4QJCA 1DR6A 1HFQA 3FQZA 4ELGA 1DRFA 3F91A 1TDRA 3JW5A 4X5FA 3CL9A 3JWCA 1MVSA 2XW7A 1PD9A 4ELBA 1RX4A 2W9TA 3DRCA 1PD8A 3JW3A 3QYOA 5HI6A 3SRRX 4KJLA 4M6LA 1QZFA 1DR2A 1U71A 3RG9A 4HOGA 2AZNA 3E0BA 2OBCA 3NTZA 3QGTA 4KJJA 3K2HA 1JOMA 5U27A 4DPHA 2BLCA 3CSEA 3ROAA 4X5JA 2L28A 2OIPA 3FY8X 5FDAA 3INVA 4PTHA 3QLWA 4FGHA 3IRNA 1OHJA 3FREX 3GHVA 4KFJA 3SH2A 1LUDA 2P4GA 3KGYA 2H2QA 1RB2A 3IX9A 5DXVA 4PSSA 2ITHA 1LY3A 1RX7A 2W3AA 3SAIA 3R33A 4PSTA 3NU0A 4QLEA 1DDSA 4CD2A 2C2SA 1RB3A 4GH8A 4KNEA 3FQFA 1CZ3A 2CD2A 1DRAA 1AI9A 4EILA 4HOFA 1DR7A 2HQPA 2LF1A 1DLRA 4M2XA 4HOEA 2FZJA 3DATA 2W3VA 4OR7A 1JOLA 3QL0A 3FRBX 3DL5A 3Q1HA 3FRAX 3GHCA 5HF0X 3TQ9A 3FL9A 1ZDRA 4PSYA 2JYBA 3QG2A 4M7VA 3NZ9X 4HA7A 5CCCA 3F0VX 3EEJA 6DFRA 3F0BX 3F8YA 4KD7A 1S3WA 3HBBA 3FS6A 4XECX 4M7UA 3NZAX 1RE7A 7DFRA 3QLXA 1RX9A 3CLBA 1RA9A 1BOZA 1RA2A 4DDRA 3TD8A 1JUVA 4IXED 3RO9A 3HJ3A 1KMSA 4X5GA 2ANOA 1J3KA 3QLSA 3NXRA 1U72A 1OHKA 3I8AX 3DFRA 1E26A 1VDRA 3F0QX 3DGAA 3I3RA 3NXYA 3K45A 4NX7A 4XT5A 4KLXA 3L3RA 1RA1A 4G8ZX 1S3VA 4OSGA 4KY4A 3NZBX 3OAFA 4G3MA 1RX8A 3ZPCA 2BLAA 4EIGA 3CD2A 1IA1A 3SA2A 5DFRA 3NRRA 5CC9A 1DRHA 4KEBA 1IA2A 3FYVX 3SRWX 4H95A 2W9GA 3NXVA 2HXVA 1RC4A 2CIGA 4X5IA 5HT4A 1DR1A 3FQVA 1J3JA 2BL9A 4IXGX 1RX6A 2ZZAA 4PDJA 1M7AA 1RA3A 1DREA 1RX1A 4EIZA 3TQAA 3IRMA 3SRQX 3F0SX 3DL6A 4P68A 3FRFX 1CD2A 4XE6X 4IXFX 1RX5A 4I13A 3QLYA 1DDRA 2KGKA 1DRBA 1IA3A 4LAGX 5EAJA 1AOEA 5HF2X 3M09A 3F8ZA 5HPBA 2W9HA 1VJ3A 2D5NA 4FGGA 1RA8A 1DG7A 1DR5A 1RX3A 1DG8A 3GYFA
chains in the Genus database with same CATH topology
5HT5A 3ZPGA 5E8QA 4KYAA 4PTJA 4P3QA 3SA1A 4LAHX 4M6KA 2FZHA 4DP3A 1HFPA 2W3BA 3JVXA 2INQA 1LY4A 3JWFA 1DR3A 3D80A 1DR4A 4M6JA 4Q0DA 4KY8A 3EEMA 3QYLA 1MVTA 4H97A 8DFRA 1RH3A 4EJ1A 3KJRA 4ELFA 5HVEA 1D1GA 1M78A 1DLSA 4H98A 3SRSX 3QFXA 1RF7A 3F0UX 3IROA 3LG4A 3EELA 3IA5A 1YHOA 5HSUA 3SQYX 4XT8A 3FY9X 4QI9A 1IA4A 3QL3A 1DISA 3SRUX 3SGYA 3S7AA 3QLRA 2G6VA 3UM6A 4ELHA 1KLKA 3FYWX 4DFRA 1DIUA 3KFYA 3D84X 3VCOA 1RG7A 3NZDA 1U70A 4ECKA 1AO8A 1DHIA 3TQBA 3NXOA 3FL8A 4XT7A 3NZ6X 4LAEX 1DYJA 