4DV0D

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 54
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 4dv0D01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 4dv0D02
5LMUD 2UXDD 4DR5D 4DV0D 4DUZD 4JI0D 4B3TD 4DV5D 4LFBD 4JI3D 4DV4D 2UXCD 1I94D 4JI8D 4LF6D 4LF7D 2JANA 4LF4D 4X66D 1HR0D 4JI7D 2VQED 4JV5D 4JI4D 1IBLD 4X62D 1C06A 4DV1D 2UUBD 1N33D 4DR3D 1JH3A 1KSLA 4DV2D 2KTLA 3KBGA 4DV3D 1IBMD 4OUDA 1XNRD 2UXBD 1C05A 4X64D 4DV6D 1FJGD 4YY3D 4B3RD 4B3MD 3OTOD 4AQYD 5BR8D 4NXMD 1P9KA 2ISTA 2K6PA 4DR2D 4DR1D 4LF9D 1FKAD 1IBKD 4JYAD 1HNXD 3DH3A 4LFCD 1DM9A 2UUAD 4DR6D 1XNQD 1H3EA 1N36D 3T1HD 2UU9D 5IWAD 4KHPD 1XMQD 4DR4D 4K0KD 4JI2D 1VIOA 5LMND 3T1YD 4JI5D 2UUCD 1H3FA 1N32D 1HNWD 1KSVA 4X65D 4LFAD 4JI6D 2VQFD 4DUYD 4GKKD 4NXND 2E5LD 4LF5D 1XMOD 4GKJD 1HNZD 1J5ED 4B3SD 1N34D 4JI1D 4LF8D 4DV7D 4DR7D 3HP7A 2F4VD 1KSKA 4YHHD 4OX9D 2ZM6D 4LGTA 2HHHD
chains in the Genus database with same CATH superfamily
5LMUD 2UXDD 4DR5D 4DV0D 4DUZD 3ONGA 4JI0D 4B3TD 4DV5D 4LFBD 4NNJA 4JI3D 4DV4D 2UXCD 1I94D 4JI8D 4LF6D 4LF7D 2JANA 4LF4D 3FN1A 4X66D 1HR0D 4JI7D 2VQED 4JV5D 4JI4D 1IBLD 4X62D 1C06A 4DV1D 2UUBD 1N33D 1Y8XB 4DR3D 2ZTBA 1JH3A 3CMMA 3KYCB 1KSLA 4DV2D 2NVUB 2KTLA 3KBGA 3KYDB 3ONHA 4DV3D 5A2QE 1IBMD 4OUDA 1XNRD 2UXBD 1C05A 4X64D 4DV6D 1FJGD 4YY3D 4B3RD 4B3MD 3OTOD 4AQYD 5LL6S 5BR8D 4NXMD 2L3NA 1P9KA 5IT9E 2ISTA 2K6PA 4DR2D 1Y8QB 4DR1D 4LF9D 1FKAD 1IBKD 4JYAD 3J7AF 1HNXD 3DH3A 4LFCD 1DM9A 2LQ7A 2UUAD 4II3A 4DR6D 1Y8RB 1XNQD 1H3EA 1N36D 3T1HD 2UU9D 5FQ2B 5IWAD 4KHPD 1XMQD 3J81E 4DR4D 4K0KD 4JI2D 5KNLA 1VIOA 5LMND 3T1YD 4JI5D 2UUCD 1H3FA 1N32D 1HNWD 1KSVA 4X65D 4II2A 4LFAD 4JI6D 2VQFD 4DUYD 4GKKD 4NXND 2E5LD 3J80E 4LF5D 1XMOD 4GKJD 1HNZD 1J5ED 4B3SD 1N34D 4W5VB 4JI1D 4LF8D 4DV7D 4DR7D 3HP7A 3JAME 5FLXE 2I1SA 2F4VD 1KSKA 4YHHD 4OX9D 2ZM6D 4LGTA 2HHHD
chains in the Genus database with same CATH topology
