3SAIA

Bacuills anthracis dihydrofolate reductase bound to propargyl-linked tmp analog, ucp1015
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
165
Chain Sequence
HHHMRVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNEGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHAFEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHVYEKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SAR studies of heterocyclic propargyl-linked TMP analogs targeting Bacillus dihydrofolate reductase
rcsb
molecule keywords Dihydrofolate reductase
molecule tags Oxidoreductase
source organism Bacillus anthracis
total genus 45
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 3saiA00
5ECCA 2ANOA 1DYIA 4ELBA 3NXYA 4Q6AA 3FQ0A 5HVEA 5JA3A 3UM6A 4PSSA 1DREA 2W3BA 4KL9A 5U26A 1DG5A 1DISA 3QL3A 4HA7A 3NTZA 2FZJA 3K45A 3M08A 4XT5A 1RX6A 3ZPGA 1RB2A 1RX3A 4H98A 2W3MA 1RX9A 4CD2A 1DYHA 1IA4A 4X5GA 1DRHA 4TU5X 2D5NA 4KJKA 1QZFA 2FZIA 3IRMA 1S3VA 3TQ8A 1MVTA 4OSGA 3CD2A 2O7PA 3NXTA 3FL8A 3FL9A 5ECXA 1U70A 3FQZA 2JYBA 3F0XX 3HBBA 3VCOA 4H95A 4P66A 4X5HA 1PD9A 5HT4A 3SH2A 1DHIA 3NXRA 1LY3A 4ELEA 2OIPA 3KGYA 4LAHX 5HPBA 3CL9A 1RD7A 3CLBA 1HFQA 1DLRA 3ROAA 1OHJA 4QLGA 3NZ9X 3FRBX 4M6KA 4P68A 3ZPCA 3L3RA 3RG9A 4M6JA 3SRWX 3GHWA 1HFRA 1VJ3A 4KEBA 3EEJA 1KLKA 3GI2A 4DPDA 3FS6A 4KBNA 4P3QA 4QHVA 1RX4A 1E26A 4X5JA 3OAFA 4NX6A 1M79A 1DF7A 4EILA 2W3AA 3QLZA 3DATA 3FREX 5HSUA 3FYVX 2AZNA 5CCCA 3NRRA 1RX7A 3QFXA 4KY8A 1DR1A 1RA2A 3QLYA 1RA8A 3K2HA 3EIGA 1SEJA 3QLSA 4QJCA 2H2QA 4KAKA 3JWCA 1DDRA 2BLCA 1S3WA 3IA4A 1DYRA 3QLWA 1DR4A 4PSTA 1RC4A 3FY9X 4KM2A 4KY4A 4G3MA 1VDRA 3QL0A 3LG4A 2W9GA 3INVA 3FQVA 4H96A 1RA3A 4EIZA 1KMSA 1LY4A 3DFRA 4PTHA 3DRCA 2DHFA 4LAGX 5HF2X 5JG0X 2QK8A 3FQOA 3SRSX 1RG7A 5CC9A 3SRUX 3TQ9A 3JVXA 3JWMA 1RA1A 1TDRA 1J3KA 2BLAA 3E0BA 3R33A 1RH3A 1S3UA 3JTWA 3CSEA 1IA3A 1U72A 4PDJA 4GH8A 3F8ZA 3JW3A 4G8ZX 3FQFA 4M7VA 3D84X 4ECKA 2G6VA 3IRNA 4KLXA 1RX1A 1U71A 3NU0A 2L28A 3F91A 4LAEX 3OCHA 3IX9A 3NZCX 3NZDA 3DL6A 1DRBA 3UM5A 3K47A 3UM8A 3QLXA 2KGKA 4Q67A 3EEMA 4FGHA 1ZDRA 4DFRA 1DR3A 3SRRX 3HJ3A 4DPHA 4FHBA 3S3VA 2HQPA 2B3ZA 4QI9A 3F0BX 2D0KA 3SQYX 4KNEA 1DDSA 2FZHA 3SA1A 2ITHA 1J3JA 3F8YA 1BOZA 4X5IA 3F0UX 3QYLA 3SA2A 1JUVA 4DP3A 1PDBA 2INQA 4XT4A 4HOGA 1M78A 3NZ6X 1AI9A 4QLEA 4I13A 3FY8X 4KJJA 1DRFA 5DFRA 3SRQX 5HQYA 4G95A 1CD2A 1DR5A 3F0VX 5HF0X 1S3YA 3JW5A 3K74A 3NXXA 4M7UA 3JWKA 1IA2A 3S7AA 3NZAX 2W3VA 4HOFA 1M7AA 1DLSA 3QG2A 3TD8A 1JOMA 4PTJA 3KFYA 3QLRA 3FQCA 1LUDA 2OBCA 1OHKA 3GHVA 4QLFA 1PD8A 3QYOA 4ELGA 2C2TA 4KJLA 1DG7A 6DFRA 5HSRA 4Q0EA 1MVSA 1DR2A 3IROA 2W9HA 1AO8A 1DRAA 3FYWX 3SAIA 3KY8A 3NXOA 2DRCA 