5BR8D

Ambient-temperature crystal structure of 30s ribosomal subunit from thermus thermophilus in complex with paromomycin
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Ambient-temperature crystal structure of 30S ribosomal subunit from Thermus thermophilus in complex with paromomycin
rcsb
molecule tags Ribosome
total genus 63
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 5br8D01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 5br8D02
4GKJD 2E5LD 3HP7A 1XMOD 4JI5D 4LF4D 4DUZD 4X62D 1KSKA 1N32D 2UUAD 2JANA 5IWAD 1N34D 4LF5D 4DV7D 2VQED 1VIOA 4KHPD 3OTOD 1C05A 4LF9D 1XMQD 4X65D 4DV3D 4JI3D 4DR7D 4DV0D 1HNWD 2F4VD 1HNZD 4B3TD 4DUYD 4X64D 4JYAD 4JV5D 4B3MD 1H3FA 1J5ED 4JI1D 4LGTA 2UXDD 1KSVA 5BR8D 2UU9D 4NXND 4LFBD 2UXBD 1IBKD 2KTLA 3KBGA 4AQYD 4JI4D 4OUDA 1C06A 4NXMD 1HNXD 4LF8D 1FJGD 4YY3D 1JH3A 4DR1D 3T1HD 2UXCD 4DR2D 1IBMD 2UUBD 4JI8D 4LF6D 4JI0D 4B3SD 4LFCD 3DH3A 2ISTA 1KSLA 4DR5D 4OX9D 1XNQD 4B3RD 1DM9A 4LF7D 4DR6D 4DR4D 1FKAD 1P9KA 2UUCD 2K6PA 1IBLD 4GKKD 4YHHD 2ZM6D 1N36D 4DV1D 4JI6D 4K0KD 4DR3D 2VQFD 4JI7D 5LMND 1N33D 5LMUD 4JI2D 4DV6D 1HR0D 1I94D 1H3EA 2HHHD 1XNRD 4X66D 4DV4D 3T1YD 4LFAD 4DV5D 4DV2D
chains in the Genus database with same CATH superfamily
4GKJD 2E5LD 3HP7A 1XMOD 4JI5D 4LF4D 4DUZD 4X62D 1KSKA 3J81E 1N32D 2UUAD 3FN1A 2JANA 5IWAD 1N34D 4LF5D 4DV7D 2VQED 1VIOA 4KHPD 3OTOD 1C05A 4LF9D 1XMQD 4X65D 4DV3D 1Y8XB 2I1SA 4JI3D 3J7AF 4DR7D 4DV0D 1HNWD 2F4VD 1HNZD 4B3TD 4DUYD 4X64D 4JYAD 4JV5D 4B3MD 1H3FA 1J5ED 4JI1D 4LGTA 3JAME 2UXDD 1KSVA 5LL6S 3J80E 5BR8D 4II3A 2UU9D 4NXND 5A2QE 4LFBD 2UXBD 1IBKD 2KTLA 3KBGA 4AQYD 4JI4D 2ZTBA 4OUDA 1C06A 4NXMD 1HNXD 4LF8D 1FJGD 4YY3D 1JH3A 4DR1D 3T1HD 5FLXE 2UXCD 3KYDB 5FQ2B 4DR2D 1IBMD 2UUBD 4JI8D 4LF6D 4JI0D 4B3SD 4LFCD 4NNJA 5IT9E 3DH3A 2ISTA 3CMMA 3ONHA 1KSLA 4W5VB 4DR5D 4OX9D 1XNQD 4B3RD 1DM9A 4LF7D 4DR6D 4DR4D 1Y8RB 2LQ7A 1FKAD 3KYCB 2NVUB 1P9KA 2UUCD 2K6PA 1IBLD 4GKKD 4YHHD 2ZM6D 2L3NA 1N36D 4DV1D 4JI6D 4K0KD 4DR3D 4II2A 2VQFD 4JI7D 5LMND 1N33D 5LMUD 5KNLA 3ONGA 4JI2D 4DV6D 1HR0D 1I94D 1H3EA 2HHHD 1XNRD 4X66D 4DV4D 3T1YD 1Y8QB 4LFAD 4DV5D 4DV2D
chains in the Genus database with same CATH topology
