1FKAD

Structure of functionally activated small ribosomal subunit at 3.3 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
161
structure length
161
Chain Sequence
RRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structure of functionally activated small ribosomal subunit at 3.3 angstroms resolution.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2000-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 1fkaD01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 1fkaD02
4B3TD 4KHPD 1H3FA 1FKAD 4DV1D 1HNZD 1HNXD 2ISTA 4LF4D 1DM9A 1P9KA 1IBKD 4NXND 3T1HD 4DR4D 4LF9D 1VIOA 2UXBD 4X66D 4K0KD 4YY3D 2ZM6D 4B3MD 4YHHD 2JANA 4GKKD 1H3EA 5LMUD 1IBMD 1C05A 4X65D 4DUZD 2VQFD 4DR5D 4LFCD 4DV3D 4X62D 4DV7D 4DR1D 4OX9D 4JI2D 4LF5D 1KSVA 4JI8D 1HR0D 5IWAD 1XNRD 3T1YD 2UUCD 4JI6D 1KSLA 4JYAD 4DUYD 4DR2D 1C06A 4JI5D 1XNQD 3DH3A 2UXDD 3OTOD 4AQYD 4X64D 5LMND 4JI3D 4DV0D 4LF8D 1N36D 2UU9D 4LF6D 2HHHD 1JH3A 2UXCD 2UUAD 4JI0D 1IBLD 4B3RD 4DR3D 4DR7D 3HP7A 1XMQD 4LF7D 4LGTA 4NXMD 1J5ED 4DV6D 1KSKA 4DV2D 4JI4D 4GKJD 1N34D 2VQED 4DR6D 4JI7D 1I94D 1N33D 3KBGA 1FJGD 4B3SD 2E5LD 4LFAD 1XMOD 4OUDA 2K6PA 4DV4D 4DV5D 2KTLA 4JV5D 1HNWD 4JI1D 2F4VD 5BR8D 4LFBD 2UUBD 1N32D
chains in the Genus database with same CATH superfamily
4B3TD 4KHPD 1H3FA 1FKAD 4DV1D 1HNZD 2LQ7A 1HNXD 3ONHA 5FLXE 2ISTA 4LF4D 1DM9A 5LL6S 1P9KA 5A2QE 1IBKD 4NXND 1Y8XB 3T1HD 4DR4D 5FQ2B 3KYCB 4LF9D 1VIOA 2UXBD 4X66D 4K0KD 4YY3D 2ZM6D 4B3MD 4YHHD 2JANA 3FN1A 4GKKD 1H3EA 5LMUD 3JAME 1IBMD 1C05A 4X65D 4DUZD 2VQFD 4DR5D 4LFCD 4DV3D 4X62D 4DV7D 4DR1D 4OX9D 3J80E 4JI2D 4LF5D 1KSVA 4JI8D 1HR0D 5IWAD 2L3NA 3T1YD 1XNRD 2NVUB 2UUCD 4JI6D 1KSLA 1Y8RB 4NNJA 4JYAD 4DUYD 4DR2D 3J81E 4W5VB 1C06A 4JI5D 1XNQD 3DH3A 2UXDD 3OTOD 4II3A 3ONGA 4AQYD 4X64D 5LMND 5KNLA 4JI3D 4DV0D 4LF8D 1N36D 2UU9D 4LF6D 2HHHD 1JH3A 2UXCD 2UUAD 4JI0D 3J7AF 1IBLD 4B3RD 4DR3D 4DR7D 3CMMA 3HP7A 1XMQD 4LF7D 4LGTA 4NXMD 1J5ED 4DV6D 1KSKA 4DV2D 4JI4D 4GKJD 1N34D 2VQED 4DR6D 1Y8QB 5IT9E 4JI7D 1I94D 1N33D 3KBGA 1FJGD 4II2A 4B3SD 2I1SA 3KYDB 2E5LD 4LFAD 1XMOD 4OUDA 2K6PA 4DV4D 4DV5D 2KTLA 4JV5D 1HNWD 4JI1D 2F4VD 5BR8D 4LFBD 2UUBD 2ZTBA 1N32D
chains in the Genus database with same CATH topology
