4LF4D

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 60
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 4lf4D01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 4lf4D02
1XNRD 4DUYD 1H3FA 1KSLA 1XMQD 1N36D 4DV3D 4JI7D 4DV4D 2VQFD 4YY3D 4YHHD 2UUCD 4NXMD 2UXBD 4JI4D 2JANA 4GKJD 5IWAD 4JI3D 4X62D 4LF6D 4JI5D 2UXCD 4JI2D 4LFCD 1DM9A 1N32D 4LF4D 2ISTA 1HNZD 1N33D 2K6PA 4OUDA 4DV0D 3T1YD 4DV1D 2KTLA 4AQYD 1C05A 1XNQD 4GKKD 4DR5D 4DR3D 4DR6D 1XMOD 1HR0D 4LGTA 4B3MD 4B3SD 4OX9D 4LFAD 2HHHD 1VIOA 4NXND 1H3EA 4DV5D 4JI8D 3HP7A 4B3TD 4LF8D 4X65D 4DR7D 1IBMD 2UU9D 4JI1D 4X66D 4KHPD 4DV2D 5LMUD 2E5LD 1KSVA 1P9KA 1HNWD 4DV7D 4LF5D 1IBKD 4JYAD 2UUAD 1JH3A 5LMND 4DR1D 1N34D 3KBGA 3OTOD 4JI6D 2VQED 2ZM6D 2UXDD 4DR4D 1FKAD 1I94D 4LF7D 1HNXD 1KSKA 4JI0D 2UUBD 4DV6D 4DUZD 4K0KD 4X64D 5BR8D 1FJGD 4LFBD 4LF9D 3DH3A 1C06A 4DR2D 1J5ED 1IBLD 4B3RD 2F4VD 3T1HD 4JV5D
chains in the Genus database with same CATH superfamily
1XNRD 4DUYD 1H3FA 1KSLA 4W5VB 1XMQD 1N36D 4DV3D 4JI7D 2NVUB 4DV4D 1Y8QB 5FLXE 2VQFD 4YY3D 4YHHD 2UUCD 4NXMD 2UXBD 4JI4D 2JANA 3KYDB 4GKJD 3KYCB 2LQ7A 5IWAD 4JI3D 4X62D 4LF6D 4JI5D 2UXCD 4JI2D 5A2QE 4LFCD 1DM9A 1N32D 4LF4D 3FN1A 2ISTA 1HNZD 1N33D 2K6PA 4OUDA 5KNLA 4DV0D 3T1YD 4DV1D 2KTLA 4AQYD 1C05A 1XNQD 2ZTBA 4GKKD 5FQ2B 4DR5D 4DR3D 2I1SA 4DR6D 1XMOD 1HR0D 4LGTA 4B3MD 4B3SD 4OX9D 4LFAD 3J80E 3CMMA 2HHHD 1VIOA 4NXND 2L3NA 1H3EA 4DV5D 4JI8D 5LL6S 3HP7A 3J81E 4B3TD 4LF8D 4X65D 4DR7D 1IBMD 2UU9D 4JI1D 4X66D 1Y8XB 4KHPD 4DV2D 4II3A 5LMUD 5IT9E 2E5LD 4NNJA 1KSVA 1P9KA 1HNWD 4DV7D 3JAME 4LF5D 1IBKD 4JYAD 2UUAD 1JH3A 5LMND 4DR1D 1N34D 3KBGA 3OTOD 4JI6D 2VQED 2ZM6D 2UXDD 4DR4D 3ONGA 1FKAD 1I94D 4II2A 4LF7D 1HNXD 1KSKA 4JI0D 2UUBD 4DV6D 4DUZD 4K0KD 4X64D 5BR8D 1FJGD 4LFBD 4LF9D 3DH3A 1C06A 4DR2D 1J5ED 1Y8RB 3J7AF 3ONHA 1IBLD 4B3RD 2F4VD 3T1HD 4JV5D
chains in the Genus database with same CATH topology
