1HNWD

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 60
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 1hnwD01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 1hnwD02
4JI8D 4DV4D 4JI4D 4JI6D 3OTOD 1KSLA 5BR8D 1I94D 4GKKD 4X64D 3DH3A 4KHPD 2KTLA 4X66D 4DR4D 2UUAD 1XMOD 4GKJD 4B3RD 4DV3D 1N36D 4LF6D 4LFBD 4JI0D 1JH3A 4LF5D 4LGTA 1IBLD 4LF7D 1N33D 1N32D 1H3FA 1DM9A 4LFAD 4JI3D 4DV6D 3T1YD 2VQFD 2UUBD 2K6PA 1KSKA 2HHHD 5IWAD 1XNRD 4JI5D 4LF9D 1N34D 4DV5D 2E5LD 4OUDA 4JV5D 1HNXD 1C05A 1IBMD 1FJGD 2UUCD 4DR6D 2UXDD 4LFCD 1XNQD 5LMUD 4DV2D 2ZM6D 2UXCD 2UU9D 2ISTA 4NXMD 4YY3D 2F4VD 4DR3D 4LF8D 4YHHD 4B3MD 1HR0D 4DV1D 4NXND 4K0KD 1HNWD 4DV0D 1H3EA 1XMQD 4JYAD 1FKAD 4DR7D 1HNZD 4JI1D 4B3SD 4DR1D 3HP7A 1IBKD 4LF4D 1VIOA 1C06A 3KBGA 4AQYD 4X65D 1KSVA 5LMND 4DV7D 4X62D 4B3TD 1P9KA 4DUYD 2VQED 4JI7D 3T1HD 4JI2D 4DR5D 4DR2D 2UXBD 4DUZD 2JANA 1J5ED 4OX9D
chains in the Genus database with same CATH superfamily
3FN1A 4JI8D 4DV4D 4JI4D 4JI6D 3OTOD 1KSLA 5BR8D 1I94D 4GKKD 4X64D 3DH3A 4KHPD 2KTLA 3CMMA 4X66D 4DR4D 3KYCB 5FQ2B 3J81E 2UUAD 1XMOD 4GKJD 2I1SA 4B3RD 4DV3D 5FLXE 1N36D 4LF6D 4LFBD 4JI0D 1JH3A 4LF5D 4LGTA 1IBLD 4LF7D 1N33D 1N32D 1H3FA 3J7AF 1DM9A 4LFAD 4JI3D 4DV6D 3T1YD 2VQFD 2UUBD 2K6PA 1KSKA 2HHHD 3ONGA 5IWAD 1XNRD 4JI5D 4LF9D 4NNJA 1N34D 4DV5D 2E5LD 4OUDA 4II2A 4JV5D 1HNXD 1C05A 1IBMD 3J80E 1FJGD 2UUCD 3JAME 4DR6D 2UXDD 4LFCD 1XNQD 5LMUD 2LQ7A 4DV2D 2NVUB 2ZM6D 4II3A 2UXCD 2UU9D 2ISTA 4NXMD 4W5VB 4YY3D 2F4VD 4DR3D 4LF8D 4YHHD 1Y8QB 4B3MD 1HR0D 4DV1D 4NXND 4K0KD 1HNWD 4DV0D 1H3EA 1XMQD 4JYAD 5LL6S 1FKAD 4DR7D 1HNZD 4JI1D 3KYDB 4B3SD 4DR1D 3HP7A 1IBKD 4LF4D 1VIOA 1C06A 3KBGA 4AQYD 4X65D 1KSVA 5LMND 4DV7D 5KNLA 4X62D 5A2QE 5IT9E 4B3TD 1Y8XB 2L3NA 1P9KA 4DUYD 2VQED 4JI7D 3T1HD 4JI2D 4DR5D 1Y8RB 4DR2D 2UXBD 4DUZD 2JANA 1J5ED 3ONHA 4OX9D 2ZTBA
chains in the Genus database with same CATH topology