2HM9A 3TQ8A 3IA4A 4P66A 3GI2A 3NXXA 2FZIA 3JWKA 4I1NA 4Q0EA 4XT4A 4KM2A 4QLGA 1HFRA 1KMVA 4QJZD 4DPDA 1S3UA 3M08A 3GHWA 3F0XX 3EX8A 3QLZA 3JSUA 3JWMA 4HA9A 1DHFA 5HVBA 1SEJA 1DAJA 3FQ0A 1J3IA 1M79A 1PDBA 2B3ZA 3FRDX 5HQZA 2GD9A 1DYRA 4NX6A 1DYHA 5U26A 3K74A 4XRBA 2DHFA 3NXTA 5HSRA 5JA3A 3S3VA 5HQYA 1DYIA 3EIGA 4KAKA 2D0KA 3FQCA 3UM5A 2ANQA 1DHJA 5ECXA 4QHVA 3K47A 4Q6AA 3UM8A 4KL9A 3KJSA 4TU5X 4G95A 1RD7A 1DF7A 1S3YA 3DG8A 3FQOA 3S9UA 3OCHA 2O7PA 4LEKX 4H96A 1RX2A 4QLFA 4KM0A 2QK8A 4KJKA 2W3WA 3JTWA 2DRCA 4ELEA 4KBNA 4FHBA 3N0HA 5ECCA 5HUIA 3EEKA 5JG0X 4RGCA 2C2TA 2W3MA 1DG5A 3DAUA 3NZCX 3SR5X 3KY8A 4Q67A 2W9SA 4P3RA 4X5HA 1BZFA 2BLBA 4XT6A 4QJCA 1DR6A 1HFQA 3FQZA 4ELGA 1DRFA 3F91A 1TDRA 3JW5A 4X5FA 3CL9A 3JWCA 1MVSA 2XW7A 1PD9A 4ELBA 1RX4A 2W9TA 3DRCA 1PD8A 3JW3A 3QYOA 5HI6A 3SRRX 4KJLA 4M6LA 1QZFA 1DR2A 1U71A 3RG9A 4HOGA 2AZNA 3E0BA 2OBCA 3NTZA 3QGTA 4KJJA 3K2HA 1JOMA 5U27A 4DPHA 2BLCA 3CSEA 3ROAA 4X5JA 2L28A 2OIPA 3FY8X 5FDAA 3INVA 4PTHA 3QLWA 4FGHA 3IRNA 1OHJA 3FREX 3GHVA 4KFJA 3SH2A 1LUDA 2P4GA 3KGYA 2H2QA 1RB2A 3IX9A 5DXVA 4PSSA 2ITHA 1LY3A 1RX7A 2W3AA 3SAIA 3R33A 4PSTA 3NU0A 4QLEA 1DDSA 4CD2A 2C2SA 1RB3A 4GH8A 4KNEA 3FQFA 1CZ3A 2CD2A 1DRAA 1AI9A 4EILA 4HOFA 1DR7A 2HQPA 2LF1A 1DLRA 4M2XA 4HOEA 2FZJA 3DATA 2W3VA 4OR7A 1JOLA 3QL0A 3FRBX 3DL5A 3Q1HA 3FRAX 3GHCA 5HF0X 3TQ9A 3FL9A 1ZDRA 4PSYA 2JYBA 3QG2A 4M7VA 3NZ9X 4HA7A 5CCCA 3F0VX 3EEJA 6DFRA 3F0BX 3F8YA 4KD7A 1S3WA 3HBBA 3FS6A 4XECX 4M7UA 3NZAX 1RE7A 7DFRA 3QLXA 1RX9A 3CLBA 1RA9A 1BOZA 1RA2A 4DDRA 3TD8A 1JUVA 4IXED 3RO9A 3HJ3A 1KMSA 4X5GA 2ANOA 1J3KA 3QLSA 3NXRA 1U72A 1OHKA 3I8AX 3DFRA 1E26A 1VDRA 3F0QX 3DGAA 3I3RA 3NXYA 3K45A 4NX7A 4XT5A 4KLXA 3L3RA 1RA1A 4G8ZX 1S3VA 4OSGA 4KY4A 3NZBX 3OAFA 4G3MA 1RX8A 3ZPCA 2BLAA 4EIGA 3CD2A 1IA1A 3SA2A 5DFRA 3NRRA 5CC9A 1DRHA 4KEBA 1IA2A 3FYVX 3SRWX 4H95A 2W9GA 3NXVA 2HXVA 1RC4A 2CIGA 4X5IA 5HT4A 1DR1A 3FQVA 1J3JA 2BL9A 4IXGX 1RX6A 2ZZAA 4PDJA 1M7AA 1RA3A 1DREA 1RX1A 4EIZA 3TQAA 3IRMA 3SRQX 3F0SX 3DL6A 4P68A 3FRFX 1CD2A 4XE6X 4IXFX 1RX5A 4I13A 3QLYA 1DDRA 2KGKA 1DRBA 