3VCOA

Schistosoma mansoni dihydrofolate reductase
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
183
structure length
183
Chain Sequence
SHMRLNVVVAVSENWGIGKGGGLPWKIKKDMEFFKTVTTKAHPGLKNAVVMGRVTWESIPESFKPLKDRINIVVSSTLSHAPSFVQVVPSLNAAIDLLYNEEFSSIVDEVFIIGGYRLYKEALKQSIYPVRIYCTHILSEVDCDTYFPKVDWDKLKKVDLPDIPADTFTENGFTFKFCVYDVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and kinetics assays of recombinant Schistosoma mansoni dihydrofolate reductase.
pubmed doi rcsb
molecule keywords Dihydrofolate reductase
molecule tags Oxidoreductase
source organism Schistosoma mansoni
total genus 46
structure length 183
sequence length 183
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2012-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 3vcoA00
4KEBA 3FL9A 3TQBA 2FZIA 4XE6X 4QLGA 1RX7A 3SAIA 2KGKA 3FRBX 3M09A 1DYRA 3RG9A 4HOFA 3K74A 2W9TA 3S7AA 4H97A 5HVEA 1DRAA 3F0UX 1DHFA 3LG4A 3CLBA 5JG0X 2D0KA 3QYOA 3TQ9A 3CSEA 3FY9X 4Q0EA 8DFRA 1DR7A 3UM8A 1PDBA 2B3ZA 5HT5A 3CL9A 2W3BA 1RX5A 4HA7A 4ELBA 3F91A 3FQ0A 1RB3A 1DRFA 3F8ZA 4XT6A 3JW3A 3FREX 3QLRA 3DL6A 2L28A 3JWFA 4I13A 3QGTA 4X5JA 4KY8A 4DP3A 3DAUA 3L3RA 4EIZA 5CC9A 3HJ3A 4P66A 3DL5A 1AI9A 1DR4A 3EEKA 3F0XX 1HFRA 3SQYX 3FY8X 3GYFA 3IRNA 5HF0X 2ANOA 1J3KA 3GHWA 4G8ZX 1RX1A 3NXYA 4G95A 4M6JA 4XRBA 4M7UA 1AOEA 4DPHA 3F0SX 3FQZA 4ELGA 5HSRA 3SA2A 1RF7A 4KNEA 1S3WA 1S3UA 2W3MA 3NZAX 1BOZA 1S3VA 4ECKA 4ELFA 3JSUA 3FRDX 1ZDRA 3SRSX 1MVTA 4IXED 2P4GA 1DR5A 4KFJA 3JWMA 4DPDA 3F0BX 2HXVA 1DF7A 2D5NA 3KFYA 1DG5A 3D84X 3UM6A 1J3JA 3CD2A 1IA4A 2BLCA 3JTWA 3IX9A 1HFPA 2FZHA 1JOMA 2HM9A 1SEJA 3ZPGA 4DFRA 1M7AA 1DDRA 5HVBA 4EJ1A 4KBNA 1DDSA 3ROAA 2DRCA 4PTHA 4OR7A 3TD8A 1JUVA 3QFXA 1RX6A 4M7VA 1JOLA 1RA9A 1S3YA 1U71A 3EELA 3R33A 2C2SA 3F0VX 4KLXA 4KJKA 4LAGX 4QHVA 3SA1A 3EEJA 2H2QA 3Q1HA 4QJZD 1DRHA 1RG7A 3F0QX 2JYBA 1QZFA 2W3AA 4OSGA 4HOGA 2W9GA 3TQ8A 5DFRA 1DRBA 1DG7A 3DRCA 3IROA 3JWCA 2BLAA 3SR5X 4HOEA 1KMSA 3JW5A 5HT4A 4GH8A 3HBBA 3FYWX 5DXVA 6DFRA 1LY4A 3ZPCA 4Q6AA 1OHKA 3KY8A 3NXRA 3K45A 