4JI8D 4DV4D 4JI4D 4JI6D 3OTOD 1KSLA 5BR8D 1I94D 4GKKD 4X64D 3DH3A 4KHPD 2KTLA 4X66D 4DR4D 2UUAD 1XMOD 4GKJD 4B3RD 4DV3D 1N36D 4LF6D 4LFBD 4JI0D 1JH3A 4LF5D 4LGTA 1IBLD 4LF7D 1N33D 1N32D 1H3FA 1DM9A 4LFAD 4JI3D 4DV6D 3T1YD 2VQFD 2UUBD 2K6PA 1KSKA 2HHHD 5IWAD 1XNRD 4JI5D 4LF9D 1N34D 4DV5D 2E5LD 4OUDA 4JV5D 1HNXD 1C05A 1IBMD 1FJGD 2UUCD 4DR6D 2UXDD 4LFCD 1XNQD 5LMUD 4DV2D 2ZM6D 2UXCD 2UU9D 2ISTA 4NXMD 4YY3D 2F4VD 4DR3D 4LF8D 4YHHD 4B3MD 1HR0D 4DV1D 4NXND 4K0KD 1HNWD 4DV0D 1H3EA 1XMQD 4JYAD 1FKAD 4DR7D 1HNZD 4JI1D 4B3SD 4DR1D 3HP7A 1IBKD 4LF4D 1VIOA 1C06A 3KBGA 4AQYD 4X65D 1KSVA 5LMND 4DV7D 4X62D 4B3TD 2L3NA 1P9KA 4DUYD 2VQED 4JI7D 3T1HD 4JI2D 4DR5D 4DR2D 2UXBD 4DUZD 2JANA 1J5ED 4OX9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 D;  4DV4 D;  4JI4 D;  4JI6 D;  3OTO D;  1KSL A;  5BR8 D;  1I94 D;  4GKK D;  4X64 D;  3DH3 A;  4KHP D;  2KTL A;  4X66 D;  4DR4 D;  2UUA D;  1XMO D;  4GKJ D;  4B3R D;  4DV3 D;  1N36 D;  4LF6 D;  4LFB D;  4JI0 D;  1JH3 A;  4LF5 D;  4LGT A;  1IBL D;  4LF7 D;  1N33 D;  1N32 D;  1H3F A;  1DM9 A;  4LFA D;  4JI3 D;  4DV6 D;  3T1Y D;  2VQF D;  2UUB D;  2K6P A;  1KSK A;  2HHH D;  5IWA D;  1XNR D;  4JI5 D;  4LF9 D;  1N34 D;  4DV5 D;  2E5L D;  4OUD A;  4JV5 D;  1HNX D;  1C05 A;  1IBM D;  1FJG D;  2UUC D;  4DR6 D;  2UXD D;  4LFC D;  1XNQ D;  5LMU D;  4DV2 D;  2ZM6 D;  2UXC D;  2UU9 D;  2IST A;  4NXM D;  4YY3 D;  2F4V D;  4DR3 D;  4LF8 D;  4YHH D;  4B3M D;  1HR0 D;  4DV1 D;  4NXN D;  4K0K D;  1HNW D;  4DV0 D;  1H3E A;  1XMQ D;  4JYA D;  1FKA D;  4DR7 D;  1HNZ D;  4JI1 D;  4B3S D;  4DR1 D;  3HP7 A;  1IBK D;  4LF4 D;  1VIO A;  1C06 A;  3KBG A;  4AQY D;  4X65 D;  1KSV A;  5LMN D;  4DV7 D;  4X62 D;  4B3T D;  1P9K A;  4DUY D;  2VQE D;  4JI7 D;  3T1H D;  4JI2 D;  4DR5 D;  4DR2 D;  2UXB D;  4DUZ D;  2JAN A;  1J5E D;  4OX9 D; 
#chains in the Genus database with same CATH topology
 3FN1 A;  4JI8 D;  4DV4 D;  4JI4 D;  4JI6 D;  3OTO D;  1KSL A;  5BR8 D;  1I94 D;  4GKK D;  4X64 D;  3DH3 A;  4KHP D;  2KTL A;  3CMM A;  4X66 D;  4DR4 D;  3KYC B;  5FQ2 B;  3J81 E;  2UUA D;  1XMO D;  4GKJ D;  2I1S A;  4B3R D;  4DV3 D;  5FLX E;  1N36 D;  4LF6 D;  4LFB D;  4JI0 D;  1JH3 A;  4LF5 D;  4LGT A;  1IBL D;  4LF7 D;  1N33 D;  1N32 D;  1H3F A;  3J7A F;  1DM9 A;  4LFA D;  4JI3 D;  4DV6 D;  