3DG8A 1DHFA 5FDAA 2ZZAA 1YHOA 4RGCA 2P4GA 4KM0A 4XRBA 3NXVA 3KJSA 3KJRA 3EX8A 8DFRA 2W3WA 2W9TA 1DR6A 1IA1A 4KD7A 3N0HA 4DDRA 1DAJA 1RX5A 4ELFA 3JSUA 7DFRA 3FRDX 5E8QA 4FGGA 1DHJA 4PSYA 3EEKA 4EJ1A 1JOLA 3S9UA 2W9SA 4KFJA 1DIUA 1RA9A 3F0QX 4M2XA 5HUIA 3D80A 5HVBA 3FRAX 1DG8A 2LF1A 5HQZA 3NZBX 2ANQA 2HM9A 3FRFX 3RO9A 2XW7A 4X5FA 1RX2A 3DAUA 3GYFA 4XT7A 1BZFA 4IXFX 1DYJA 4H97A 3M09A 4NX7A 4Q0DA 1RF7A 4P3RA 3TQBA 4OR7A 5EAJA 4M6LA 3JWFA 3Q1HA 5HI6A 4HOEA 2GD9A 4HA9A 1DR7A 2BLBA 5U27A 3IA5A 3SR5X 3SGYA 4IXED 4EIGA 4LEKX 4QJZD 1RX8A 3GHCA 4I1NA 1RB3A 4XT6A 1RE7A 2CIGA 5DXVA 1KMVA 3DL5A 3F0SX 1AOEA 4XECX 2C2SA 4IXGX 2BL9A 3I3RA 2CD2A 1HFPA 4XT8A 3DGAA 3TQAA 5HT5A 4XE6X 3QGTA 1CZ3A 4KYAA 1D1GA 4ELHA 1J3IA 3I8AX 3EELA 2HXVA
chains in the Genus database with same CATH superfamily
5ECCA 2ANOA 1DYIA 4ELBA 3NXYA 4Q6AA 3FQ0A 5HVEA 5JA3A 3UM6A 4PSSA 1DREA 2W3BA 4KL9A 5U26A 1DG5A 1DISA 3QL3A 4HA7A 3NTZA 2FZJA 3K45A 3M08A 4XT5A 1RX6A 3ZPGA 1RB2A 1RX3A 4H98A 2W3MA 1RX9A 4CD2A 1DYHA 1IA4A 4X5GA 1DRHA 4TU5X 2D5NA 4KJKA 1QZFA 2FZIA 3IRMA 1S3VA 3TQ8A 1MVTA 4OSGA 3CD2A 2O7PA 3NXTA 3FL8A 3FL9A 5ECXA 1U70A 3FQZA 2JYBA 3F0XX 3HBBA 3VCOA 4H95A 4P66A 4X5HA 1PD9A 5HT4A 3SH2A 1DHIA 3NXRA 1LY3A 4ELEA 2OIPA 3KGYA 4LAHX 5HPBA 3CL9A 1RD7A 3CLBA 1HFQA 1DLRA 3ROAA 1OHJA 4QLGA 3NZ9X 3FRBX 4M6KA 4P68A 3ZPCA 3L3RA 3RG9A 4M6JA 3SRWX 3GHWA 1HFRA 1VJ3A 4KEBA 3EEJA 1KLKA 3GI2A 4DPDA 3FS6A 4KBNA 4P3QA 4QHVA 1RX4A 1E26A 4X5JA 3OAFA 4NX6A 1M79A 1DF7A 4EILA 2W3AA 3QLZA 3DATA 3FREX 5HSUA 3FYVX 2AZNA 5CCCA 3NRRA 1RX7A 3QFXA 4KY8A 1DR1A 1RA2A 3QLYA 1RA8A 3K2HA 3EIGA 1SEJA 3QLSA 4QJCA 2H2QA 4KAKA 3JWCA 1DDRA 2BLCA 1S3WA 3IA4A 1DYRA 3QLWA 1DR4A 4PSTA 1RC4A 3FY9X 4KM2A 4KY4A 4G3MA 1VDRA 3QL0A 3LG4A 2W9GA 3INVA 3FQVA 4H96A 1RA3A 4EIZA 1KMSA 1LY4A 3DFRA 4PTHA 3DRCA 2DHFA 4LAGX 5HF2X 5JG0X 2QK8A 3FQOA 3SRSX 1RG7A 5CC9A 3SRUX 3TQ9A 3JVXA 3JWMA 1RA1A 1TDRA 1J3KA 2BLAA 3E0BA 3R33A 1RH3A 1S3UA 3JTWA 3CSEA 1IA3A 1U72A 4PDJA 4GH8A 3F8ZA 3JW3A 4G8ZX 3FQFA 4M7VA 3D84X 4ECKA 2G6VA 3IRNA 4KLXA 1RX1A 1U71A 3NU0A 2L28A 3F91A 4LAEX 3OCHA 3IX9A 3NZCX 3NZDA 3DL6A 1DRBA 3UM5A 3K47A 3UM8A 3QLXA 2KGKA 4Q67A 3EEMA 4FGHA 1ZDRA 4DFRA 1DR3A 3SRRX 3HJ3A 4DPHA 4FHBA 3S3VA 2HQPA 2B3ZA 4QI9A 3F0BX 2D0KA 3SQYX 4KNEA 1DDSA 2FZHA 3SA1A 2ITHA 1J3JA 3F8YA 1BOZA 4X5IA 3F0UX 3QYLA 3SA2A 1JUVA 4DP3A 1PDBA 2INQA 4XT4A 4HOGA 1M78A 3NZ6X 1AI9A 4QLEA 4I13A 3FY8X 4KJJA 1DRFA 5DFRA 3SRQX 5HQYA 4G95A 1CD2A 1DR5A 3F0VX 5HF0X 1S3YA 3JW5A 3K74A 3NXXA 4M7UA 3JWKA 1IA2A 3S7AA 3NZAX 2W3VA 4HOFA 1M7AA 1DLSA 3QG2A 3TD8A 1JOMA 4PTJA 3KFYA 3QLRA 3FQCA 1LUDA 2OBCA 1OHKA 3GHVA 4QLFA 1PD8A 3QYOA 4ELGA 2C2TA 4KJLA 