1IA3A 4LAGX 5EAJA 1AOEA 5HF2X 3M09A 3F8ZA 5HPBA 2W9HA 1VJ3A 2D5NA 4FGGA 1RA8A 1DG7A 1DR5A 1RX3A 1DG8A 3GYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HT5 A;  3ZPG A;  5E8Q A;  4KYA A;  4PTJ A;  4P3Q A;  3SA1 A;  4LAH X;  4M6K A;  2FZH A;  4DP3 A;  1HFP A;  2W3B A;  3JVX A;  2INQ A;  1LY4 A;  3JWF A;  1DR3 A;  3D80 A;  1DR4 A;  4M6J A;  4Q0D A;  4KY8 A;  3EEM A;  3QYL A;  1MVT A;  4H97 A;  8DFR A;  1RH3 A;  4EJ1 A;  3KJR A;  4ELF A;  5HVE A;  1D1G A;  1M78 A;  1DLS A;  4H98 A;  3SRS X;  3QFX A;  1RF7 A;  3F0U X;  3IRO A;  3LG4 A;  3EEL A;  3IA5 A;  1YHO A;  5HSU A;  3SQY X;  4XT8 A;  3FY9 X;  4QI9 A;  1IA4 A;  3QL3 A;  1DIS A;  3SRU X;  3SGY A;  3S7A A;  3QLR A;  2G6V A;  3UM6 A;  4ELH A;  1KLK A;  3FYW X;  4DFR A;  1DIU A;  3KFY A;  3D84 X;  3VCO A;  1RG7 A;  3NZD A;  1U70 A;  4ECK A;  1AO8 A;  1DHI A;  3TQB A;  3NXO A;  3FL8 A;  4XT7 A;  3NZ6 X;  4LAE X;  1DYJ A;  2HM9 A;  3TQ8 A;  3IA4 A;  4P66 A;  3GI2 A;  3NXX A;  2FZI A;  3JWK A;  4I1N A;  4Q0E A;  4XT4 A;  4KM2 A;  4QLG A;  1HFR A;  1KMV A;  4QJZ D;  4DPD A;  1S3U A;  3M08 A;  3GHW A;  3F0X X;  3EX8 A;  3QLZ A;  3JSU A;  3JWM A;  4HA9 A;  1DHF A;  5HVB A;  1SEJ A;  1DAJ A;  3FQ0 A;  1J3I A;  1M79 A;  1PDB A;  2B3Z A;  3FRD X;  5HQZ A;  2GD9 A;  1DYR A;  4NX6 A;  1DYH A;  5U26 A;  3K74 A;  4XRB A;  2DHF A;  3NXT A;  5HSR A;  5JA3 A;  3S3V A;  5HQY A;  1DYI A;  3EIG A;  4KAK A;  2D0K A;  3FQC A;  3UM5 A;  2ANQ A;  1DHJ A;  5ECX A;  4QHV A;  3K47 A;  4Q6A A;  3UM8 A;  4KL9 A;  3KJS A;  4TU5 X;  4G95 A;  1RD7 A;  1DF7 A;  1S3Y A;  3DG8 A;  3FQO A;  3S9U A;  3OCH A;  2O7P A;  4LEK X;  4H96 A;  1RX2 A;  4QLF A;  4KM0 A;  2QK8 A;  4KJK A;  2W3W A;  3JTW A;  2DRC A;  4ELE A;  4KBN A;  4FHB A;  3N0H A;  5ECC A;  5HUI A;  3EEK A;  5JG0 X;  4RGC A;  2C2T A;  2W3M A;  1DG5 A;  3DAU A;  3NZC X;  3SR5 X;  3KY8 A;  4Q67 A;  2W9S A;  4P3R A;  4X5H A;  1BZF A;  2BLB A;  4XT6 A;  4QJC A;  1DR6 A;  1HFQ A;  3FQZ A;  4ELG A;  1DRF A;  3F91 A;  1TDR A;  3JW5 A;  4X5F A;  3CL9 A;  3JWC A;  1MVS A;  2XW7 A;  1PD9 A;  