4GKJD 2E5LD 3HP7A 1XMOD 4JI5D 4LF4D 4DUZD 4X62D 1KSKA 1N32D 2UUAD 2JANA 5IWAD 1N34D 4LF5D 4DV7D 2VQED 1VIOA 4KHPD 3OTOD 1C05A 4LF9D 1XMQD 4X65D 4DV3D 4JI3D 4DR7D 4DV0D 1HNWD 2F4VD 1HNZD 4B3TD 4DUYD 4X64D 4JYAD 4JV5D 4B3MD 1H3FA 1J5ED 4JI1D 4LGTA 2UXDD 1KSVA 5BR8D 2UU9D 4NXND 4LFBD 2UXBD 1IBKD 2KTLA 3KBGA 4AQYD 4JI4D 4OUDA 1C06A 4NXMD 1HNXD 4LF8D 1FJGD 4YY3D 1JH3A 4DR1D 3T1HD 2UXCD 4DR2D 1IBMD 2UUBD 4JI8D 4LF6D 4JI0D 4B3SD 4LFCD 3DH3A 2ISTA 1KSLA 4DR5D 4OX9D 1XNQD 4B3RD 1DM9A 4LF7D 4DR6D 4DR4D 1FKAD 1P9KA 2UUCD 2K6PA 1IBLD 4GKKD 4YHHD 2ZM6D 2L3NA 1N36D 4DV1D 4JI6D 4K0KD 4DR3D 2VQFD 4JI7D 5LMND 1N33D 5LMUD 4JI2D 4DV6D 1HR0D 1I94D 1H3EA 2HHHD 1XNRD 4X66D 4DV4D 3T1YD 4LFAD 4DV5D 4DV2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKJ D;  2E5L D;  3HP7 A;  1XMO D;  4JI5 D;  4LF4 D;  4DUZ D;  4X62 D;  1KSK A;  1N32 D;  2UUA D;  2JAN A;  5IWA D;  1N34 D;  4LF5 D;  4DV7 D;  2VQE D;  1VIO A;  4KHP D;  3OTO D;  1C05 A;  4LF9 D;  1XMQ D;  4X65 D;  4DV3 D;  4JI3 D;  4DR7 D;  4DV0 D;  1HNW D;  2F4V D;  1HNZ D;  4B3T D;  4DUY D;  4X64 D;  4JYA D;  4JV5 D;  4B3M D;  1H3F A;  1J5E D;  4JI1 D;  4LGT A;  2UXD D;  1KSV A;  5BR8 D;  2UU9 D;  4NXN D;  4LFB D;  2UXB D;  1IBK D;  2KTL A;  3KBG A;  4AQY D;  4JI4 D;  4OUD A;  1C06 A;  4NXM D;  1HNX D;  4LF8 D;  1FJG D;  4YY3 D;  1JH3 A;  4DR1 D;  3T1H D;  2UXC D;  4DR2 D;  1IBM D;  2UUB D;  4JI8 D;  4LF6 D;  4JI0 D;  4B3S D;  4LFC D;  3DH3 A;  2IST A;  1KSL A;  4DR5 D;  4OX9 D;  1XNQ D;  4B3R D;  1DM9 A;  4LF7 D;  4DR6 D;  4DR4 D;  1FKA D;  1P9K A;  2UUC D;  2K6P A;  1IBL D;  4GKK D;  4YHH D;  2ZM6 D;  1N36 D;  4DV1 D;  4JI6 D;  4K0K D;  4DR3 D;  2VQF D;  4JI7 D;  5LMN D;  1N33 D;  5LMU D;  4JI2 D;  4DV6 D;  1HR0 D;  1I94 D;  1H3E A;  2HHH D;  1XNR D;  4X66 D;  4DV4 D;  3T1Y D;  4LFA D;  4DV5 D;  4DV2 D; 
#chains in the Genus database with same CATH topology