1DG7A 6DFRA 5HSRA 4Q0EA 1MVSA 1DR2A 3IROA 2W9HA 1AO8A 1DRAA 3FYWX 3SAIA 3KY8A 3NXOA 2DRCA 3DG8A 1DHFA 5FDAA 2ZZAA 1YHOA 4RGCA 2P4GA 4KM0A 4XRBA 3NXVA 3KJSA 3KJRA 3EX8A 8DFRA 2W3WA 2W9TA 1DR6A 1IA1A 4KD7A 3N0HA 4DDRA 1DAJA 1RX5A 4ELFA 3JSUA 7DFRA 3FRDX 5E8QA 4FGGA 1DHJA 4PSYA 3EEKA 4EJ1A 1JOLA 3S9UA 2W9SA 4KFJA 1DIUA 1RA9A 3F0QX 4M2XA 5HUIA 3D80A 5HVBA 3FRAX 1DG8A 2LF1A 5HQZA 3NZBX 2ANQA 2HM9A 3FRFX 3RO9A 2XW7A 4X5FA 1RX2A 3DAUA 3GYFA 4XT7A 1BZFA 4IXFX 1DYJA 4H97A 3M09A 4NX7A 4Q0DA 1RF7A 4P3RA 3TQBA 4OR7A 5EAJA 4M6LA 3JWFA 3Q1HA 5HI6A 4HOEA 2GD9A 4HA9A 1DR7A 2BLBA 5U27A 3IA5A 3SR5X 3SGYA 4IXED 4EIGA 4LEKX 4QJZD 1RX8A 3GHCA 4I1NA 1RB3A 4XT6A 1RE7A 2CIGA 5DXVA 1KMVA 3DL5A 3F0SX 1AOEA 4XECX 2C2SA 4IXGX 2BL9A 3I3RA 2CD2A 1HFPA 4XT8A 3DGAA 3TQAA 5HT5A 4XE6X 3QGTA 1CZ3A 4KYAA 1D1GA 4ELHA 1J3IA 3I8AX 3EELA 2HXVA
chains in the Genus database with same CATH topology
5ECCA 2ANOA 1DYIA 4ELBA 3NXYA 4Q6AA 3FQ0A 5HVEA 5JA3A 3UM6A 4PSSA 1DREA 2W3BA 4KL9A 5U26A 1DG5A 1DISA 3QL3A 4HA7A 3NTZA 2FZJA 3K45A 3M08A 4XT5A 1RX6A 3ZPGA 1RB2A 1RX3A 4H98A 2W3MA 1RX9A 4CD2A 1DYHA 1IA4A 4X5GA 1DRHA 4TU5X 2D5NA 4KJKA 1QZFA 2FZIA 3IRMA 1S3VA 3TQ8A 1MVTA 4OSGA 3CD2A 2O7PA 3NXTA 3FL8A 3FL9A 5ECXA 1U70A 3FQZA 2JYBA 3F0XX 3HBBA 3VCOA 4H95A 4P66A 4X5HA 1PD9A 5HT4A 3SH2A 1DHIA 3NXRA 1LY3A 4ELEA 2OIPA 3KGYA 4LAHX 5HPBA 3CL9A 1RD7A 3CLBA 1HFQA 1DLRA 3ROAA 1OHJA 4QLGA 3NZ9X 3FRBX 4M6KA 4P68A 3ZPCA 3L3RA 3RG9A 4M6JA 3SRWX 3GHWA 1HFRA 1VJ3A 4KEBA 3EEJA 1KLKA 3GI2A 4DPDA 3FS6A 4KBNA 4P3QA 4QHVA 1RX4A 1E26A 4X5JA 3OAFA 4NX6A 1M79A 1DF7A 4EILA 2W3AA 3QLZA 3DATA 3FREX 5HSUA 3FYVX 2AZNA 5CCCA 3NRRA 1RX7A 3QFXA 4KY8A 1DR1A 1RA2A 3QLYA 1RA8A 3K2HA 3EIGA 1SEJA 3QLSA 4QJCA 2H2QA 4KAKA 3JWCA 1DDRA 2BLCA 1S3WA 3IA4A 1DYRA 3QLWA 1DR4A 4PSTA 1RC4A 3FY9X 4KM2A 4KY4A 4G3MA 1VDRA 3QL0A 3LG4A 2W9GA 3INVA 3FQVA 4H96A 1RA3A 4EIZA 1KMSA 1LY4A 3DFRA 4PTHA 3DRCA 2DHFA 4LAGX 5HF2X 5JG0X 2QK8A 3FQOA 3SRSX 1RG7A 5CC9A 3SRUX 3TQ9A 3JVXA 3JWMA 1RA1A 1TDRA 1J3KA 2BLAA 3E0BA 3R33A 1RH3A 1S3UA 3JTWA 3CSEA 1IA3A 1U72A 4PDJA 4GH8A 3F8ZA 3JW3A 4G8ZX 3FQFA 4M7VA 3D84X 4ECKA 2G6VA 3IRNA 4KLXA 1RX1A 1U71A 3NU0A 2L28A 3F91A 4LAEX 3OCHA 3IX9A 3NZCX 3NZDA 3DL6A 1DRBA 3UM5A 3K47A 3UM8A 3QLXA 2KGKA 4Q67A 3EEMA 4FGHA 1ZDRA 4DFRA 1DR3A 3SRRX 3HJ3A 4DPHA 4FHBA 3S3VA 2HQPA 2B3ZA 4QI9A 3F0BX 2D0KA 3SQYX 4KNEA 1DDSA 2FZHA 3SA1A 2ITHA 1J3JA 3F8YA 1BOZA 4X5IA 3F0UX 3QYLA 3SA2A 1JUVA 4DP3A 1PDBA 2INQA 4XT4A 4HOGA 1M78A 3NZ6X 1AI9A 4QLEA 4I13A 3FY8X 4KJJA 1DRFA 5DFRA 3SRQX 5HQYA 4G95A 1CD2A 1DR5A 3F0VX 5HF0X 1S3YA 3JW5A 3K74A 3NXXA 4M7UA 3JWKA 1IA2A 3S7AA 3NZAX 2W3VA 4HOFA 1M7AA 1DLSA 3QG2A 3TD8A 