4YY3D

30s ribosomal subunit- higb complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
total genus 59
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 4yy3D01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 4yy3D02
4B3MD 2HHHD 1HNZD 4JI7D 4K0KD 4JI3D 1C06A 4DR6D 4B3TD 1XMQD 4DV2D 5BR8D 1VIOA 4LGTA 4X66D 4JV5D 1XNQD 1C05A 4B3SD 4OX9D 1FJGD 1XMOD 2UXDD 2UXBD 4GKJD 4LFCD 4LFAD 1HR0D 3T1HD 4LF6D 4DV5D 4JYAD 4X62D 5LMND 1I94D 4X65D 5LMUD 4KHPD 4JI6D 4GKKD 2JANA 1FKAD 2VQFD 4DR4D 2UUAD 2UUBD 1IBLD 1XNRD 4DV1D 4AQYD 1HNWD 1KSVA 2ISTA 4JI5D 4LF7D 4YHHD 1P9KA 4DV4D 1N33D 4YY3D 1KSLA 4JI8D 1JH3A 4LF5D 1N36D 2VQED 1J5ED 4DV0D 4DUYD 4DUZD 2F4VD 3T1YD 4DR5D 4JI2D 1H3FA 3DH3A 5IWAD 4DV6D 4DR1D 4NXND 2ZM6D 1IBMD 2KTLA 4LF8D 4LF9D 4NXMD 2UU9D 2UXCD 4DV7D 1H3EA 4LFBD 4OUDA 4DV3D 1KSKA 4B3RD 4JI4D 4DR2D 1DM9A 4DR3D 4LF4D 2E5LD 2K6PA 3KBGA 1HNXD 1IBKD 4JI1D 1N32D 2UUCD 3OTOD 1N34D 4X64D 4JI0D 4DR7D 3HP7A
chains in the Genus database with same CATH superfamily
4B3MD 2HHHD 3KYDB 2I1SA 5IT9E 1HNZD 4JI7D 4K0KD 4JI3D 1C06A 4DR6D 4B3TD 5FQ2B 5A2QE 4NNJA 1XMQD 4DV2D 5BR8D 1VIOA 3CMMA 4LGTA 4X66D 4JV5D 5FLXE 1Y8QB 1XNQD 1C05A 4B3SD 4OX9D 1FJGD 1XMOD 2UXDD 2UXBD 4GKJD 3J81E 4LFCD 4LFAD 1HR0D 3T1HD 4LF6D 2ZTBA 4DV5D 4JYAD 4X62D 5LMND 1I94D 3KYCB 4X65D 3JAME 5LMUD 4KHPD 4JI6D 4GKKD 2JANA 1FKAD 2VQFD 4DR4D 5KNLA 2UUAD 2UUBD 1IBLD 1XNRD 4DV1D 4AQYD 1HNWD 1KSVA 2ISTA 4JI5D 4LF7D 4YHHD 1P9KA 4DV4D 1N33D 4YY3D 1KSLA 4JI8D 1JH3A 4LF5D 1N36D 2VQED 1J5ED 4II2A 4DV0D 4DUYD 3ONGA 4DUZD 4II3A 2F4VD 3T1YD 4DR5D 4JI2D 1H3FA 3J80E 3DH3A 5IWAD 2LQ7A 4DV6D 4DR1D 3J7AF 4NXND 4W5VB 1Y8RB 2ZM6D 1IBMD 2KTLA 2L3NA 4LF8D 2NVUB 4LF9D 4NXMD 2UU9D 2UXCD 4DV7D 1H3EA 4LFBD 3ONHA 4OUDA 4DV3D 1KSKA 4B3RD 4JI4D 4DR2D 1DM9A 4DR3D 4LF4D 2E5LD 5LL6S 2K6PA 3KBGA 1HNXD 1IBKD 4JI1D 1N32D 2UUCD 3FN1A 3OTOD 1N34D 1Y8XB 4X64D 4JI0D 4DR7D 3HP7A
chains in the Genus database with same CATH topology