4ELB A;  1RX4 A;  2W9T A;  3DRC A;  1PD8 A;  3JW3 A;  3QYO A;  5HI6 A;  3SRR X;  4KJL A;  4M6L A;  1QZF A;  1DR2 A;  1U71 A;  3RG9 A;  4HOG A;  2AZN A;  3E0B A;  2OBC A;  3NTZ A;  3QGT A;  4KJJ A;  3K2H A;  1JOM A;  5U27 A;  4DPH A;  2BLC A;  3CSE A;  3ROA A;  4X5J A;  2L28 A;  2OIP A;  3FY8 X;  5FDA A;  3INV A;  4PTH A;  3QLW A;  4FGH A;  3IRN A;  1OHJ A;  3FRE X;  3GHV A;  4KFJ A;  3SH2 A;  1LUD A;  2P4G A;  3KGY A;  2H2Q A;  1RB2 A;  3IX9 A;  5DXV A;  4PSS A;  2ITH A;  1LY3 A;  1RX7 A;  2W3A A;  3SAI A;  3R33 A;  4PST A;  3NU0 A;  4QLE A;  1DDS A;  4CD2 A;  2C2S A;  1RB3 A;  4GH8 A;  4KNE A;  3FQF A;  1CZ3 A;  2CD2 A;  1DRA A;  1AI9 A;  4EIL A;  4HOF A;  1DR7 A;  2HQP A;  2LF1 A;  1DLR A;  4M2X A;  4HOE A;  2FZJ A;  3DAT A;  2W3V A;  4OR7 A;  1JOL A;  3QL0 A;  3FRB X;  3DL5 A;  3Q1H A;  3FRA X;  3GHC A;  5HF0 X;  3TQ9 A;  3FL9 A;  1ZDR A;  4PSY A;  2JYB A;  3QG2 A;  4M7V A;  3NZ9 X;  4HA7 A;  5CCC A;  3F0V X;  3EEJ A;  6DFR A;  3F0B X;  3F8Y A;  4KD7 A;  1S3W A;  3HBB A;  3FS6 A;  4XEC X;  4M7U A;  3NZA X;  1RE7 A;  7DFR A;  3QLX A;  1RX9 A;  3CLB A;  1RA9 A;  1BOZ A;  1RA2 A;  4DDR A;  3TD8 A;  1JUV A;  4IXE D;  3RO9 A;  3HJ3 A;  1KMS A;  4X5G A;  2ANO A;  1J3K A;  3QLS A;  3NXR A;  1U72 A;  1OHK A;  3I8A X;  3DFR A;  1E26 A;  1VDR A;  3F0Q X;  3DGA A;  3I3R A;  3NXY A;  3K45 A;  4NX7 A;  4XT5 A;  4KLX A;  3L3R A;  1RA1 A;  4G8Z X;  1S3V A;  4OSG A;  4KY4 A;  3NZB X;  3OAF A;  4G3M A;  1RX8 A;  3ZPC A;  2BLA A;  4EIG A;  3CD2 A;  1IA1 A;  3SA2 A;  5DFR A;  3NRR A;  5CC9 A;  1DRH A;  4KEB A;  1IA2 A;  3FYV X;  3SRW X;  4H95 A;  2W9G A;  3NXV A;  2HXV A;  1RC4 A;  2CIG A;  4X5I A;  5HT4 A;  1DR1 A;  3FQV A;  1J3J A;  2BL9 A;  4IXG X;  1RX6 A;  2ZZA A;  4PDJ A;  1M7A A;  1RA3 A;  1DRE A;  1RX1 A;  4EIZ A;  3TQA A;  3IRM A;  3SRQ X;  3F0S X;  3DL6 A;  4P68 A;  3FRF X;  1CD2 A;  4XE6 X;  4IXF X;  1RX5 A;  4I13 A;  3QLY A;  1DDR A;  2KGK A;  1DRB A;  1IA3 A;  4LAG X;  5EAJ A;  1AOE A;  5HF2 X;  3M09 A;  3F8Z A;  5HPB A;  2W9H A;  1VJ3 A;  2D5N A;  4FGG A;  1RA8 A;  1DG7 A;  1DR5 A;  1RX3 A;  1DG8 A;  3GYF A; 