5LMUD 2UXDD 4DR5D 4DV0D 4DUZD 4JI0D 4B3TD 4DV5D 4LFBD 4JI3D 4DV4D 2UXCD 1I94D 4JI8D 4LF6D 4LF7D 2JANA 4LF4D 4X66D 1HR0D 4JI7D 2VQED 4JV5D 4JI4D 1IBLD 4X62D 1C06A 4DV1D 2UUBD 1N33D 4DR3D 1JH3A 1KSLA 4DV2D 2KTLA 3KBGA 4DV3D 1IBMD 4OUDA 1XNRD 2UXBD 1C05A 4X64D 4DV6D 1FJGD 4YY3D 4B3RD 4B3MD 3OTOD 4AQYD 5BR8D 4NXMD 2L3NA 1P9KA 2ISTA 2K6PA 4DR2D 4DR1D 4LF9D 1FKAD 1IBKD 4JYAD 1HNXD 3DH3A 4LFCD 1DM9A 2UUAD 4DR6D 1XNQD 1H3EA 1N36D 3T1HD 2UU9D 5IWAD 4KHPD 1XMQD 4DR4D 4K0KD 4JI2D 1VIOA 5LMND 3T1YD 4JI5D 2UUCD 1H3FA 1N32D 1HNWD 1KSVA 4X65D 4LFAD 4JI6D 2VQFD 4DUYD 4GKKD 4NXND 2E5LD 4LF5D 1XMOD 4GKJD 1HNZD 1J5ED 4B3SD 1N34D 4JI1D 4LF8D 4DV7D 4DR7D 3HP7A 2F4VD 1KSKA 4YHHD 4OX9D 2ZM6D 4LGTA 2HHHD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU D;  2UXD D;  4DR5 D;  4DV0 D;  4DUZ D;  4JI0 D;  4B3T D;  4DV5 D;  4LFB D;  4JI3 D;  4DV4 D;  2UXC D;  1I94 D;  4JI8 D;  4LF6 D;  4LF7 D;  2JAN A;  4LF4 D;  4X66 D;  1HR0 D;  4JI7 D;  2VQE D;  4JV5 D;  4JI4 D;  1IBL D;  4X62 D;  1C06 A;  4DV1 D;  2UUB D;  1N33 D;  4DR3 D;  1JH3 A;  1KSL A;  4DV2 D;  2KTL A;  3KBG A;  4DV3 D;  1IBM D;  4OUD A;  1XNR D;  2UXB D;  1C05 A;  4X64 D;  4DV6 D;  1FJG D;  4YY3 D;  4B3R D;  4B3M D;  3OTO D;  4AQY D;  5BR8 D;  4NXM D;  1P9K A;  2IST A;  2K6P A;  4DR2 D;  4DR1 D;  4LF9 D;  1FKA D;  1IBK D;  4JYA D;  1HNX D;  3DH3 A;  4LFC D;  1DM9 A;  2UUA D;  4DR6 D;  1XNQ D;  1H3E A;  1N36 D;  3T1H D;  2UU9 D;  5IWA D;  4KHP D;  1XMQ D;  4DR4 D;  4K0K D;  4JI2 D;  1VIO A;  5LMN D;  3T1Y D;  4JI5 D;  2UUC D;  1H3F A;  1N32 D;  1HNW D;  1KSV A;  4X65 D;  4LFA D;  4JI6 D;  2VQF D;  4DUY D;  4GKK D;  4NXN D;  2E5L D;  4LF5 D;  1XMO D;  4GKJ D;  1HNZ D;  1J5E D;  4B3S D;  1N34 D;  4JI1 D;  4LF8 D;  4DV7 D;  4DR7 D;  3HP7 A;  2F4V D;  1KSK A;  4YHH D;  4OX9 D;  2ZM6 D;  4LGT A;  2HHH D; 
#chains in the Genus database with same CATH topology
 5LMU D;  2UXD D;  4DR5 D;  4DV0 D;  4DUZ D;  3ONG A;  4JI0 D;  4B3T D;  4DV5 D;  4LFB D;  4NNJ A;  4JI3 D;  4DV4 D;  2UXC D;  1I94 D;  4JI8 D;  4LF6 D;  4LF7 D;  2JAN A;  4LF4 D;  3FN1 A;  4X66 D;  1HR0 D;  4JI7 D;  2VQE D;  4JV5 D;  4JI4 D;  1IBL D;  4X62 D;  1C06 A;  4DV1 D;  2UUB D;  1N33 D;  1Y8X B;  4DR3 D;  2ZTB A;  1JH3 A;  3CMM A;  3KYC B;  1KSL A;  4DV2 D;  2NVU B;  2KTL A;  3KBG A;  