4NX7A 2AZNA 3SRRX 2W9SA 1DYJA 7DFRA 5HQZA 1VJ3A 3GI2A 3QYLA 3NZBX 4QJCA 3QG2A 1IA3A 4PSYA 5U26A 1DG8A 3SH2A 1DR2A 1RD7A 4QLEA 4EILA 1IA2A 5CCCA 1DHJA 1RA3A 4X5GA 3FQVA 3QLYA 4LAEX 4X5HA 1DYIA 2G6VA 3N0HA 4X5FA 1IA1A 2FZJA 3NXVA 3UM5A 4KL9A 3DG8A 1J3IA 3E0BA 3TQAA 3D80A 3KJRA 3FRFX 4G3MA 4Q67A 4FHBA 2CIGA 3NU0A 4ELEA 4KD7A 4ELHA 3F8YA 1TDRA 5JA3A 1VDRA 5ECCA 1E26A 1DHIA 5EAJA 2INQA 4P3QA 3NRRA 4M2XA 5HPBA 3FRAX 1OHJA 1PD8A 2O7PA 4XT8A 3S3VA 4XECX 3EEMA 1RA2A 3QL3A 2W9HA 1KLKA 4PSSA 4XT4A 3NZ6X 1DR1A 4FGGA 2CD2A 4X5IA 1DREA 1BZFA 3DFRA 4KJJA 1DLRA 1D1GA 3GHCA 4XT7A 1RX2A 5HQYA 3NZ9X 4EIGA 4M6KA 1LUDA 1RX9A 4CD2A 3QLXA 1RH3A 1RC4A 3EIGA 3S9UA 5FDAA 2C2TA 3NZDA 4KM0A 4KM2A 3IA5A 1DR3A 3DGAA 1RE7A 1RA8A 1DIUA 3DATA 2DHFA 4QLFA 2ITHA 3QLWA 4KY4A 2OBCA 5HUIA 1DAJA 2QK8A 3FQFA 2W3WA 4TU5X 2LF1A 3K2HA 3K47A 3QLSA 1CD2A 2OIPA 1U70A 1MVSA 3QLZA 4P3RA 3INVA 5HF2X 1AO8A 4H95A 3KJSA 1U72A 4KYAA 3JVXA 4I1NA 4RGCA 1RA1A 4LAHX 3SRWX 2BLBA 1YHOA 4P68A 4Q0DA 3FQOA 2GD9A 4FGHA 3SRQX 1HFQA 5ECXA 4PSTA 3FL8A 3NTZA 4KJLA 4DDRA 3NXOA 4PTJA 4H98A 2XW7A 1RX4A 5E8QA 1M78A 4XT5A 3NXTA 4PDJA 3FYVX 3I8AX 3VCOA 3I3RA 3IRMA 5HSUA 1PD9A 3M08A 3NZCX 4NX6A 4KAKA 1DISA 3EX8A 3QL0A 3SRUX 1KMVA 4M6LA 3NXXA 1M79A 3RO9A 2HQPA 2W3VA 1LY3A 1RB2A 3OCHA 1CZ3A 4IXFX 1DLSA 1DR6A 1RX3A 5HI6A 1RX8A 4LEKX 1DYHA 4HA9A 3FQCA 2BL9A 4QI9A 3FS6A 3IA4A 3GHVA 3JWKA 3OAFA 2ZZAA 4H96A 3KGYA 4IXGX 5U27A 2ANQA 3SGYA
chains in the Genus database with same CATH superfamily
4KEBA 3FL9A 3TQBA 2FZIA 4XE6X 4QLGA 1RX7A 3SAIA 2KGKA 3FRBX 3M09A 1DYRA 3RG9A 4HOFA 3K74A 2W9TA 3S7AA 4H97A 5HVEA 1DRAA 3F0UX 1DHFA 3LG4A 3CLBA 5JG0X 2D0KA 3QYOA 3TQ9A 3CSEA 3FY9X 4Q0EA 8DFRA 1DR7A 3UM8A 1PDBA 2B3ZA 5HT5A 3CL9A 2W3BA 1RX5A 4HA7A 4ELBA 3F91A 3FQ0A 1RB3A 1DRFA 3F8ZA 4XT6A 3JW3A 3FREX 3QLRA 3DL6A 2L28A 3JWFA 4I13A 3QGTA 4X5JA 4KY8A 4DP3A 3DAUA 3L3RA 4EIZA 5CC9A 3HJ3A 4P66A 3DL5A 1AI9A 1DR4A 3EEKA 3F0XX 1HFRA 3SQYX 3FY8X 3GYFA 3IRNA 5HF0X 2ANOA 1J3KA 3GHWA 4G8ZX 1RX1A 3NXYA 4G95A 4M6JA 4XRBA 4M7UA 1AOEA 