1JOMA 4PTJA 3KFYA 3QLRA 3FQCA 1LUDA 2OBCA 1OHKA 3GHVA 4QLFA 1PD8A 3QYOA 4ELGA 2C2TA 4KJLA 1DG7A 6DFRA 5HSRA 4Q0EA 1MVSA 1DR2A 3IROA 2W9HA 1AO8A 1DRAA 3FYWX 3SAIA 3KY8A 3NXOA 2DRCA 3DG8A 1DHFA 5FDAA 2ZZAA 1YHOA 4RGCA 2P4GA 4KM0A 4XRBA 3NXVA 3KJSA 3KJRA 3EX8A 8DFRA 2W3WA 2W9TA 1DR6A 1IA1A 4KD7A 3N0HA 4DDRA 1DAJA 1RX5A 4ELFA 3JSUA 7DFRA 3FRDX 5E8QA 4FGGA 1DHJA 4PSYA 3EEKA 4EJ1A 1JOLA 3S9UA 2W9SA 4KFJA 1DIUA 1RA9A 3F0QX 4M2XA 5HUIA 3D80A 5HVBA 3FRAX 1DG8A 2LF1A 5HQZA 3NZBX 2ANQA 2HM9A 3FRFX 3RO9A 2XW7A 4X5FA 1RX2A 3DAUA 3GYFA 4XT7A 1BZFA 4IXFX 1DYJA 4H97A 3M09A 4NX7A 4Q0DA 1RF7A 4P3RA 3TQBA 4OR7A 5EAJA 4M6LA 3JWFA 3Q1HA 5HI6A 4HOEA 2GD9A 4HA9A 1DR7A 2BLBA 5U27A 3IA5A 3SR5X 3SGYA 4IXED 4EIGA 4LEKX 4QJZD 1RX8A 3GHCA 4I1NA 1RB3A 4XT6A 1RE7A 2CIGA 5DXVA 1KMVA 3DL5A 3F0SX 1AOEA 4XECX 2C2SA 4IXGX 2BL9A 3I3RA 2CD2A 1HFPA 4XT8A 3DGAA 3TQAA 5HT5A 4XE6X 3QGTA 1CZ3A 4KYAA 1D1GA 4ELHA 1J3IA 3I8AX 3EELA 2HXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ECC A;  2ANO A;  1DYI A;  4ELB A;  3NXY A;  4Q6A A;  3FQ0 A;  5HVE A;  5JA3 A;  3UM6 A;  4PSS A;  1DRE A;  2W3B A;  4KL9 A;  5U26 A;  1DG5 A;  1DIS A;  3QL3 A;  4HA7 A;  3NTZ A;  2FZJ A;  3K45 A;  3M08 A;  4XT5 A;  1RX6 A;  3ZPG A;  1RB2 A;  1RX3 A;  4H98 A;  2W3M A;  1RX9 A;  4CD2 A;  1DYH A;  1IA4 A;  4X5G A;  1DRH A;  4TU5 X;  2D5N A;  4KJK A;  1QZF A;  2FZI A;  3IRM A;  1S3V A;  3TQ8 A;  1MVT A;  4OSG A;  3CD2 A;  2O7P A;  3NXT A;  3FL8 A;  3FL9 A;  5ECX A;  1U70 A;  3FQZ A;  2JYB A;  3F0X X;  3HBB A;  3VCO A;  4H95 A;  4P66 A;  4X5H A;  1PD9 A;  5HT4 A;  3SH2 A;  1DHI A;  3NXR A;  1LY3 A;  4ELE A;  2OIP A;  3KGY A;  4LAH X;  5HPB A;  3CL9 A;  1RD7 A;  3CLB A;  1HFQ A;  1DLR A;  3ROA A;  1OHJ A;  4QLG A;  3NZ9 X;  3FRB X;  4M6K A;  4P68 A;  3ZPC A;  3L3R A;  3RG9 A;  4M6J A;  3SRW X;  3GHW A;  1HFR A;  1VJ3 A;  4KEB A;  3EEJ A;  1KLK A;  3GI2 A;  4DPD A;  3FS6 A;  4KBN A;  4P3Q A;  4QHV A;  1RX4 A;  1E26 A;  4X5J A;  3OAF A;  4NX6 A;  1M79 A;  1DF7 A;  4EIL A;  2W3A A;  3QLZ A;  3DAT A;  3FRE X;  5HSU A;  3FYV X;  2AZN A;  5CCC A;  3NRR A;  1RX7 A;  3QFX A;  4KY8 A;  1DR1 A;  1RA2 A;  3QLY A;  1RA8 A;  3K2H A;  3EIG A;  1SEJ A;  3QLS A;  4QJC A;  2H2Q A;  4KAK A;  3JWC A;  1DDR A;  2BLC A;  1S3W A;  3IA4 A;  1DYR A;  3QLW A;  1DR4 A;  4PST A;  1RC4 A;  3FY9 X;  4KM2 A;  4KY4 A;  4G3M A;  1VDR A;  3QL0 A;  3LG4 A;  2W9G A;  3INV A;  3FQV A;  4H96 A;  1RA3 A;  4EIZ A;  1KMS A;  1LY4 A;  3DFR A;  4PTH A;  3DRC A;  2DHF A;  4LAG X;  5HF2 X;  5JG0 X;  2QK8 A;  3FQO A;  3SRS X;  1RG7 A;  5CC9 A;  3SRU X;  3TQ9 A;  3JVX A;  3JWM A;  1RA1 A;  1TDR A;  1J3K A;  2BLA A;  3E0B