4X66D

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 62
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 4x66D01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 4x66D02
4LF5D 4JI5D 4LFAD 4JV5D 1H3FA 1JH3A 4AQYD 4DUYD 4DR1D 4DV3D 1KSKA 1HR0D 1HNWD 5LMUD 4YHHD 4DR3D 4JI1D 4JI7D 4JI0D 3T1YD 1N36D 4DV2D 4LF4D 4YY3D 4GKKD 4LF7D 1XNRD 1I94D 2UU9D 4JI2D 4DV7D 4JI8D 4KHPD 4X66D 3OTOD 2JANA 2F4VD 2UXCD 4LGTA 1IBLD 2UUCD 1FKAD 4JI4D 1KSVA 4JI6D 3T1HD 1C06A 4X64D 1HNZD 5LMND 1VIOA 4DV6D 4B3SD 4K0KD 1N34D 1XMQD 4JYAD 3HP7A 4LF9D 4B3TD 4LFBD 1DM9A 2ZM6D 4NXMD 1N32D 2UXBD 4DV0D 4DR7D 1IBKD 2UUBD 4LFCD 1P9KA 1KSLA 1XMOD 1IBMD 4X65D 1N33D 5IWAD 4B3MD 2K6PA 4LF6D 1FJGD 4X62D 5BR8D 3DH3A 4DR5D 4DR2D 1HNXD 1J5ED 4DUZD 2VQED 3KBGA 2VQFD 2ISTA 4DV5D 4DV1D 2KTLA 2E5LD 4LF8D 4OX9D 4JI3D 1H3EA 2HHHD 2UUAD 4OUDA 4DR6D 2UXDD 4B3RD 1C05A 4NXND 4DR4D 4GKJD 1XNQD 4DV4D
chains in the Genus database with same CATH superfamily
4LF5D 4JI5D 4LFAD 3ONGA 4JV5D 5A2QE 1H3FA 1JH3A 3KYCB 4AQYD 4DUYD 4DR1D 2LQ7A 4DV3D 4II2A 1KSKA 1HR0D 1HNWD 5LMUD 5KNLA 4YHHD 4DR3D 4JI1D 4JI7D 4JI0D 3T1YD 1N36D 4DV2D 4LF4D 4YY3D 4GKKD 1Y8XB 4LF7D 1XNRD 1I94D 5FLXE 5LL6S 2UU9D 4NNJA 4JI2D 4DV7D 4JI8D 3JAME 4KHPD 4X66D 3OTOD 2JANA 1Y8QB 3KYDB 2F4VD 2UXCD 4LGTA 1IBLD 2UUCD 1FKAD 4JI4D 1KSVA 4JI6D 3T1HD 1C06A 4X64D 1HNZD 5LMND 1VIOA 4DV6D 2NVUB 4B3SD 4K0KD 5FQ2B 1N34D 3ONHA 2I1SA 1XMQD 4JYAD 3HP7A 3J80E 4LF9D 3CMMA 4B3TD 4LFBD 4II3A 1DM9A 3J81E 2ZM6D 3J7AF 4NXMD 1N32D 2UXBD 4DV0D 4DR7D 1IBKD 2UUBD 4LFCD 1P9KA 1KSLA 1XMOD 1IBMD 4X65D 1N33D 2ZTBA 5IWAD 4B3MD 2K6PA 4LF6D 1FJGD 4X62D 5BR8D 3DH3A 2L3NA 4DR5D 4DR2D 1HNXD 1J5ED 5IT9E 4DUZD 2VQED 3KBGA 2VQFD 1Y8RB 2ISTA 4DV5D 4DV1D 2KTLA 2E5LD 4LF8D 4OX9D 4JI3D 1H3EA 2HHHD 2UUAD 3FN1A 4OUDA 4DR6D 2UXDD 4B3RD 1C05A 4NXND 4W5VB 4DR4D 4GKJD 1XNQD 4DV4D
chains in the Genus database with same CATH topology