3KYD B;  3ONH A;  4DV3 D;  5A2Q E;  1IBM D;  4OUD A;  1XNR D;  2UXB D;  1C05 A;  4X64 D;  4DV6 D;  1FJG D;  4YY3 D;  4B3R D;  4B3M D;  3OTO D;  4AQY D;  5LL6 S;  5BR8 D;  4NXM D;  2L3N A;  1P9K A;  5IT9 E;  2IST A;  2K6P A;  4DR2 D;  1Y8Q B;  4DR1 D;  4LF9 D;  1FKA D;  1IBK D;  4JYA D;  3J7A F;  1HNX D;  3DH3 A;  4LFC D;  1DM9 A;  2LQ7 A;  2UUA D;  4II3 A;  4DR6 D;  1Y8R B;  1XNQ D;  1H3E A;  1N36 D;  3T1H D;  2UU9 D;  5FQ2 B;  5IWA D;  4KHP D;  1XMQ D;  3J81 E;  4DR4 D;  4K0K D;  4JI2 D;  5KNL A;  1VIO A;  5LMN D;  3T1Y D;  4JI5 D;  2UUC D;  1H3F A;  1N32 D;  1HNW D;  1KSV A;  4X65 D;  4II2 A;  4LFA D;  4JI6 D;  2VQF D;  4DUY D;  4GKK D;  4NXN D;  2E5L D;  3J80 E;  4LF5 D;  1XMO D;  4GKJ D;  1HNZ D;  1J5E D;  4B3S D;  1N34 D;  4W5V B;  4JI1 D;  4LF8 D;  4DV7 D;  4DR7 D;  3HP7 A;  3JAM E;  5FLX E;  2I1S A;  2F4V D;  1KSK A;  4YHH D;  4OX9 D;  2ZM6 D;  4LGT A;  2HHH D; 
#chains in the Genus database with same CATH homology
 5LMU D;  2UXD D;  4DR5 D;  4DV0 D;  4DUZ D;  4JI0 D;  4B3T D;  4DV5 D;  4LFB D;  4JI3 D;  4DV4 D;  2UXC D;  1I94 D;  4JI8 D;  4LF6 D;  4LF7 D;  2JAN A;  4LF4 D;  4X66 D;  1HR0 D;  4JI7 D;  2VQE D;  4JV5 D;  4JI4 D;  1IBL D;  4X62 D;  1C06 A;  4DV1 D;  2UUB D;  1N33 D;  4DR3 D;  1JH3 A;  1KSL A;  4DV2 D;  2KTL A;  3KBG A;  4DV3 D;  1IBM D;  4OUD A;  1XNR D;  2UXB D;  1C05 A;  4X64 D;  4DV6 D;  1FJG D;  4YY3 D;  4B3R D;  4B3M D;  3OTO D;  4AQY D;  5BR8 D;  4NXM D;  2L3N A;  1P9K A;  2IST A;  2K6P A;  4DR2 D;  4DR1 D;  4LF9 D;  1FKA D;  1IBK D;  4JYA D;  1HNX D;  3DH3 A;  4LFC D;  1DM9 A;  2UUA D;  4DR6 D;  1XNQ D;  1H3E A;  1N36 D;  3T1H D;  2UU9 D;  5IWA D;  4KHP D;  1XMQ D;  4DR4 D;  4K0K D;  4JI2 D;  1VIO A;  5LMN D;  3T1Y D;  4JI5 D;  2UUC D;  1H3F A;  1N32 D;  1HNW D;  1KSV A;  4X65 D;  4LFA D;  4JI6 D;  2VQF D;  4DUY D;  4GKK D;  4NXN D;  2E5L D;  4LF5 D;  1XMO D;  4GKJ D;  1HNZ D;  1J5E D;  4B3S D;  1N34 D;  4JI1 D;  4LF8 D;  4DV7 D;  4DR7 D;  3HP7 A;  2F4V D;  1KSK A;  4YHH D;  4OX9 D;  2ZM6 D;  4LGT A;  2HHH D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...