The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
29
|
sequence length |
104
|
structure length |
104
|
Chain Sequence |
SVSILRSSVNHREVDEAIDNILRYTNSTEQQFLEAMESTGGRVRIAIAKLLSKQTSGGSGGSKLGGSGGSRKDLSVKGMLYDSDSQQILNRLRERVSGSTAQSA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms
doi rcsb |
| molecule tags |
Dna binding protein
|
| source organism |
Schizosaccharomyces pombe, synthetic
|
| molecule keywords |
DNA-binding protein rap1, Telomere length regulator taz1
|
| total genus |
29
|
| structure length |
104
|
| sequence length |
104
|
| ec nomenclature | |
| pdb deposition date | 2010-09-19 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Ribosomal Protein S4 Delta 41; Chain A, domain 1 | Ribosomal Protein S4 Delta 41; Chain A, domain 1 |
#chains in the Genus database with same CATH superfamily 2L3N A; #chains in the Genus database with same CATH topology 2HHH D; 2UXD D; 1N34 D; 4X62 D; 1N36 D; 4LF7 D; 2E5L D; 4DV1 D; 4KHP D; 1C05 A; 2L3N A; 4DR3 D; 4JI6 D; 4DUY D; 1J5E D; 3OTO D; 1IBL D; 3T1H D; 4JYA D; 4LF6 D; 4JI8 D; 2VQF D; 1HR0 D; 4LF9 D; 2F4V D; 2UUA D; 4YHH D; 4DV5 D; 4DR1 D; 5LMU D; 5BR8 D; 2UU9 D; 1XMO D; 2UUB D; 2VQE D; 4YY3 D; 4LF8 D; 4DR7 D; 1IBK D; 4LFC D; 5LMN D; 1XNR D; 4X65 D; 4DR2 D; 4B3M D; 4B3S D; 4JI7 D; 4DV2 D; 4OX9 D; 4GKJ D; 1N32 D; 1I94 D; 4X64 D; 4NXN D; 4DV7 D; 1N33 D; 4LFB D; 4JI4 D; 4AQY D; 1FJG D; 4DV6 D; 4JI0 D; 4B3R D; 1HNW D; 4JI1 D; 4DR4 D; 4LF5 D; 4DV4 D; 4LFA D; 4DR5 D; 4K0K D; 1XNQ D; 4JI3 D; 2ZM6 D; 4JI5 D; 4GKK D; 4JV5 D; 5IWA D; 1XMQ D; 3T1Y D; 4NXM D; 4DV3 D; 4DUZ D; 4JI2 D; 2UXC D; 2UXB D; 4LF4 D; 1C06 A; 1IBM D; 2UUC D; 4B3T D; 1HNX D; 1FKA D; 4DV0 D; 4DR6 D; 4X66 D; 1HNZ D; #chains in the Genus database with same CATH homology 2HHH D; 2UXD D; 1N34 D; 4X62 D; 1N36 D; 4LF7 D; 2E5L D; 4DV1 D; 4KHP D; 1C05 A; 2L3N A; 4DR3 D; 4JI6 D; 4DUY D; 1J5E D; 3OTO D; 1IBL D; 3T1H D; 4JYA D; 4LF6 D; 4JI8 D; 2VQF D; 1HR0 D; 4LF9 D; 2F4V D; 2UUA D; 4YHH D; 4DV5 D; 4DR1 D; 5LMU D; 5BR8 D; 2UU9 D; 1XMO D; 2UUB D; 2VQE D; 4YY3 D; 4LF8 D; 4DR7 D; 1IBK D; 4LFC D; 5LMN D; 1XNR D; 4X65 D; 4DR2 D; 4B3M D; 4B3S D; 4JI7 D; 4DV2 D; 4OX9 D; 4GKJ D; 1N32 D; 1I94 D; 4X64 D; 4NXN D; 4DV7 D; 1N33 D; 4LFB D; 4JI4 D; 4AQY D; 1FJG D; 4DV6 D; 4JI0 D; 4B3R D; 1HNW D; 4JI1 D; 4DR4 D; 4LF5 D; 4DV4 D; 4LFA D; 4DR5 D; 4K0K D; 1XNQ D; 4JI3 D; 2ZM6 D; 4JI5 D; 4GKK D; 4JV5 D; 5IWA D; 1XMQ D; 3T1Y D; 4NXM D; 4DV3 D; 4DUZ D; 4JI2 D; 2UXC D; 2UXB D; 4LF4 D; 1C06 A; 1IBM D; 2UUC D; 4B3T D; 1HNX D; 1FKA D; 4DV0 D; 4DR6 D; 4X66 D; 1HNZ D;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
