4X65D

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 59
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 4x65D01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 4x65D02
1C06A 4X65D 4X66D 4GKJD 4LFCD 2VQED 4LF4D 1HNZD 1N34D 4JI3D 1JH3A 4DUZD 3KBGA 1I94D 2F4VD 1IBKD 1XMQD 3HP7A 4NXND 4JI7D 2UXBD 4DR4D 2K6PA 4JI5D 4DR7D 4JI6D 4DUYD 1VIOA 4KHPD 4LF6D 4X64D 1IBLD 4DV2D 4JV5D 4LF5D 4JI8D 4LF7D 4DR6D 2JANA 4JI2D 1H3FA 4DV1D 1FKAD 3OTOD 4YY3D 5BR8D 4B3SD 1KSLA 1N32D 3T1YD 1XMOD 3T1HD 1XNQD 2ZM6D 1IBMD 5IWAD 4LF8D 2KTLA 4LFAD 4DR3D 1HNXD 2HHHD 4LGTA 2UXCD 1HR0D 2UUCD 1HNWD 2VQFD 4DV4D 4DV7D 4DR5D 4LFBD 4YHHD 1N36D 4JYAD 4JI1D 4NXMD 4B3MD 4DV6D 4GKKD 4DV0D 4DR2D 4OX9D 2UUBD 4AQYD 4DR1D 4JI0D 4OUDA 1P9KA 4K0KD 2UU9D 4B3TD 1KSVA 4B3RD 1XNRD 4JI4D 4LF9D 3DH3A 1H3EA 4DV3D 2UUAD 5LMUD 4DV5D 1FJGD 2ISTA 2UXDD 1KSKA 2E5LD 1C05A 1N33D 5LMND 1J5ED 1DM9A 4X62D
chains in the Genus database with same CATH superfamily
1C06A 4X65D 4X66D 4GKJD 4LFCD 2VQED 4LF4D 1HNZD 2NVUB 1N34D 4JI3D 1JH3A 4DUZD 3FN1A 5A2QE 1Y8QB 3KBGA 3CMMA 1I94D 2F4VD 1IBKD 1XMQD 3HP7A 4NXND 2I1SA 4JI7D 2UXBD 4II2A 4DR4D 2K6PA 4JI5D 4DR7D 4JI6D 4DUYD 1VIOA 4KHPD 4LF6D 4X64D 1IBLD 4DV2D 5KNLA 4JV5D 1Y8XB 4LF5D 4JI8D 4LF7D 4DR6D 2JANA 4JI2D 1H3FA 3J81E 2LQ7A 4DV1D 1FKAD 4II3A 3OTOD 4YY3D 5BR8D 4B3SD 1KSLA 1N32D 3T1YD 1XMOD 3T1HD 1XNQD 2ZM6D 1IBMD 5IWAD 4LF8D 2KTLA 4LFAD 4DR3D 1HNXD 2HHHD 4LGTA 2UXCD 1HR0D 2UUCD 1HNWD 3KYCB 2VQFD 5FLXE 4DV4D 3J7AF 4DV7D 4W5VB 4DR5D 2L3NA 4LFBD 4YHHD 1N36D 2ZTBA 4JYAD 4JI1D 4NXMD 4B3MD 4DV6D 4GKKD 4NNJA 4DV0D 4DR2D 4OX9D 2UUBD 4AQYD 4DR1D 5IT9E 3ONGA 4JI0D 4OUDA 1P9KA 5FQ2B 4K0KD 2UU9D 4B3TD 1KSVA 5LL6S 4B3RD 1XNRD 3JAME 3J80E 4JI4D 4LF9D 3DH3A 1H3EA 4DV3D 2UUAD 5LMUD 1Y8RB 4DV5D 1FJGD 3KYDB 2ISTA 2UXDD 3ONHA 1KSKA 2E5LD 1C05A 1N33D 5LMND 1J5ED 1DM9A 4X62D
chains in the Genus database with same CATH topology