4B3TD 4KHPD 1H3FA 1FKAD 4DV1D 1HNZD 1HNXD 2ISTA 4LF4D 1DM9A 1P9KA 1IBKD 4NXND 3T1HD 4DR4D 4LF9D 1VIOA 2UXBD 4X66D 4K0KD 4YY3D 2ZM6D 4B3MD 4YHHD 2JANA 4GKKD 1H3EA 5LMUD 1IBMD 1C05A 4X65D 4DUZD 2VQFD 4DR5D 4LFCD 4DV3D 4X62D 4DV7D 4DR1D 4OX9D 4JI2D 4LF5D 1KSVA 4JI8D 1HR0D 5IWAD 2L3NA 3T1YD 1XNRD 2UUCD 4JI6D 1KSLA 4JYAD 4DUYD 4DR2D 1C06A 4JI5D 1XNQD 3DH3A 2UXDD 3OTOD 4AQYD 4X64D 5LMND 4JI3D 4DV0D 4LF8D 1N36D 2UU9D 4LF6D 2HHHD 1JH3A 2UXCD 2UUAD 4JI0D 1IBLD 4B3RD 4DR3D 4DR7D 3HP7A 1XMQD 4LF7D 4LGTA 4NXMD 1J5ED 4DV6D 1KSKA 4DV2D 4JI4D 4GKJD 1N34D 2VQED 4DR6D 4JI7D 1I94D 1N33D 3KBGA 1FJGD 4B3SD 2E5LD 4LFAD 1XMOD 4OUDA 2K6PA 4DV4D 4DV5D 2KTLA 4JV5D 1HNWD 4JI1D 2F4VD 5BR8D 4LFBD 2UUBD 1N32D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T D;  4KHP D;  1H3F A;  1FKA D;  4DV1 D;  1HNZ D;  1HNX D;  2IST A;  4LF4 D;  1DM9 A;  1P9K A;  1IBK D;  4NXN D;  3T1H D;  4DR4 D;  4LF9 D;  1VIO A;  2UXB D;  4X66 D;  4K0K D;  4YY3 D;  2ZM6 D;  4B3M D;  4YHH D;  2JAN A;  4GKK D;  1H3E A;  5LMU D;  1IBM D;  1C05 A;  4X65 D;  4DUZ D;  2VQF D;  4DR5 D;  4LFC D;  4DV3 D;  4X62 D;  4DV7 D;  4DR1 D;  4OX9 D;  4JI2 D;  4LF5 D;  1KSV A;  4JI8 D;  1HR0 D;  5IWA D;  1XNR D;  3T1Y D;  2UUC D;  4JI6 D;  1KSL A;  4JYA D;  4DUY D;  4DR2 D;  1C06 A;  4JI5 D;  1XNQ D;  3DH3 A;  2UXD D;  3OTO D;  4AQY D;  4X64 D;  5LMN D;  4JI3 D;  4DV0 D;  4LF8 D;  1N36 D;  2UU9 D;  4LF6 D;  2HHH D;  1JH3 A;  2UXC D;  2UUA D;  4JI0 D;  1IBL D;  4B3R D;  4DR3 D;  4DR7 D;  3HP7 A;  1XMQ D;  4LF7 D;  4LGT A;  4NXM D;  1J5E D;  4DV6 D;  1KSK A;  4DV2 D;  4JI4 D;  4GKJ D;  1N34 D;  2VQE D;  4DR6 D;  4JI7 D;  1I94 D;  1N33 D;  3KBG A;  1FJG D;  4B3S D;  2E5L D;  4LFA D;  1XMO D;  4OUD A;  2K6P A;  4DV4 D;  4DV5 D;  2KTL A;  4JV5 D;  1HNW D;  4JI1 D;  2F4V D;  5BR8 D;  4LFB D;  2UUB D;  1N32 D; 
#chains in the Genus database with same CATH topology