4LF5D 4JI5D 4LFAD 4JV5D 1H3FA 1JH3A 4AQYD 4DUYD 4DR1D 4DV3D 1KSKA 1HR0D 1HNWD 5LMUD 4YHHD 4DR3D 4JI1D 4JI7D 4JI0D 3T1YD 1N36D 4DV2D 4LF4D 4YY3D 4GKKD 4LF7D 1XNRD 1I94D 2UU9D 4JI2D 4DV7D 4JI8D 4KHPD 4X66D 3OTOD 2JANA 2F4VD 2UXCD 4LGTA 1IBLD 2UUCD 1FKAD 4JI4D 1KSVA 4JI6D 3T1HD 1C06A 4X64D 1HNZD 5LMND 1VIOA 4DV6D 4B3SD 4K0KD 1N34D 1XMQD 4JYAD 3HP7A 4LF9D 4B3TD 4LFBD 1DM9A 2ZM6D 4NXMD 1N32D 2UXBD 4DV0D 4DR7D 1IBKD 2UUBD 4LFCD 1P9KA 1KSLA 1XMOD 1IBMD 4X65D 1N33D 5IWAD 4B3MD 2K6PA 4LF6D 1FJGD 4X62D 5BR8D 3DH3A 2L3NA 4DR5D 4DR2D 1HNXD 1J5ED 4DUZD 2VQED 3KBGA 2VQFD 2ISTA 4DV5D 4DV1D 2KTLA 2E5LD 4LF8D 4OX9D 4JI3D 1H3EA 2HHHD 2UUAD 4OUDA 4DR6D 2UXDD 4B3RD 1C05A 4NXND 4DR4D 4GKJD 1XNQD 4DV4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 D;  4JI5 D;  4LFA D;  4JV5 D;  1H3F A;  1JH3 A;  4AQY D;  4DUY D;  4DR1 D;  4DV3 D;  1KSK A;  1HR0 D;  1HNW D;  5LMU D;  4YHH D;  4DR3 D;  4JI1 D;  4JI7 D;  4JI0 D;  3T1Y D;  1N36 D;  4DV2 D;  4LF4 D;  4YY3 D;  4GKK D;  4LF7 D;  1XNR D;  1I94 D;  2UU9 D;  4JI2 D;  4DV7 D;  4JI8 D;  4KHP D;  4X66 D;  3OTO D;  2JAN A;  2F4V D;  2UXC D;  4LGT A;  1IBL D;  2UUC D;  1FKA D;  4JI4 D;  1KSV A;  4JI6 D;  3T1H D;  1C06 A;  4X64 D;  1HNZ D;  5LMN D;  1VIO A;  4DV6 D;  4B3S D;  4K0K D;  1N34 D;  1XMQ D;  4JYA D;  3HP7 A;  4LF9 D;  4B3T D;  4LFB D;  1DM9 A;  2ZM6 D;  4NXM D;  1N32 D;  2UXB D;  4DV0 D;  4DR7 D;  1IBK D;  2UUB D;  4LFC D;  1P9K A;  1KSL A;  1XMO D;  1IBM D;  4X65 D;  1N33 D;  5IWA D;  4B3M D;  2K6P A;  4LF6 D;  1FJG D;  4X62 D;  5BR8 D;  3DH3 A;  4DR5 D;  4DR2 D;  1HNX D;  1J5E D;  4DUZ D;  2VQE D;  3KBG A;  2VQF D;  2IST A;  4DV5 D;  4DV1 D;  2KTL A;  2E5L D;  4LF8 D;  4OX9 D;  4JI3 D;  1H3E A;  2HHH D;  2UUA D;  4OUD A;  4DR6 D;  2UXD D;  4B3R D;  1C05 A;  4NXN D;  4DR4 D;  4GKJ D;  1XNQ D;  4DV4 D; 
#chains in the Genus database with same CATH topology
 4LF5 D;  4JI5 D;  4LFA D;  3ONG A;  4JV5 D;  5A2Q E;  1H3F A;  1JH3 A;  3KYC B;  4AQY D;  4DUY D;  4DR1 D;  2LQ7 A;  4DV3 D;  4II2 A;  1KSK A;  1HR0 D;  1HNW D;  5LMU D;  5KNL A;  4YHH D;  4DR3 D;  4JI1 D;  4JI7 D;  4JI0 D;  3T1Y D;  1N36 D;  4DV2 D;  4LF4 D;  4YY3 D;  4GKK D;  1Y8X B;  4LF7 D;  1XNR D;  1I94 D;  5FLX E;  5LL6 S;  2UU9 D;  4NNJ A;  4JI2 D;  4DV7 D;  4JI8 D;  3JAM E;  4KHP D;  