1C06A 4X65D 4X66D 4GKJD 4LFCD 2VQED 4LF4D 1HNZD 1N34D 4JI3D 1JH3A 4DUZD 3KBGA 1I94D 2F4VD 1IBKD 1XMQD 3HP7A 4NXND 4JI7D 2UXBD 4DR4D 2K6PA 4JI5D 4DR7D 4JI6D 4DUYD 1VIOA 4KHPD 4LF6D 4X64D 1IBLD 4DV2D 4JV5D 4LF5D 4JI8D 4LF7D 4DR6D 2JANA 4JI2D 1H3FA 4DV1D 1FKAD 3OTOD 4YY3D 5BR8D 4B3SD 1KSLA 1N32D 3T1YD 1XMOD 3T1HD 1XNQD 2ZM6D 1IBMD 5IWAD 4LF8D 2KTLA 4LFAD 4DR3D 1HNXD 2HHHD 4LGTA 2UXCD 1HR0D 2UUCD 1HNWD 2VQFD 4DV4D 4DV7D 4DR5D 2L3NA 4LFBD 4YHHD 1N36D 4JYAD 4JI1D 4NXMD 4B3MD 4DV6D 4GKKD 4DV0D 4DR2D 4OX9D 2UUBD 4AQYD 4DR1D 4JI0D 4OUDA 1P9KA 4K0KD 2UU9D 4B3TD 1KSVA 4B3RD 1XNRD 4JI4D 4LF9D 3DH3A 1H3EA 4DV3D 2UUAD 5LMUD 4DV5D 1FJGD 2ISTA 2UXDD 1KSKA 2E5LD 1C05A 1N33D 5LMND 1J5ED 1DM9A 4X62D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C06 A;  4X65 D;  4X66 D;  4GKJ D;  4LFC D;  2VQE D;  4LF4 D;  1HNZ D;  1N34 D;  4JI3 D;  1JH3 A;  4DUZ D;  3KBG A;  1I94 D;  2F4V D;  1IBK D;  1XMQ D;  3HP7 A;  4NXN D;  4JI7 D;  2UXB D;  4DR4 D;  2K6P A;  4JI5 D;  4DR7 D;  4JI6 D;  4DUY D;  1VIO A;  4KHP D;  4LF6 D;  4X64 D;  1IBL D;  4DV2 D;  4JV5 D;  4LF5 D;  4JI8 D;  4LF7 D;  4DR6 D;  2JAN A;  4JI2 D;  1H3F A;  4DV1 D;  1FKA D;  3OTO D;  4YY3 D;  5BR8 D;  4B3S D;  1KSL A;  1N32 D;  3T1Y D;  1XMO D;  3T1H D;  1XNQ D;  2ZM6 D;  1IBM D;  5IWA D;  4LF8 D;  2KTL A;  4LFA D;  4DR3 D;  1HNX D;  2HHH D;  4LGT A;  2UXC D;  1HR0 D;  2UUC D;  1HNW D;  2VQF D;  4DV4 D;  4DV7 D;  4DR5 D;  4LFB D;  4YHH D;  1N36 D;  4JYA D;  4JI1 D;  4NXM D;  4B3M D;  4DV6 D;  4GKK D;  4DV0 D;  4DR2 D;  4OX9 D;  2UUB D;  4AQY D;  4DR1 D;  4JI0 D;  4OUD A;  1P9K A;  4K0K D;  2UU9 D;  4B3T D;  1KSV A;  4B3R D;  1XNR D;  4JI4 D;  4LF9 D;  3DH3 A;  1H3E A;  4DV3 D;  2UUA D;  5LMU D;  4DV5 D;  1FJG D;  2IST A;  2UXD D;  1KSK A;  2E5L D;  1C05 A;  1N33 D;  5LMN D;  1J5E D;  1DM9 A;  4X62 D; 
#chains in the Genus database with same CATH topology
 1C06 A;  4X65 D;  4X66 D;  4GKJ D;  4LFC D;  2VQE D;  4LF4 D;  1HNZ D;  2NVU B;  1N34 D;  4JI3 D;  1JH3 A;  4DUZ D;  3FN1 A;  5A2Q E;  1Y8Q B;  3KBG A;  3CMM A;  1I94 D;  2F4V D;  1IBK D;  1XMQ D;  3HP7 A;  4NXN D;  2I1S A;  4JI7 D;  2UXB D;  4II2 A;  4DR4 D;  2K6P A;  4JI5 D;  4DR7 D;  4JI6 D;  4DUY D;  1VIO A;  4KHP D;  4LF6 D;  4X64 D;  1IBL D;  4DV2 D;  5KNL A;  4JV5 D;  1Y8X B;  4LF5 D;  