4B3MD 2HHHD 1HNZD 4JI7D 4K0KD 4JI3D 1C06A 4DR6D 4B3TD 1XMQD 4DV2D 5BR8D 1VIOA 4LGTA 4X66D 4JV5D 1XNQD 1C05A 4B3SD 4OX9D 1FJGD 1XMOD 2UXDD 2UXBD 4GKJD 4LFCD 4LFAD 1HR0D 3T1HD 4LF6D 4DV5D 4JYAD 4X62D 5LMND 1I94D 4X65D 5LMUD 4KHPD 4JI6D 4GKKD 2JANA 1FKAD 2VQFD 4DR4D 2UUAD 2UUBD 1IBLD 1XNRD 4DV1D 4AQYD 1HNWD 1KSVA 2ISTA 4JI5D 4LF7D 4YHHD 1P9KA 4DV4D 1N33D 4YY3D 1KSLA 4JI8D 1JH3A 4LF5D 1N36D 2VQED 1J5ED 4DV0D 4DUYD 4DUZD 2F4VD 3T1YD 4DR5D 4JI2D 1H3FA 3DH3A 5IWAD 4DV6D 4DR1D 4NXND 2ZM6D 1IBMD 2KTLA 2L3NA 4LF8D 4LF9D 4NXMD 2UU9D 2UXCD 4DV7D 1H3EA 4LFBD 4OUDA 4DV3D 1KSKA 4B3RD 4JI4D 4DR2D 1DM9A 4DR3D 4LF4D 2E5LD 2K6PA 3KBGA 1HNXD 1IBKD 4JI1D 1N32D 2UUCD 3OTOD 1N34D 4X64D 4JI0D 4DR7D 3HP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M D;  2HHH D;  1HNZ D;  4JI7 D;  4K0K D;  4JI3 D;  1C06 A;  4DR6 D;  4B3T D;  1XMQ D;  4DV2 D;  5BR8 D;  1VIO A;  4LGT A;  4X66 D;  4JV5 D;  1XNQ D;  1C05 A;  4B3S D;  4OX9 D;  1FJG D;  1XMO D;  2UXD D;  2UXB D;  4GKJ D;  4LFC D;  4LFA D;  1HR0 D;  3T1H D;  4LF6 D;  4DV5 D;  4JYA D;  4X62 D;  5LMN D;  1I94 D;  4X65 D;  5LMU D;  4KHP D;  4JI6 D;  4GKK D;  2JAN A;  1FKA D;  2VQF D;  4DR4 D;  2UUA D;  2UUB D;  1IBL D;  1XNR D;  4DV1 D;  4AQY D;  1HNW D;  1KSV A;  2IST A;  4JI5 D;  4LF7 D;  4YHH D;  1P9K A;  4DV4 D;  1N33 D;  4YY3 D;  1KSL A;  4JI8 D;  1JH3 A;  4LF5 D;  1N36 D;  2VQE D;  1J5E D;  4DV0 D;  4DUY D;  4DUZ D;  2F4V D;  3T1Y D;  4DR5 D;  4JI2 D;  1H3F A;  3DH3 A;  5IWA D;  4DV6 D;  4DR1 D;  4NXN D;  2ZM6 D;  1IBM D;  2KTL A;  4LF8 D;  4LF9 D;  4NXM D;  2UU9 D;  2UXC D;  4DV7 D;  1H3E A;  4LFB D;  4OUD A;  4DV3 D;  1KSK A;  4B3R D;  4JI4 D;  4DR2 D;  1DM9 A;  4DR3 D;  4LF4 D;  2E5L D;  2K6P A;  3KBG A;  1HNX D;  1IBK D;  4JI1 D;  1N32 D;  2UUC D;  3OTO D;  1N34 D;  4X64 D;  4JI0 D;  4DR7 D;  3HP7 A; 
#chains in the Genus database with same CATH topology
 4B3M D;  2HHH D;  3KYD B;  2I1S A;  5IT9 E;  1HNZ D;  4JI7 D;  4K0K D;  4JI3 D;  1C06 A;  4DR6 D;  4B3T D;  5FQ2 B;  5A2Q E;  4NNJ A;  1XMQ D;  4DV2 D;  5BR8 D;  1VIO A;  3CMM A;  4LGT A;  4X66 D;  4JV5 D;  5FLX E;  1Y8Q B;  1XNQ D;  1C05 A;  4B3S D;  4OX9 D;  1FJG D;  1XMO D;  2UXD D;  2UXB D;  4GKJ D;  3J81 E;  4LFC D;  4LFA D;  1HR0 D;  3T1H D;  4LF6 D;  2ZTB A;  4DV5 D;  