A;  3R33 A;  1RH3 A;  1S3U A;  3JTW A;  3CSE A;  1IA3 A;  1U72 A;  4PDJ A;  4GH8 A;  3F8Z A;  3JW3 A;  4G8Z X;  3FQF A;  4M7V A;  3D84 X;  4ECK A;  2G6V A;  3IRN A;  4KLX A;  1RX1 A;  1U71 A;  3NU0 A;  2L28 A;  3F91 A;  4LAE X;  3OCH A;  3IX9 A;  3NZC X;  3NZD A;  3DL6 A;  1DRB A;  3UM5 A;  3K47 A;  3UM8 A;  3QLX A;  2KGK A;  4Q67 A;  3EEM A;  4FGH A;  1ZDR A;  4DFR A;  1DR3 A;  3SRR X;  3HJ3 A;  4DPH A;  4FHB A;  3S3V A;  2HQP A;  2B3Z A;  4QI9 A;  3F0B X;  2D0K A;  3SQY X;  4KNE A;  1DDS A;  2FZH A;  3SA1 A;  2ITH A;  1J3J A;  3F8Y A;  1BOZ A;  4X5I A;  3F0U X;  3QYL A;  3SA2 A;  1JUV A;  4DP3 A;  1PDB A;  2INQ A;  4XT4 A;  4HOG A;  1M78 A;  3NZ6 X;  1AI9 A;  4QLE A;  4I13 A;  3FY8 X;  4KJJ A;  1DRF A;  5DFR A;  3SRQ X;  5HQY A;  4G95 A;  1CD2 A;  1DR5 A;  3F0V X;  5HF0 X;  1S3Y A;  3JW5 A;  3K74 A;  3NXX A;  4M7U A;  3JWK A;  1IA2 A;  3S7A A;  3NZA X;  2W3V A;  4HOF A;  1M7A A;  1DLS A;  3QG2 A;  3TD8 A;  1JOM A;  4PTJ A;  3KFY A;  3QLR A;  3FQC A;  1LUD A;  2OBC A;  1OHK A;  3GHV A;  4QLF A;  1PD8 A;  3QYO A;  4ELG A;  2C2T A;  4KJL A;  1DG7 A;  6DFR A;  5HSR A;  4Q0E A;  1MVS A;  1DR2 A;  3IRO A;  2W9H A;  1AO8 A;  1DRA A;  3FYW X;  3SAI A;  3KY8 A;  3NXO A;  2DRC A;  3DG8 A;  1DHF A;  5FDA A;  2ZZA A;  1YHO A;  4RGC A;  2P4G A;  4KM0 A;  4XRB A;  3NXV A;  3KJS A;  3KJR A;  3EX8 A;  8DFR A;  2W3W A;  2W9T A;  1DR6 A;  1IA1 A;  4KD7 A;  3N0H A;  4DDR A;  1DAJ A;  1RX5 A;  4ELF A;  3JSU A;  7DFR A;  3FRD X;  5E8Q A;  4FGG A;  1DHJ A;  4PSY A;  3EEK A;  4EJ1 A;  1JOL A;  3S9U A;  2W9S A;  4KFJ A;  1DIU A;  1RA9 A;  3F0Q X;  4M2X A;  5HUI A;  3D80 A;  5HVB A;  3FRA X;  1DG8 A;  2LF1 A;  5HQZ A;  3NZB X;  2ANQ A;  2HM9 A;  3FRF X;  3RO9 A;  2XW7 A;  4X5F A;  1RX2 A;  3DAU A;  3GYF A;  4XT7 A;  1BZF A;  4IXF X;  1DYJ A;  4H97 A;  3M09 A;  4NX7 A;  4Q0D A;  1RF7 A;  4P3R A;  3TQB A;  4OR7 A;  5EAJ A;  4M6L A;  3JWF A;  3Q1H A;  5HI6 A;  4HOE A;  2GD9 A;  4HA9 A;  1DR7 A;  2BLB A;  5U27 A;  3IA5 A;  3SR5 X;  3SGY A;  4IXE D;  4EIG A;  4LEK X;  4QJZ D;  1RX8 A;  3GHC A;  4I1N A;  1RB3 A;  4XT6 A;  1RE7 A;  2CIG A;  5DXV A;  1KMV A;  3DL5 A;  3F0S X;  1AOE A;  4XEC X;  2C2S A;  4IXG X;  2BL9 A;  3I3R A;  2CD2 A;  1HFP A;  4XT8 A;  3DGA A;  3TQA A;  5HT5 A;  4XE6 X;  3QGT A;  1CZ3 A;  4KYA A;  1D1G A;  4ELH A;  1J3I A;  3I8A X;  3EEL A;  2HXV A; 
#chains in the Genus database with same CATH topology