 4GKJ D;  2E5L D;  3HP7 A;  1XMO D;  4JI5 D;  4LF4 D;  4DUZ D;  4X62 D;  1KSK A;  3J81 E;  1N32 D;  2UUA D;  3FN1 A;  2JAN A;  5IWA D;  1N34 D;  4LF5 D;  4DV7 D;  2VQE D;  1VIO A;  4KHP D;  3OTO D;  1C05 A;  4LF9 D;  1XMQ D;  4X65 D;  4DV3 D;  1Y8X B;  2I1S A;  4JI3 D;  3J7A F;  4DR7 D;  4DV0 D;  1HNW D;  2F4V D;  1HNZ D;  4B3T D;  4DUY D;  4X64 D;  4JYA D;  4JV5 D;  4B3M D;  1H3F A;  1J5E D;  4JI1 D;  4LGT A;  3JAM E;  2UXD D;  1KSV A;  5LL6 S;  3J80 E;  5BR8 D;  4II3 A;  2UU9 D;  4NXN D;  5A2Q E;  4LFB D;  2UXB D;  1IBK D;  2KTL A;  3KBG A;  4AQY D;  4JI4 D;  2ZTB A;  4OUD A;  1C06 A;  4NXM D;  1HNX D;  4LF8 D;  1FJG D;  4YY3 D;  1JH3 A;  4DR1 D;  3T1H D;  5FLX E;  2UXC D;  3KYD B;  5FQ2 B;  4DR2 D;  1IBM D;  2UUB D;  4JI8 D;  4LF6 D;  4JI0 D;  4B3S D;  4LFC D;  4NNJ A;  5IT9 E;  3DH3 A;  2IST A;  3CMM A;  3ONH A;  1KSL A;  4W5V B;  4DR5 D;  4OX9 D;  1XNQ D;  4B3R D;  1DM9 A;  4LF7 D;  4DR6 D;  4DR4 D;  1Y8R B;  2LQ7 A;  1FKA D;  3KYC B;  2NVU B;  1P9K A;  2UUC D;  2K6P A;  1IBL D;  4GKK D;  4YHH D;  2ZM6 D;  2L3N A;  1N36 D;  4DV1 D;  4JI6 D;  4K0K D;  4DR3 D;  4II2 A;  2VQF D;  4JI7 D;  5LMN D;  1N33 D;  5LMU D;  5KNL A;  3ONG A;  4JI2 D;  4DV6 D;  1HR0 D;  1I94 D;  1H3E A;  2HHH D;  1XNR D;  4X66 D;  4DV4 D;  3T1Y D;  1Y8Q B;  4LFA D;  4DV5 D;  4DV2 D; 
#chains in the Genus database with same CATH homology
 4GKJ D;  2E5L D;  3HP7 A;  1XMO D;  4JI5 D;  4LF4 D;  4DUZ D;  4X62 D;  1KSK A;  1N32 D;  2UUA D;  2JAN A;  5IWA D;  1N34 D;  4LF5 D;  4DV7 D;  2VQE D;  1VIO A;  4KHP D;  3OTO D;  1C05 A;  4LF9 D;  1XMQ D;  4X65 D;  4DV3 D;  4JI3 D;  4DR7 D;  4DV0 D;  1HNW D;  2F4V D;  1HNZ D;  4B3T D;  4DUY D;  4X64 D;  4JYA D;  4JV5 D;  4B3M D;  1H3F A;  1J5E D;  4JI1 D;  4LGT A;  2UXD D;  1KSV A;  5BR8 D;  2UU9 D;  4NXN D;  4LFB D;  2UXB D;  1IBK D;  2KTL A;  3KBG A;  4AQY D;  4JI4 D;  4OUD A;  1C06 A;  4NXM D;  1HNX D;  4LF8 D;  1FJG D;  4YY3 D;  1JH3 A;  4DR1 D;  3T1H D;  2UXC D;  4DR2 D;  1IBM D;  2UUB D;  4JI8 D;  4LF6 D;  4JI0 D;  4B3S D;  4LFC D;  3DH3 A;  2IST A;  1KSL A;  4DR5 D;  4OX9 D;  1XNQ D;  4B3R D;  1DM9 A;  4LF7 D;  4DR6 D;  4DR4 D;  1FKA D;  1P9K A;  2UUC D;  2K6P A;  1IBL D;  4GKK D;  4YHH D;  2ZM6 D;  2L3N A;  1N36 D;  4DV1 D;  4JI6 D;  4K0K D;  4DR3 D;  2VQF D;  4JI7 D;  5LMN D;  1N33 D;  5LMU D;  4JI2 D;  4DV6 D;  1HR0 D;  1I94 D;  1H3E A;  2HHH D;  1XNR D;  4X66 D;  4DV4 D;  3T1Y D;  4LFA D;  4DV5 D;  4DV2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...