1XNRD 4DUYD 1H3FA 1KSLA 1XMQD 1N36D 4DV3D 4JI7D 4DV4D 2VQFD 4YY3D 4YHHD 2UUCD 4NXMD 2UXBD 4JI4D 2JANA 4GKJD 5IWAD 4JI3D 4X62D 4LF6D 4JI5D 2UXCD 4JI2D 4LFCD 1DM9A 1N32D 4LF4D 2ISTA 1HNZD 1N33D 2K6PA 4OUDA 4DV0D 3T1YD 4DV1D 2KTLA 4AQYD 1C05A 1XNQD 4GKKD 4DR5D 4DR3D 4DR6D 1XMOD 1HR0D 4LGTA 4B3MD 4B3SD 4OX9D 4LFAD 2HHHD 1VIOA 4NXND 2L3NA 1H3EA 4DV5D 4JI8D 3HP7A 4B3TD 4LF8D 4X65D 4DR7D 1IBMD 2UU9D 4JI1D 4X66D 4KHPD 4DV2D 5LMUD 2E5LD 1KSVA 1P9KA 1HNWD 4DV7D 4LF5D 1IBKD 4JYAD 2UUAD 1JH3A 5LMND 4DR1D 1N34D 3KBGA 3OTOD 4JI6D 2VQED 2ZM6D 2UXDD 4DR4D 1FKAD 1I94D 4LF7D 1HNXD 1KSKA 4JI0D 2UUBD 4DV6D 4DUZD 4K0KD 4X64D 5BR8D 1FJGD 4LFBD 4LF9D 3DH3A 1C06A 4DR2D 1J5ED 1IBLD 4B3RD 2F4VD 3T1HD 4JV5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR D;  4DUY D;  1H3F A;  1KSL A;  1XMQ D;  1N36 D;  4DV3 D;  4JI7 D;  4DV4 D;  2VQF D;  4YY3 D;  4YHH D;  2UUC D;  4NXM D;  2UXB D;  4JI4 D;  2JAN A;  4GKJ D;  5IWA D;  4JI3 D;  4X62 D;  4LF6 D;  4JI5 D;  2UXC D;  4JI2 D;  4LFC D;  1DM9 A;  1N32 D;  4LF4 D;  2IST A;  1HNZ D;  1N33 D;  2K6P A;  4OUD A;  4DV0 D;  3T1Y D;  4DV1 D;  2KTL A;  4AQY D;  1C05 A;  1XNQ D;  4GKK D;  4DR5 D;  4DR3 D;  4DR6 D;  1XMO D;  1HR0 D;  4LGT A;  4B3M D;  4B3S D;  4OX9 D;  4LFA D;  2HHH D;  1VIO A;  4NXN D;  1H3E A;  4DV5 D;  4JI8 D;  3HP7 A;  4B3T D;  4LF8 D;  4X65 D;  4DR7 D;  1IBM D;  2UU9 D;  4JI1 D;  4X66 D;  4KHP D;  4DV2 D;  5LMU D;  2E5L D;  1KSV A;  1P9K A;  1HNW D;  4DV7 D;  4LF5 D;  1IBK D;  4JYA D;  2UUA D;  1JH3 A;  5LMN D;  4DR1 D;  1N34 D;  3KBG A;  3OTO D;  4JI6 D;  2VQE D;  2ZM6 D;  2UXD D;  4DR4 D;  1FKA D;  1I94 D;  4LF7 D;  1HNX D;  1KSK A;  4JI0 D;  2UUB D;  4DV6 D;  4DUZ D;  4K0K D;  4X64 D;  5BR8 D;  1FJG D;  4LFB D;  4LF9 D;  3DH3 A;  1C06 A;  4DR2 D;  1J5E D;  1IBL D;  4B3R D;  2F4V D;  3T1H D;  4JV5 D; 
#chains in the Genus database with same CATH topology
 1XNR D;  4DUY D;  1H3F A;  1KSL A;  4W5V B;  1XMQ D;  1N36 D;  4DV3 D;  4JI7 D;  2NVU B;  4DV4 D;  1Y8Q B;  5FLX E;  2VQF D;  4YY3 D;  4YHH D;  2UUC D;  4NXM D;  2UXB D;  4JI4 D;  2JAN A;  3KYD B;  4GKJ D;  3KYC B;  2LQ7 A;  5IWA D;  4JI3 D;  4X62 D;  4LF6 D;  4JI5 D;  2UXC D;  4JI2 D;  5A2Q E;  4LFC D;  1DM9 A;  1N32 D;  4LF4 D;  3FN1 A;  2IST A;  1HNZ D;  1N33 D;  2K6P A;  4OUD A;  5KNL A;  