4X66 D;  3OTO D;  2JAN A;  1Y8Q B;  3KYD B;  2F4V D;  2UXC D;  4LGT A;  1IBL D;  2UUC D;  1FKA D;  4JI4 D;  1KSV A;  4JI6 D;  3T1H D;  1C06 A;  4X64 D;  1HNZ D;  5LMN D;  1VIO A;  4DV6 D;  2NVU B;  4B3S D;  4K0K D;  5FQ2 B;  1N34 D;  3ONH A;  2I1S A;  1XMQ D;  4JYA D;  3HP7 A;  3J80 E;  4LF9 D;  3CMM A;  4B3T D;  4LFB D;  4II3 A;  1DM9 A;  3J81 E;  2ZM6 D;  3J7A F;  4NXM D;  1N32 D;  2UXB D;  4DV0 D;  4DR7 D;  1IBK D;  2UUB D;  4LFC D;  1P9K A;  1KSL A;  1XMO D;  1IBM D;  4X65 D;  1N33 D;  2ZTB A;  5IWA D;  4B3M D;  2K6P A;  4LF6 D;  1FJG D;  4X62 D;  5BR8 D;  3DH3 A;  2L3N A;  4DR5 D;  4DR2 D;  1HNX D;  1J5E D;  5IT9 E;  4DUZ D;  2VQE D;  3KBG A;  2VQF D;  1Y8R B;  2IST A;  4DV5 D;  4DV1 D;  2KTL A;  2E5L D;  4LF8 D;  4OX9 D;  4JI3 D;  1H3E A;  2HHH D;  2UUA D;  3FN1 A;  4OUD A;  4DR6 D;  2UXD D;  4B3R D;  1C05 A;  4NXN D;  4W5V B;  4DR4 D;  4GKJ D;  1XNQ D;  4DV4 D; 
#chains in the Genus database with same CATH homology
 4LF5 D;  4JI5 D;  4LFA D;  4JV5 D;  1H3F A;  1JH3 A;  4AQY D;  4DUY D;  4DR1 D;  4DV3 D;  1KSK A;  1HR0 D;  1HNW D;  5LMU D;  4YHH D;  4DR3 D;  4JI1 D;  4JI7 D;  4JI0 D;  3T1Y D;  1N36 D;  4DV2 D;  4LF4 D;  4YY3 D;  4GKK D;  4LF7 D;  1XNR D;  1I94 D;  2UU9 D;  4JI2 D;  4DV7 D;  4JI8 D;  4KHP D;  4X66 D;  3OTO D;  2JAN A;  2F4V D;  2UXC D;  4LGT A;  1IBL D;  2UUC D;  1FKA D;  4JI4 D;  1KSV A;  4JI6 D;  3T1H D;  1C06 A;  4X64 D;  1HNZ D;  5LMN D;  1VIO A;  4DV6 D;  4B3S D;  4K0K D;  1N34 D;  1XMQ D;  4JYA D;  3HP7 A;  4LF9 D;  4B3T D;  4LFB D;  1DM9 A;  2ZM6 D;  4NXM D;  1N32 D;  2UXB D;  4DV0 D;  4DR7 D;  1IBK D;  2UUB D;  4LFC D;  1P9K A;  1KSL A;  1XMO D;  1IBM D;  4X65 D;  1N33 D;  5IWA D;  4B3M D;  2K6P A;  4LF6 D;  1FJG D;  4X62 D;  5BR8 D;  3DH3 A;  2L3N A;  4DR5 D;  4DR2 D;  1HNX D;  1J5E D;  4DUZ D;  2VQE D;  3KBG A;  2VQF D;  2IST A;  4DV5 D;  4DV1 D;  2KTL A;  2E5L D;  4LF8 D;  4OX9 D;  4JI3 D;  1H3E A;  2HHH D;  2UUA D;  4OUD A;  4DR6 D;  2UXD D;  4B3R D;  1C05 A;  4NXN D;  4DR4 D;  4GKJ D;  1XNQ D;  4DV4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...