4JI8 D;  4LF7 D;  4DR6 D;  2JAN A;  4JI2 D;  1H3F A;  3J81 E;  2LQ7 A;  4DV1 D;  1FKA D;  4II3 A;  3OTO D;  4YY3 D;  5BR8 D;  4B3S D;  1KSL A;  1N32 D;  3T1Y D;  1XMO D;  3T1H D;  1XNQ D;  2ZM6 D;  1IBM D;  5IWA D;  4LF8 D;  2KTL A;  4LFA D;  4DR3 D;  1HNX D;  2HHH D;  4LGT A;  2UXC D;  1HR0 D;  2UUC D;  1HNW D;  3KYC B;  2VQF D;  5FLX E;  4DV4 D;  3J7A F;  4DV7 D;  4W5V B;  4DR5 D;  2L3N A;  4LFB D;  4YHH D;  1N36 D;  2ZTB A;  4JYA D;  4JI1 D;  4NXM D;  4B3M D;  4DV6 D;  4GKK D;  4NNJ A;  4DV0 D;  4DR2 D;  4OX9 D;  2UUB D;  4AQY D;  4DR1 D;  5IT9 E;  3ONG A;  4JI0 D;  4OUD A;  1P9K A;  5FQ2 B;  4K0K D;  2UU9 D;  4B3T D;  1KSV A;  5LL6 S;  4B3R D;  1XNR D;  3JAM E;  3J80 E;  4JI4 D;  4LF9 D;  3DH3 A;  1H3E A;  4DV3 D;  2UUA D;  5LMU D;  1Y8R B;  4DV5 D;  1FJG D;  3KYD B;  2IST A;  2UXD D;  3ONH A;  1KSK A;  2E5L D;  1C05 A;  1N33 D;  5LMN D;  1J5E D;  1DM9 A;  4X62 D; 
#chains in the Genus database with same CATH homology
 1C06 A;  4X65 D;  4X66 D;  4GKJ D;  4LFC D;  2VQE D;  4LF4 D;  1HNZ D;  1N34 D;  4JI3 D;  1JH3 A;  4DUZ D;  3KBG A;  1I94 D;  2F4V D;  1IBK D;  1XMQ D;  3HP7 A;  4NXN D;  4JI7 D;  2UXB D;  4DR4 D;  2K6P A;  4JI5 D;  4DR7 D;  4JI6 D;  4DUY D;  1VIO A;  4KHP D;  4LF6 D;  4X64 D;  1IBL D;  4DV2 D;  4JV5 D;  4LF5 D;  4JI8 D;  4LF7 D;  4DR6 D;  2JAN A;  4JI2 D;  1H3F A;  4DV1 D;  1FKA D;  3OTO D;  4YY3 D;  5BR8 D;  4B3S D;  1KSL A;  1N32 D;  3T1Y D;  1XMO D;  3T1H D;  1XNQ D;  2ZM6 D;  1IBM D;  5IWA D;  4LF8 D;  2KTL A;  4LFA D;  4DR3 D;  1HNX D;  2HHH D;  4LGT A;  2UXC D;  1HR0 D;  2UUC D;  1HNW D;  2VQF D;  4DV4 D;  4DV7 D;  4DR5 D;  2L3N A;  4LFB D;  4YHH D;  1N36 D;  4JYA D;  4JI1 D;  4NXM D;  4B3M D;  4DV6 D;  4GKK D;  4DV0 D;  4DR2 D;  4OX9 D;  2UUB D;  4AQY D;  4DR1 D;  4JI0 D;  4OUD A;  1P9K A;  4K0K D;  2UU9 D;  4B3T D;  1KSV A;  4B3R D;  1XNR D;  4JI4 D;  4LF9 D;  3DH3 A;  1H3E A;  4DV3 D;  2UUA D;  5LMU D;  4DV5 D;  1FJG D;  2IST A;  2UXD D;  1KSK A;  2E5L D;  1C05 A;  1N33 D;  5LMN D;  1J5E D;  1DM9 A;  4X62 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...