 4B3T D;  4KHP D;  1H3F A;  1FKA D;  4DV1 D;  1HNZ D;  2LQ7 A;  1HNX D;  3ONH A;  5FLX E;  2IST A;  4LF4 D;  1DM9 A;  5LL6 S;  1P9K A;  5A2Q E;  1IBK D;  4NXN D;  1Y8X B;  3T1H D;  4DR4 D;  5FQ2 B;  3KYC B;  4LF9 D;  1VIO A;  2UXB D;  4X66 D;  4K0K D;  4YY3 D;  2ZM6 D;  4B3M D;  4YHH D;  2JAN A;  3FN1 A;  4GKK D;  1H3E A;  5LMU D;  3JAM E;  1IBM D;  1C05 A;  4X65 D;  4DUZ D;  2VQF D;  4DR5 D;  4LFC D;  4DV3 D;  4X62 D;  4DV7 D;  4DR1 D;  4OX9 D;  3J80 E;  4JI2 D;  4LF5 D;  1KSV A;  4JI8 D;  1HR0 D;  5IWA D;  2L3N A;  3T1Y D;  1XNR D;  2NVU B;  2UUC D;  4JI6 D;  1KSL A;  1Y8R B;  4NNJ A;  4JYA D;  4DUY D;  4DR2 D;  3J81 E;  4W5V B;  1C06 A;  4JI5 D;  1XNQ D;  3DH3 A;  2UXD D;  3OTO D;  4II3 A;  3ONG A;  4AQY D;  4X64 D;  5LMN D;  5KNL A;  4JI3 D;  4DV0 D;  4LF8 D;  1N36 D;  2UU9 D;  4LF6 D;  2HHH D;  1JH3 A;  2UXC D;  2UUA D;  4JI0 D;  3J7A F;  1IBL D;  4B3R D;  4DR3 D;  4DR7 D;  3CMM A;  3HP7 A;  1XMQ D;  4LF7 D;  4LGT A;  4NXM D;  1J5E D;  4DV6 D;  1KSK A;  4DV2 D;  4JI4 D;  4GKJ D;  1N34 D;  2VQE D;  4DR6 D;  1Y8Q B;  5IT9 E;  4JI7 D;  1I94 D;  1N33 D;  3KBG A;  1FJG D;  4II2 A;  4B3S D;  2I1S A;  3KYD B;  2E5L D;  4LFA D;  1XMO D;  4OUD A;  2K6P A;  4DV4 D;  4DV5 D;  2KTL A;  4JV5 D;  1HNW D;  4JI1 D;  2F4V D;  5BR8 D;  4LFB D;  2UUB D;  2ZTB A;  1N32 D; 
#chains in the Genus database with same CATH homology
 4B3T D;  4KHP D;  1H3F A;  1FKA D;  4DV1 D;  1HNZ D;  1HNX D;  2IST A;  4LF4 D;  1DM9 A;  1P9K A;  1IBK D;  4NXN D;  3T1H D;  4DR4 D;  4LF9 D;  1VIO A;  2UXB D;  4X66 D;  4K0K D;  4YY3 D;  2ZM6 D;  4B3M D;  4YHH D;  2JAN A;  4GKK D;  1H3E A;  5LMU D;  1IBM D;  1C05 A;  4X65 D;  4DUZ D;  2VQF D;  4DR5 D;  4LFC D;  4DV3 D;  4X62 D;  4DV7 D;  4DR1 D;  4OX9 D;  4JI2 D;  4LF5 D;  1KSV A;  4JI8 D;  1HR0 D;  5IWA D;  2L3N A;  3T1Y D;  1XNR D;  2UUC D;  4JI6 D;  1KSL A;  4JYA D;  4DUY D;  4DR2 D;  1C06 A;  4JI5 D;  1XNQ D;  3DH3 A;  2UXD D;  3OTO D;  4AQY D;  4X64 D;  5LMN D;  4JI3 D;  4DV0 D;  4LF8 D;  1N36 D;  2UU9 D;  4LF6 D;  2HHH D;  1JH3 A;  2UXC D;  2UUA D;  4JI0 D;  1IBL D;  4B3R D;  4DR3 D;  4DR7 D;  3HP7 A;  1XMQ D;  4LF7 D;  4LGT A;  4NXM D;  1J5E D;  4DV6 D;  1KSK A;  4DV2 D;  4JI4 D;  4GKJ D;  1N34 D;  2VQE D;  4DR6 D;  4JI7 D;  1I94 D;  1N33 D;  3KBG A;  1FJG D;  4B3S D;  2E5L D;  4LFA D;  1XMO D;  4OUD A;  2K6P A;  4DV4 D;  4DV5 D;  2KTL A;  4JV5 D;  1HNW D;  4JI1 D;  2F4V D;  5BR8 D;  4LFB D;  2UUB D;  1N32 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...