4DV0 D;  3T1Y D;  4DV1 D;  2KTL A;  4AQY D;  1C05 A;  1XNQ D;  2ZTB A;  4GKK D;  5FQ2 B;  4DR5 D;  4DR3 D;  2I1S A;  4DR6 D;  1XMO D;  1HR0 D;  4LGT A;  4B3M D;  4B3S D;  4OX9 D;  4LFA D;  3J80 E;  3CMM A;  2HHH D;  1VIO A;  4NXN D;  2L3N A;  1H3E A;  4DV5 D;  4JI8 D;  5LL6 S;  3HP7 A;  3J81 E;  4B3T D;  4LF8 D;  4X65 D;  4DR7 D;  1IBM D;  2UU9 D;  4JI1 D;  4X66 D;  1Y8X B;  4KHP D;  4DV2 D;  4II3 A;  5LMU D;  5IT9 E;  2E5L D;  4NNJ A;  1KSV A;  1P9K A;  1HNW D;  4DV7 D;  3JAM E;  4LF5 D;  1IBK D;  4JYA D;  2UUA D;  1JH3 A;  5LMN D;  4DR1 D;  1N34 D;  3KBG A;  3OTO D;  4JI6 D;  2VQE D;  2ZM6 D;  2UXD D;  4DR4 D;  3ONG A;  1FKA D;  1I94 D;  4II2 A;  4LF7 D;  1HNX D;  1KSK A;  4JI0 D;  2UUB D;  4DV6 D;  4DUZ D;  4K0K D;  4X64 D;  5BR8 D;  1FJG D;  4LFB D;  4LF9 D;  3DH3 A;  1C06 A;  4DR2 D;  1J5E D;  1Y8R B;  3J7A F;  3ONH A;  1IBL D;  4B3R D;  2F4V D;  3T1H D;  4JV5 D; 
#chains in the Genus database with same CATH homology
 1XNR D;  4DUY D;  1H3F A;  1KSL A;  1XMQ D;  1N36 D;  4DV3 D;  4JI7 D;  4DV4 D;  2VQF D;  4YY3 D;  4YHH D;  2UUC D;  4NXM D;  2UXB D;  4JI4 D;  2JAN A;  4GKJ D;  5IWA D;  4JI3 D;  4X62 D;  4LF6 D;  4JI5 D;  2UXC D;  4JI2 D;  4LFC D;  1DM9 A;  1N32 D;  4LF4 D;  2IST A;  1HNZ D;  1N33 D;  2K6P A;  4OUD A;  4DV0 D;  3T1Y D;  4DV1 D;  2KTL A;  4AQY D;  1C05 A;  1XNQ D;  4GKK D;  4DR5 D;  4DR3 D;  4DR6 D;  1XMO D;  1HR0 D;  4LGT A;  4B3M D;  4B3S D;  4OX9 D;  4LFA D;  2HHH D;  1VIO A;  4NXN D;  2L3N A;  1H3E A;  4DV5 D;  4JI8 D;  3HP7 A;  4B3T D;  4LF8 D;  4X65 D;  4DR7 D;  1IBM D;  2UU9 D;  4JI1 D;  4X66 D;  4KHP D;  4DV2 D;  5LMU D;  2E5L D;  1KSV A;  1P9K A;  1HNW D;  4DV7 D;  4LF5 D;  1IBK D;  4JYA D;  2UUA D;  1JH3 A;  5LMN D;  4DR1 D;  1N34 D;  3KBG A;  3OTO D;  4JI6 D;  2VQE D;  2ZM6 D;  2UXD D;  4DR4 D;  1FKA D;  1I94 D;  4LF7 D;  1HNX D;  1KSK A;  4JI0 D;  2UUB D;  4DV6 D;  4DUZ D;  4K0K D;  4X64 D;  5BR8 D;  1FJG D;  4LFB D;  4LF9 D;  3DH3 A;  1C06 A;  4DR2 D;  1J5E D;  1IBL D;  4B3R D;  2F4V D;  3T1H D;  4JV5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...