 5ECC A;  2ANO A;  1DYI A;  4ELB A;  3NXY A;  4Q6A A;  3FQ0 A;  5HVE A;  5JA3 A;  3UM6 A;  4PSS A;  1DRE A;  2W3B A;  4KL9 A;  5U26 A;  1DG5 A;  1DIS A;  3QL3 A;  4HA7 A;  3NTZ A;  2FZJ A;  3K45 A;  3M08 A;  4XT5 A;  1RX6 A;  3ZPG A;  1RB2 A;  1RX3 A;  4H98 A;  2W3M A;  1RX9 A;  4CD2 A;  1DYH A;  1IA4 A;  4X5G A;  1DRH A;  4TU5 X;  2D5N A;  4KJK A;  1QZF A;  2FZI A;  3IRM A;  1S3V A;  3TQ8 A;  1MVT A;  4OSG A;  3CD2 A;  2O7P A;  3NXT A;  3FL8 A;  3FL9 A;  5ECX A;  1U70 A;  3FQZ A;  2JYB A;  3F0X X;  3HBB A;  3VCO A;  4H95 A;  4P66 A;  4X5H A;  1PD9 A;  5HT4 A;  3SH2 A;  1DHI A;  3NXR A;  1LY3 A;  4ELE A;  2OIP A;  3KGY A;  4LAH X;  5HPB A;  3CL9 A;  1RD7 A;  3CLB A;  1HFQ A;  1DLR A;  3ROA A;  1OHJ A;  4QLG A;  3NZ9 X;  3FRB X;  4M6K A;  4P68 A;  3ZPC A;  3L3R A;  3RG9 A;  4M6J A;  3SRW X;  3GHW A;  1HFR A;  1VJ3 A;  4KEB A;  3EEJ A;  1KLK A;  3GI2 A;  4DPD A;  3FS6 A;  4KBN A;  4P3Q A;  4QHV A;  1RX4 A;  1E26 A;  4X5J A;  3OAF A;  4NX6 A;  1M79 A;  1DF7 A;  4EIL A;  2W3A A;  3QLZ A;  3DAT A;  3FRE X;  5HSU A;  3FYV X;  2AZN A;  5CCC A;  3NRR A;  1RX7 A;  3QFX A;  4KY8 A;  1DR1 A;  1RA2 A;  3QLY A;  1RA8 A;  3K2H A;  3EIG A;  1SEJ A;  3QLS A;  4QJC A;  2H2Q A;  4KAK A;  3JWC A;  1DDR A;  2BLC A;  1S3W A;  3IA4 A;  1DYR A;  3QLW A;  1DR4 A;  4PST A;  1RC4 A;  3FY9 X;  4KM2 A;  4KY4 A;  4G3M A;  1VDR A;  3QL0 A;  3LG4 A;  2W9G A;  3INV A;  3FQV A;  4H96 A;  1RA3 A;  4EIZ A;  1KMS A;  1LY4 A;  3DFR A;  4PTH A;  3DRC A;  2DHF A;  4LAG X;  5HF2 X;  5JG0 X;  2QK8 A;  3FQO A;  3SRS X;  1RG7 A;  5CC9 A;  3SRU X;  3TQ9 A;  3JVX A;  3JWM A;  1RA1 A;  1TDR A;  1J3K A;  2BLA A;  3E0B A;  3R33 A;  1RH3 A;  1S3U A;  3JTW A;  3CSE A;  1IA3 A;  1U72 A;  4PDJ A;  4GH8 A;  3F8Z A;  3JW3 A;  4G8Z X;  3FQF A;  4M7V A;  3D84 X;  4ECK A;  2G6V A;  3IRN A;  4KLX A;  1RX1 A;  1U71 A;  3NU0 A;  2L28 A;  3F91 A;  4LAE X;  3OCH A;  3IX9 A;  3NZC X;  3NZD A;  3DL6 A;  1DRB A;  3UM5 A;  3K47 A;  3UM8 A;  3QLX A;  2KGK A;  4Q67 A;  3EEM A;  4FGH A;  1ZDR A;  4DFR A;  1DR3 A;  3SRR X;  3HJ3 A;  4DPH A;  4FHB A;  3S3V A;  2HQP A;  2B3Z A;  4QI9 A;  3F0B X;  2D0K A;  3SQY X;  4KNE A;  1DDS A;  2FZH A;  3SA1 A;  2ITH A;  1J3J A;  3F8Y A;  1BOZ A;  4X5I A;  3F0U X;  3QYL A;  3SA2 A;  1JUV A;  4DP3 A;  1PDB A;  2INQ A;  4XT4 A;  4HOG A;  1M78 A;  3NZ6 X;  1AI9 A;  4QLE A;  4I13 A;  3FY8 X;  4KJJ A;  1DRF A;  5DFR A;  3SRQ X;  5HQY A;  4G95 A;  1CD2 A;  1DR5 A;  3F0V X;  5HF0 X;  1S3Y A;  3JW5 A;  3K74 A;  3NXX A;  4M7U A;  3JWK A;  1IA2 A;  3S7A A;  3NZA X;  2W3V A;  4HOF A;  1M7A A;  1DLS A;  3QG2 A;  3TD8 A;  1JOM A;  4PTJ A;  3KFY A;  3QLR A;  3FQC A;  1LUD A;  2OBC A;  1OHK A;  3GHV A;  4QLF A;  1PD8 A;  3QYO A;  4ELG A;  2C2T A;  4KJL A;  1DG7 A;  6DFR A;  5HSR A;  4Q0E A;  1MVS A;  1DR2 A;  3IRO A;  2W9H A;  1AO8 A;  1DRA A;  3FYW X;  3SAI A;  