#chains in the Genus database with same CATH topology
 5HT5 A;  3ZPG A;  5E8Q A;  4KYA A;  4PTJ A;  4P3Q A;  3SA1 A;  4LAH X;  4M6K A;  2FZH A;  4DP3 A;  1HFP A;  2W3B A;  3JVX A;  2INQ A;  1LY4 A;  3JWF A;  1DR3 A;  3D80 A;  1DR4 A;  4M6J A;  4Q0D A;  4KY8 A;  3EEM A;  3QYL A;  1MVT A;  4H97 A;  8DFR A;  1RH3 A;  4EJ1 A;  3KJR A;  4ELF A;  5HVE A;  1D1G A;  1M78 A;  1DLS A;  4H98 A;  3SRS X;  3QFX A;  1RF7 A;  3F0U X;  3IRO A;  3LG4 A;  3EEL A;  3IA5 A;  1YHO A;  5HSU A;  3SQY X;  4XT8 A;  3FY9 X;  4QI9 A;  1IA4 A;  3QL3 A;  1DIS A;  3SRU X;  3SGY A;  3S7A A;  3QLR A;  2G6V A;  3UM6 A;  4ELH A;  1KLK A;  3FYW X;  4DFR A;  1DIU A;  3KFY A;  3D84 X;  3VCO A;  1RG7 A;  3NZD A;  1U70 A;  4ECK A;  1AO8 A;  1DHI A;  3TQB A;  3NXO A;  3FL8 A;  4XT7 A;  3NZ6 X;  4LAE X;  1DYJ A;  2HM9 A;  3TQ8 A;  3IA4 A;  4P66 A;  3GI2 A;  3NXX A;  2FZI A;  3JWK A;  4I1N A;  4Q0E A;  4XT4 A;  4KM2 A;  4QLG A;  1HFR A;  1KMV A;  4QJZ D;  4DPD A;  1S3U A;  3M08 A;  3GHW A;  3F0X X;  3EX8 A;  3QLZ A;  3JSU A;  3JWM A;  4HA9 A;  1DHF A;  5HVB A;  1SEJ A;  1DAJ A;  3FQ0 A;  1J3I A;  1M79 A;  1PDB A;  2B3Z A;  3FRD X;  5HQZ A;  2GD9 A;  1DYR A;  4NX6 A;  1DYH A;  5U26 A;  3K74 A;  4XRB A;  2DHF A;  3NXT A;  5HSR A;  5JA3 A;  3S3V A;  5HQY A;  1DYI A;  3EIG A;  4KAK A;  2D0K A;  3FQC A;  3UM5 A;  2ANQ A;  1DHJ A;  5ECX A;  4QHV A;  3K47 A;  4Q6A A;  3UM8 A;  4KL9 A;  3KJS A;  4TU5 X;  4G95 A;  1RD7 A;  1DF7 A;  1S3Y A;  3DG8 A;  3FQO A;  3S9U A;  3OCH A;  2O7P A;  4LEK X;  4H96 A;  1RX2 A;  4QLF A;  4KM0 A;  2QK8 A;  4KJK A;  2W3W A;  3JTW A;  2DRC A;  4ELE A;  4KBN A;  4FHB A;  3N0H A;  5ECC A;  5HUI A;  3EEK A;  5JG0 X;  4RGC A;  2C2T A;  2W3M A;  1DG5 A;  3DAU A;  3NZC X;  3SR5 X;  3KY8 A;  4Q67 A;  2W9S A;  4P3R A;  4X5H A;  1BZF A;  2BLB A;  4XT6 A;  4QJC A;  1DR6 A;  1HFQ A;  3FQZ A;  4ELG A;  1DRF A;  3F91 A;  1TDR A;  3JW5 A;  4X5F A;  3CL9 A;  3JWC A;  1MVS A;  2XW7 A;  1PD9 A;  4ELB A;  1RX4 A;  2W9T A;  3DRC A;  1PD8 A;  3JW3 