3T1Y D;  2VQF D;  2UUB D;  2K6P A;  1KSK A;  2HHH D;  3ONG A;  5IWA D;  1XNR D;  4JI5 D;  4LF9 D;  4NNJ A;  1N34 D;  4DV5 D;  2E5L D;  4OUD A;  4II2 A;  4JV5 D;  1HNX D;  1C05 A;  1IBM D;  3J80 E;  1FJG D;  2UUC D;  3JAM E;  4DR6 D;  2UXD D;  4LFC D;  1XNQ D;  5LMU D;  2LQ7 A;  4DV2 D;  2NVU B;  2ZM6 D;  4II3 A;  2UXC D;  2UU9 D;  2IST A;  4NXM D;  4W5V B;  4YY3 D;  2F4V D;  4DR3 D;  4LF8 D;  4YHH D;  1Y8Q B;  4B3M D;  1HR0 D;  4DV1 D;  4NXN D;  4K0K D;  1HNW D;  4DV0 D;  1H3E A;  1XMQ D;  4JYA D;  5LL6 S;  1FKA D;  4DR7 D;  1HNZ D;  4JI1 D;  3KYD B;  4B3S D;  4DR1 D;  3HP7 A;  1IBK D;  4LF4 D;  1VIO A;  1C06 A;  3KBG A;  4AQY D;  4X65 D;  1KSV A;  5LMN D;  4DV7 D;  5KNL A;  4X62 D;  5A2Q E;  5IT9 E;  4B3T D;  1Y8X B;  2L3N A;  1P9K A;  4DUY D;  2VQE D;  4JI7 D;  3T1H D;  4JI2 D;  4DR5 D;  1Y8R B;  4DR2 D;  2UXB D;  4DUZ D;  2JAN A;  1J5E D;  3ONH A;  4OX9 D;  2ZTB A; 
#chains in the Genus database with same CATH homology
 4JI8 D;  4DV4 D;  4JI4 D;  4JI6 D;  3OTO D;  1KSL A;  5BR8 D;  1I94 D;  4GKK D;  4X64 D;  3DH3 A;  4KHP D;  2KTL A;  4X66 D;  4DR4 D;  2UUA D;  1XMO D;  4GKJ D;  4B3R D;  4DV3 D;  1N36 D;  4LF6 D;  4LFB D;  4JI0 D;  1JH3 A;  4LF5 D;  4LGT A;  1IBL D;  4LF7 D;  1N33 D;  1N32 D;  1H3F A;  1DM9 A;  4LFA D;  4JI3 D;  4DV6 D;  3T1Y D;  2VQF D;  2UUB D;  2K6P A;  1KSK A;  2HHH D;  5IWA D;  1XNR D;  4JI5 D;  4LF9 D;  1N34 D;  4DV5 D;  2E5L D;  4OUD A;  4JV5 D;  1HNX D;  1C05 A;  1IBM D;  1FJG D;  2UUC D;  4DR6 D;  2UXD D;  4LFC D;  1XNQ D;  5LMU D;  4DV2 D;  2ZM6 D;  2UXC D;  2UU9 D;  2IST A;  4NXM D;  4YY3 D;  2F4V D;  4DR3 D;  4LF8 D;  4YHH D;  4B3M D;  1HR0 D;  4DV1 D;  4NXN D;  4K0K D;  1HNW D;  4DV0 D;  1H3E A;  1XMQ D;  4JYA D;  1FKA D;  4DR7 D;  1HNZ D;  4JI1 D;  4B3S D;  4DR1 D;  3HP7 A;  1IBK D;  4LF4 D;  1VIO A;  1C06 A;  3KBG A;  4AQY D;  4X65 D;  1KSV A;  5LMN D;  4DV7 D;  4X62 D;  4B3T D;  2L3N A;  1P9K A;  4DUY D;  2VQE D;  4JI7 D;  3T1H D;  4JI2 D;  4DR5 D;  4DR2 D;  2UXB D;  4DUZ D;  2JAN A;  1J5E D;  4OX9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...