3KY8 A;  3NXO A;  2DRC A;  3DG8 A;  1DHF A;  5FDA A;  2ZZA A;  1YHO A;  4RGC A;  2P4G A;  4KM0 A;  4XRB A;  3NXV A;  3KJS A;  3KJR A;  3EX8 A;  8DFR A;  2W3W A;  2W9T A;  1DR6 A;  1IA1 A;  4KD7 A;  3N0H A;  4DDR A;  1DAJ A;  1RX5 A;  4ELF A;  3JSU A;  7DFR A;  3FRD X;  5E8Q A;  4FGG A;  1DHJ A;  4PSY A;  3EEK A;  4EJ1 A;  1JOL A;  3S9U A;  2W9S A;  4KFJ A;  1DIU A;  1RA9 A;  3F0Q X;  4M2X A;  5HUI A;  3D80 A;  5HVB A;  3FRA X;  1DG8 A;  2LF1 A;  5HQZ A;  3NZB X;  2ANQ A;  2HM9 A;  3FRF X;  3RO9 A;  2XW7 A;  4X5F A;  1RX2 A;  3DAU A;  3GYF A;  4XT7 A;  1BZF A;  4IXF X;  1DYJ A;  4H97 A;  3M09 A;  4NX7 A;  4Q0D A;  1RF7 A;  4P3R A;  3TQB A;  4OR7 A;  5EAJ A;  4M6L A;  3JWF A;  3Q1H A;  5HI6 A;  4HOE A;  2GD9 A;  4HA9 A;  1DR7 A;  2BLB A;  5U27 A;  3IA5 A;  3SR5 X;  3SGY A;  4IXE D;  4EIG A;  4LEK X;  4QJZ D;  1RX8 A;  3GHC A;  4I1N A;  1RB3 A;  4XT6 A;  1RE7 A;  2CIG A;  5DXV A;  1KMV A;  3DL5 A;  3F0S X;  1AOE A;  4XEC X;  2C2S A;  4IXG X;  2BL9 A;  3I3R A;  2CD2 A;  1HFP A;  4XT8 A;  3DGA A;  3TQA A;  5HT5 A;  4XE6 X;  3QGT A;  1CZ3 A;  4KYA A;  1D1G A;  4ELH A;  1J3I A;  3I8A X;  3EEL A;  2HXV A; 
#chains in the Genus database with same CATH homology
 5ECC A;  2ANO A;  1DYI A;  4ELB A;  3NXY A;  4Q6A A;  3FQ0 A;  5HVE A;  5JA3 A;  3UM6 A;  4PSS A;  1DRE A;  2W3B A;  4KL9 A;  5U26 A;  1DG5 A;  1DIS A;  3QL3 A;  4HA7 A;  3NTZ A;  2FZJ A;  3K45 A;  3M08 A;  4XT5 A;  1RX6 A;  3ZPG A;  1RB2 A;  1RX3 A;  4H98 A;  2W3M A;  1RX9 A;  4CD2 A;  1DYH A;  1IA4 A;  4X5G A;  1DRH A;  4TU5 X;  2D5N A;  4KJK A;  1QZF A;  2FZI A;  3IRM A;  1S3V A;  3TQ8 A;  1MVT A;  4OSG A;  3CD2 A;  2O7P A;  3NXT A;  3FL8 A;  3FL9 A;  5ECX A;  1U70 A;  3FQZ A;  2JYB A;  3F0X X;  3HBB A;  3VCO A;  4H95 A;  4P66 A;  4X5H A;  1PD9 A;  5HT4 A;  3SH2 A;  1DHI A;  3NXR A;  1LY3 A;  4ELE A;  2OIP A;  3KGY A;  4LAH X;  5HPB A;  3CL9 A;  1RD7 A;  3CLB A;  1HFQ A;  1DLR A;  3ROA A;  1OHJ A;  4QLG A;  3NZ9 X;  3FRB X;  4M6K A;  4P68 A;  3ZPC A;  3L3R A;  3RG9 A;  4M6J A;  3SRW X;  3GHW A;  1HFR A;  1VJ3 A;  4KEB A;  3EEJ A;  1KLK A;  3GI2 A;  4DPD A;  3FS6 A;  4KBN A;  4P3Q A;  4QHV A;  1RX4 A;  1E26 A;  4X5J A;  3OAF A;  4NX6 A;  1M79 A;  1DF7 A;  4EIL A;  2W3A A;  3QLZ A;  3DAT A;  3FRE X;  5HSU A;  3FYV X;  2AZN A;  5CCC A;  3NRR A;  1RX7 A;  3QFX A;  4KY8 A;  1DR1 A;  1RA2 A;  3QLY A;  1RA8 A;  3K2H A;  3EIG A;  1SEJ A;  3QLS A;  4QJC A;  2H2Q A;  4KAK A;  3JWC A;  1DDR A;  2BLC A;  1S3W A;  3IA4 A;  1DYR A;  3QLW A;  1DR4 A;  4PST A;  1RC4 A;  3FY9 X;  4KM2 A;  4KY4 A;  4G3M A;  1VDR A;  3QL0 A;  3LG4 A;  2W9G A;  3INV A;  3FQV A;  4H96 A;  