A;  3QYO A;  5HI6 A;  3SRR X;  4KJL A;  4M6L A;  1QZF A;  1DR2 A;  1U71 A;  3RG9 A;  4HOG A;  2AZN A;  3E0B A;  2OBC A;  3NTZ A;  3QGT A;  4KJJ A;  3K2H A;  1JOM A;  5U27 A;  4DPH A;  2BLC A;  3CSE A;  3ROA A;  4X5J A;  2L28 A;  2OIP A;  3FY8 X;  5FDA A;  3INV A;  4PTH A;  3QLW A;  4FGH A;  3IRN A;  1OHJ A;  3FRE X;  3GHV A;  4KFJ A;  3SH2 A;  1LUD A;  2P4G A;  3KGY A;  2H2Q A;  1RB2 A;  3IX9 A;  5DXV A;  4PSS A;  2ITH A;  1LY3 A;  1RX7 A;  2W3A A;  3SAI A;  3R33 A;  4PST A;  3NU0 A;  4QLE A;  1DDS A;  4CD2 A;  2C2S A;  1RB3 A;  4GH8 A;  4KNE A;  3FQF A;  1CZ3 A;  2CD2 A;  1DRA A;  1AI9 A;  4EIL A;  4HOF A;  1DR7 A;  2HQP A;  2LF1 A;  1DLR A;  4M2X A;  4HOE A;  2FZJ A;  3DAT A;  2W3V A;  4OR7 A;  1JOL A;  3QL0 A;  3FRB X;  3DL5 A;  3Q1H A;  3FRA X;  3GHC A;  5HF0 X;  3TQ9 A;  3FL9 A;  1ZDR A;  4PSY A;  2JYB A;  3QG2 A;  4M7V A;  3NZ9 X;  4HA7 A;  5CCC A;  3F0V X;  3EEJ A;  6DFR A;  3F0B X;  3F8Y A;  4KD7 A;  1S3W A;  3HBB A;  3FS6 A;  4XEC X;  4M7U A;  3NZA X;  1RE7 A;  7DFR A;  3QLX A;  1RX9 A;  3CLB A;  1RA9 A;  1BOZ A;  1RA2 A;  4DDR A;  3TD8 A;  1JUV A;  4IXE D;  3RO9 A;  3HJ3 A;  1KMS A;  4X5G A;  2ANO A;  1J3K A;  3QLS A;  3NXR A;  1U72 A;  1OHK A;  3I8A X;  3DFR A;  1E26 A;  1VDR A;  3F0Q X;  3DGA A;  3I3R A;  3NXY A;  3K45 A;  4NX7 A;  4XT5 A;  4KLX A;  3L3R A;  1RA1 A;  4G8Z X;  1S3V A;  4OSG A;  4KY4 A;  3NZB X;  3OAF A;  4G3M A;  1RX8 A;  3ZPC A;  2BLA A;  4EIG A;  3CD2 A;  1IA1 A;  3SA2 A;  5DFR A;  3NRR A;  5CC9 A;  1DRH A;  4KEB A;  1IA2 A;  3FYV X;  3SRW X;  4H95 A;  2W9G A;  3NXV A;  2HXV A;  1RC4 A;  2CIG A;  4X5I A;  5HT4 A;  1DR1 A;  3FQV A;  1J3J A;  2BL9 A;  4IXG X;  1RX6 A;  2ZZA A;  4PDJ A;  1M7A A;  1RA3 A;  1DRE A;  1RX1 A;  4EIZ A;  3TQA A;  3IRM A;  3SRQ X;  3F0S X;  3DL6 A;  4P68 A;  3FRF X;  1CD2 A;  4XE6 X;  4IXF X;  1RX5 A;  4I13 A;  3QLY A;  1DDR A;  2KGK A;  1DRB A;  1IA3 A;  4LAG X;  5EAJ A;  1AOE A;  5HF2 X;  3M09 A;  3F8Z A;  5HPB A;  2W9H A;  1VJ3 A;  2D5N A;  4FGG A;  1RA8 A;  1DG7 A;  1DR5 A;  1RX3 A;  1DG8 A;  3GYF A; 