4JYA D;  4X62 D;  5LMN D;  1I94 D;  3KYC B;  4X65 D;  3JAM E;  5LMU D;  4KHP D;  4JI6 D;  4GKK D;  2JAN A;  1FKA D;  2VQF D;  4DR4 D;  5KNL A;  2UUA D;  2UUB D;  1IBL D;  1XNR D;  4DV1 D;  4AQY D;  1HNW D;  1KSV A;  2IST A;  4JI5 D;  4LF7 D;  4YHH D;  1P9K A;  4DV4 D;  1N33 D;  4YY3 D;  1KSL A;  4JI8 D;  1JH3 A;  4LF5 D;  1N36 D;  2VQE D;  1J5E D;  4II2 A;  4DV0 D;  4DUY D;  3ONG A;  4DUZ D;  4II3 A;  2F4V D;  3T1Y D;  4DR5 D;  4JI2 D;  1H3F A;  3J80 E;  3DH3 A;  5IWA D;  2LQ7 A;  4DV6 D;  4DR1 D;  3J7A F;  4NXN D;  4W5V B;  1Y8R B;  2ZM6 D;  1IBM D;  2KTL A;  2L3N A;  4LF8 D;  2NVU B;  4LF9 D;  4NXM D;  2UU9 D;  2UXC D;  4DV7 D;  1H3E A;  4LFB D;  3ONH A;  4OUD A;  4DV3 D;  1KSK A;  4B3R D;  4JI4 D;  4DR2 D;  1DM9 A;  4DR3 D;  4LF4 D;  2E5L D;  5LL6 S;  2K6P A;  3KBG A;  1HNX D;  1IBK D;  4JI1 D;  1N32 D;  2UUC D;  3FN1 A;  3OTO D;  1N34 D;  1Y8X B;  4X64 D;  4JI0 D;  4DR7 D;  3HP7 A; 
#chains in the Genus database with same CATH homology
 4B3M D;  2HHH D;  1HNZ D;  4JI7 D;  4K0K D;  4JI3 D;  1C06 A;  4DR6 D;  4B3T D;  1XMQ D;  4DV2 D;  5BR8 D;  1VIO A;  4LGT A;  4X66 D;  4JV5 D;  1XNQ D;  1C05 A;  4B3S D;  4OX9 D;  1FJG D;  1XMO D;  2UXD D;  2UXB D;  4GKJ D;  4LFC D;  4LFA D;  1HR0 D;  3T1H D;  4LF6 D;  4DV5 D;  4JYA D;  4X62 D;  5LMN D;  1I94 D;  4X65 D;  5LMU D;  4KHP D;  4JI6 D;  4GKK D;  2JAN A;  1FKA D;  2VQF D;  4DR4 D;  2UUA D;  2UUB D;  1IBL D;  1XNR D;  4DV1 D;  4AQY D;  1HNW D;  1KSV A;  2IST A;  4JI5 D;  4LF7 D;  4YHH D;  1P9K A;  4DV4 D;  1N33 D;  4YY3 D;  1KSL A;  4JI8 D;  1JH3 A;  4LF5 D;  1N36 D;  2VQE D;  1J5E D;  4DV0 D;  4DUY D;  4DUZ D;  2F4V D;  3T1Y D;  4DR5 D;  4JI2 D;  1H3F A;  3DH3 A;  5IWA D;  4DV6 D;  4DR1 D;  4NXN D;  2ZM6 D;  1IBM D;  2KTL A;  2L3N A;  4LF8 D;  4LF9 D;  4NXM D;  2UU9 D;  2UXC D;  4DV7 D;  1H3E A;  4LFB D;  4OUD A;  4DV3 D;  1KSK A;  4B3R D;  4JI4 D;  4DR2 D;  1DM9 A;  4DR3 D;  4LF4 D;  2E5L D;  2K6P A;  3KBG A;  1HNX D;  1IBK D;  4JI1 D;  1N32 D;  2UUC D;  3OTO D;  1N34 D;  4X64 D;  4JI0 D;  4DR7 D;  3HP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...