1RA3 A;  4EIZ A;  1KMS A;  1LY4 A;  3DFR A;  4PTH A;  3DRC A;  2DHF A;  4LAG X;  5HF2 X;  5JG0 X;  2QK8 A;  3FQO A;  3SRS X;  1RG7 A;  5CC9 A;  3SRU X;  3TQ9 A;  3JVX A;  3JWM A;  1RA1 A;  1TDR A;  1J3K A;  2BLA A;  3E0B A;  3R33 A;  1RH3 A;  1S3U A;  3JTW A;  3CSE A;  1IA3 A;  1U72 A;  4PDJ A;  4GH8 A;  3F8Z A;  3JW3 A;  4G8Z X;  3FQF A;  4M7V A;  3D84 X;  4ECK A;  2G6V A;  3IRN A;  4KLX A;  1RX1 A;  1U71 A;  3NU0 A;  2L28 A;  3F91 A;  4LAE X;  3OCH A;  3IX9 A;  3NZC X;  3NZD A;  3DL6 A;  1DRB A;  3UM5 A;  3K47 A;  3UM8 A;  3QLX A;  2KGK A;  4Q67 A;  3EEM A;  4FGH A;  1ZDR A;  4DFR A;  1DR3 A;  3SRR X;  3HJ3 A;  4DPH A;  4FHB A;  3S3V A;  2HQP A;  2B3Z A;  4QI9 A;  3F0B X;  2D0K A;  3SQY X;  4KNE A;  1DDS A;  2FZH A;  3SA1 A;  2ITH A;  1J3J A;  3F8Y A;  1BOZ A;  4X5I A;  3F0U X;  3QYL A;  3SA2 A;  1JUV A;  4DP3 A;  1PDB A;  2INQ A;  4XT4 A;  4HOG A;  1M78 A;  3NZ6 X;  1AI9 A;  4QLE A;  4I13 A;  3FY8 X;  4KJJ A;  1DRF A;  5DFR A;  3SRQ X;  5HQY A;  4G95 A;  1CD2 A;  1DR5 A;  3F0V X;  5HF0 X;  1S3Y A;  3JW5 A;  3K74 A;  3NXX A;  4M7U A;  3JWK A;  1IA2 A;  3S7A A;  3NZA X;  2W3V A;  4HOF A;  1M7A A;  1DLS A;  3QG2 A;  3TD8 A;  1JOM A;  4PTJ A;  3KFY A;  3QLR A;  3FQC A;  1LUD A;  2OBC A;  1OHK A;  3GHV A;  4QLF A;  1PD8 A;  3QYO A;  4ELG A;  2C2T A;  4KJL A;  1DG7 A;  6DFR A;  5HSR A;  4Q0E A;  1MVS A;  1DR2 A;  3IRO A;  2W9H A;  1AO8 A;  1DRA A;  3FYW X;  3SAI A;  3KY8 A;  3NXO A;  2DRC A;  3DG8 A;  1DHF A;  5FDA A;  2ZZA A;  1YHO A;  4RGC A;  2P4G A;  4KM0 A;  4XRB A;  3NXV A;  3KJS A;  3KJR A;  3EX8 A;  8DFR A;  2W3W A;  2W9T A;  1DR6 A;  1IA1 A;  4KD7 A;  3N0H A;  4DDR A;  1DAJ A;  1RX5 A;  4ELF A;  3JSU A;  7DFR A;  3FRD X;  5E8Q A;  4FGG A;  1DHJ A;  4PSY A;  3EEK A;  4EJ1 A;  1JOL A;  3S9U A;  2W9S A;  4KFJ A;  1DIU A;  1RA9 A;  3F0Q X;  4M2X A;  5HUI A;  3D80 A;  5HVB A;  3FRA X;  1DG8 A;  2LF1 A;  5HQZ A;  3NZB X;  2ANQ A;  2HM9 A;  3FRF X;  3RO9 A;  2XW7 A;  4X5F A;  1RX2 A;  3DAU A;  3GYF A;  4XT7 A;  1BZF A;  4IXF X;  1DYJ A;  4H97 A;  3M09 A;  4NX7 A;  4Q0D A;  1RF7 A;  4P3R A;  3TQB A;  4OR7 A;  5EAJ A;  4M6L A;  3JWF A;  3Q1H A;  5HI6 A;  4HOE A;  2GD9 A;  4HA9 A;  1DR7 A;  2BLB A;  5U27 A;  3IA5 A;  3SR5 X;  3SGY A;  4IXE D;  4EIG A;  4LEK X;  4QJZ D;  1RX8 A;  3GHC A;  4I1N A;  1RB3 A;  4XT6 A;  1RE7 A;  2CIG A;  5DXV A;  1KMV A;  3DL5 A;  3F0S X;  1AOE A;  4XEC X;  2C2S A;  4IXG X;  2BL9 A;  3I3R A;  2CD2 A;  1HFP A;  4XT8 A;  3DGA A;  3TQA A;  5HT5 A;  4XE6 X;  3QGT A;  1CZ3 A;  4KYA A;  1D1G A;  4ELH A;  1J3I A;  3I8A X;  3EEL A;  2HXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...