#chains in the Genus database with same CATH homology
 5HT5 A;  3ZPG A;  5E8Q A;  4KYA A;  4PTJ A;  4P3Q A;  3SA1 A;  4LAH X;  4M6K A;  2FZH A;  4DP3 A;  1HFP A;  2W3B A;  3JVX A;  2INQ A;  1LY4 A;  3JWF A;  1DR3 A;  3D80 A;  1DR4 A;  4M6J A;  4Q0D A;  4KY8 A;  3EEM A;  3QYL A;  1MVT A;  4H97 A;  8DFR A;  1RH3 A;  4EJ1 A;  3KJR A;  4ELF A;  5HVE A;  1D1G A;  1M78 A;  1DLS A;  4H98 A;  3SRS X;  3QFX A;  1RF7 A;  3F0U X;  3IRO A;  3LG4 A;  3EEL A;  3IA5 A;  1YHO A;  5HSU A;  3SQY X;  4XT8 A;  3FY9 X;  4QI9 A;  1IA4 A;  3QL3 A;  1DIS A;  3SRU X;  3SGY A;  3S7A A;  3QLR A;  2G6V A;  3UM6 A;  4ELH A;  1KLK A;  3FYW X;  4DFR A;  1DIU A;  3KFY A;  3D84 X;  3VCO A;  1RG7 A;  3NZD A;  1U70 A;  4ECK A;  1AO8 A;  1DHI A;  3TQB A;  3NXO A;  3FL8 A;  4XT7 A;  3NZ6 X;  4LAE X;  1DYJ A;  2HM9 A;  3TQ8 A;  3IA4 A;  4P66 A;  3GI2 A;  3NXX A;  2FZI A;  3JWK A;  4I1N A;  4Q0E A;  4XT4 A;  4KM2 A;  4QLG A;  1HFR A;  1KMV A;  4QJZ D;  4DPD A;  1S3U A;  3M08 A;  3GHW A;  3F0X X;  3EX8 A;  3QLZ A;  3JSU A;  3JWM A;  4HA9 A;  1DHF A;  5HVB A;  1SEJ A;  1DAJ A;  3FQ0 A;  1J3I A;  1M79 A;  1PDB A;  2B3Z A;  3FRD X;  5HQZ A;  2GD9 A;  1DYR A;  4NX6 A;  1DYH A;  5U26 A;  3K74 A;  4XRB A;  2DHF A;  3NXT A;  5HSR A;  5JA3 A;  3S3V A;  5HQY A;  1DYI A;  3EIG A;  4KAK A;  2D0K A;  3FQC A;  3UM5 A;  2ANQ A;  1DHJ A;  5ECX A;  4QHV A;  3K47 A;  4Q6A A;  3UM8 A;  4KL9 A;  3KJS A;  4TU5 X;  4G95 A;  1RD7 A;  1DF7 A;  1S3Y A;  3DG8 A;  3FQO A;  3S9U A;  3OCH A;  2O7P A;  4LEK X;  4H96 A;  1RX2 A;  4QLF A;  4KM0 A;  2QK8 A;  4KJK A;  2W3W A;  3JTW A;  2DRC A;  4ELE A;  4KBN A;  4FHB A;  3N0H A;  5ECC A;  5HUI A;  3EEK A;  5JG0 X;  4RGC A;  2C2T A;  2W3M A;  1DG5 A;  3DAU A;  3NZC X;  3SR5 X;  3KY8 A;  4Q67 A;  2W9S A;  4P3R A;  4X5H A;  1BZF A;  2BLB A;  4XT6 A;  4QJC A;  1DR6 A;  1HFQ A;  3FQZ A;  4ELG A;  1DRF A;  3F91 A;  1TDR A;  3JW5 A;  4X5F A;  3CL9 A;  3JWC A;  1MVS A;  2XW7 A;  1PD9 A;  4ELB A;  1RX4 A;  2W9T A;  3DRC A;  1PD8 A;  3JW3 A;  3QYO A;  5HI6 A;  3SRR X;  4KJL A;  4M6L A;  1QZF A;  1DR2 A;  1U71 A;  3RG9 A;  4HOG A;  2AZN A;  3E0B A;  2OBC A;  3NTZ A;  3QGT A;  4KJJ A;  3K2H A;  1JOM A;  5U27 A;  4DPH A;  2BLC A;  3CSE A;  3ROA A;  4X5J A;  2L28 A;  2OIP A;  3FY8 X;  5FDA A;  3INV A;  4PTH A;  3QLW A;  4FGH A;  3IRN A;  1OHJ A;  3FRE X;  3GHV A;  4KFJ A;  3SH2 A;  1LUD A;  2P4G A;  3KGY A;  2H2Q A;  1RB2 A;  3IX9 A;  5DXV A;  4PSS A;  2ITH A;  1LY3 A;  1RX7 A;  2W3A A;  3SAI A;  3R33 A;  4PST A;  3NU0 A;  4QLE A;  1DDS A;  4CD2 A;  2C2S A;  1RB3 A;  4GH8 A;  4KNE A;  3FQF A;  1CZ3 A;  2CD2 A;  1DRA A;  1AI9 A;  4EIL A;  4HOF A;  1DR7 A;  2HQP A;  2LF1 A;  1DLR A;  4M2X A;  4HOE A;  2FZJ A;  3DAT A;  2W3V A;  4OR7 A;  1JOL A;  3QL0 A;  3FRB X;  3DL5 A;  3Q1H A;  3FRA X;  3GHC A;  5HF0 X;  3TQ9 A;  3FL9 A;  1ZDR A;  4PSY A;  2JYB A;  3QG2 A;  4M7V A;  3NZ9 X;  4HA7 A;  5CCC A;  3F0V X;  3EEJ A;  6DFR A;  3F0B X;  3F8Y A;  4KD7 A;  1S3W A;  3HBB A;  3FS6 A;  4XEC X;  4M7U A;  3NZA X;  1RE7 A;  7DFR A;  3QLX A;  1RX9 A;  3CLB A;  1RA9 A;  1BOZ A;  1RA2 A;  4DDR A;  3TD8 A;  1JUV A;  4IXE D;  3RO9 A;  3HJ3 A;  1KMS A;  4X5G A;  2ANO A;  1J3K A;  3QLS A;  3NXR A;  1U72 A;  1OHK A;  3I8A X;  3DFR A;  1E26 A;  1VDR A;  3F0Q X;  3DGA A;  3I3R A;  3NXY A;  3K45 A;  4NX7 A;  4XT5 A;  4KLX A;  3L3R A;  1RA1 A;  4G8Z X;  1S3V A;  4OSG A;  4KY4 A;  3NZB X;  3OAF A;  4G3M A;  1RX8 A;  3ZPC A;  2BLA A;  4EIG A;  3CD2 A;  1IA1 A;  3SA2 A;  5DFR A;  3NRR A;  5CC9 A;  1DRH A;  4KEB A;  1IA2 A;  3FYV X;  3SRW X;  4H95 A;  2W9G A;  3NXV A;  2HXV A;  1RC4 A;  2CIG A;  4X5I A;  5HT4 A;  1DR1 A;  3FQV A;  1J3J A;  2BL9 A;  4IXG X;  1RX6 A;  2ZZA A;  4PDJ A;  1M7A A;  1RA3 A;  1DRE A;  1RX1 A;  4EIZ A;  3TQA A;  3IRM A;  3SRQ X;  3F0S X;  3DL6 A;  4P68 A;  3FRF X;  1CD2 A;  4XE6 X;  4IXF X;  1RX5 A;  4I13 A;  3QLY A;  1DDR A;  2KGK A;  1DRB A;  1IA3 A;  4LAG X;  5EAJ A;  1AOE A;  5HF2 X;  3M09 A;  3F8Z A;  5HPB A;  2W9H A;  1VJ3 A;  2D5N A;  4FGG A;  1RA8 A;  1DG7 A;  1DR5 A;  1RX3 A;  1DG8 A;  3GYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...