4DPHA 3F0SX 3FQZA 4ELGA 5HSRA 3SA2A 1RF7A 4KNEA 1S3WA 1S3UA 2W3MA 3NZAX 1BOZA 1S3VA 4ECKA 4ELFA 3JSUA 3FRDX 1ZDRA 3SRSX 1MVTA 4IXED 2P4GA 1DR5A 4KFJA 3JWMA 4DPDA 3F0BX 2HXVA 1DF7A 2D5NA 3KFYA 1DG5A 3D84X 3UM6A 1J3JA 3CD2A 1IA4A 2BLCA 3JTWA 3IX9A 1HFPA 2FZHA 1JOMA 2HM9A 1SEJA 3ZPGA 4DFRA 1M7AA 1DDRA 5HVBA 4EJ1A 4KBNA 1DDSA 3ROAA 2DRCA 4PTHA 4OR7A 3TD8A 1JUVA 3QFXA 1RX6A 4M7VA 1JOLA 1RA9A 1S3YA 1U71A 3EELA 3R33A 2C2SA 3F0VX 4KLXA 4KJKA 4LAGX 4QHVA 3SA1A 3EEJA 2H2QA 3Q1HA 4QJZD 1DRHA 1RG7A 3F0QX 2JYBA 1QZFA 2W3AA 4OSGA 4HOGA 2W9GA 3TQ8A 5DFRA 1DRBA 1DG7A 3DRCA 3IROA 3JWCA 2BLAA 3SR5X 4HOEA 1KMSA 3JW5A 5HT4A 4GH8A 3HBBA 3FYWX 5DXVA 6DFRA 1LY4A 3ZPCA 4Q6AA 1OHKA 3KY8A 3NXRA 3K45A 4NX7A 2AZNA 3SRRX 2W9SA 1DYJA 7DFRA 5HQZA 1VJ3A 3GI2A 3QYLA 3NZBX 4QJCA 3QG2A 1IA3A 4PSYA 5U26A 1DG8A 3SH2A 1DR2A 1RD7A 4QLEA 4EILA 1IA2A 5CCCA 1DHJA 1RA3A 4X5GA 3FQVA 3QLYA 4LAEX 4X5HA 1DYIA 2G6VA 3N0HA 4X5FA 1IA1A 2FZJA 3NXVA 3UM5A 4KL9A 3DG8A 1J3IA 3E0BA 3TQAA 3D80A 3KJRA 3FRFX 4G3MA 4Q67A 4FHBA 2CIGA 3NU0A 4ELEA 4KD7A 4ELHA 3F8YA 1TDRA 5JA3A 1VDRA 5ECCA 1E26A 1DHIA 5EAJA 2INQA 4P3QA 3NRRA 4M2XA 5HPBA 3FRAX 1OHJA 1PD8A 2O7PA 4XT8A 3S3VA 4XECX 3EEMA 1RA2A 3QL3A 2W9HA 1KLKA 4PSSA 4XT4A 3NZ6X 1DR1A 4FGGA 2CD2A 4X5IA 1DREA 1BZFA 3DFRA 4KJJA 1DLRA 1D1GA 3GHCA 4XT7A 1RX2A 5HQYA 3NZ9X 4EIGA 4M6KA 1LUDA 1RX9A 4CD2A 3QLXA 1RH3A 1RC4A 3EIGA 3S9UA 5FDAA 2C2TA 3NZDA 4KM0A 4KM2A 3IA5A 1DR3A 3DGAA 1RE7A 1RA8A 1DIUA 3DATA 2DHFA 4QLFA 2ITHA 3QLWA 4KY4A 2OBCA 5HUIA 1DAJA 2QK8A 3FQFA 2W3WA 4TU5X 2LF1A 3K2HA 3K47A 3QLSA 1CD2A 2OIPA 1U70A 1MVSA 3QLZA 4P3RA 3INVA 5HF2X 1AO8A 4H95A 3KJSA 1U72A 4KYAA 3JVXA 4I1NA 4RGCA 1RA1A 4LAHX 3SRWX 2BLBA 1YHOA 4P68A 4Q0DA 3FQOA 2GD9A 4FGHA 3SRQX 1HFQA 5ECXA 4PSTA 3FL8A 3NTZA 4KJLA 4DDRA 3NXOA 4PTJA 4H98A 2XW7A 1RX4A 5E8QA 1M78A 4XT5A 3NXTA 4PDJA 3FYVX 3I8AX 3VCOA 3I3RA 3IRMA 5HSUA 1PD9A 3M08A 3NZCX 4NX6A 4KAKA 1DISA 3EX8A 3QL0A 3SRUX 1KMVA 4M6LA 3NXXA 1M79A 3RO9A 2HQPA 2W3VA 1LY3A 1RB2A 3OCHA 1CZ3A 4IXFX 1DLSA 1DR6A 1RX3A 5HI6A 1RX8A 4LEKX 1DYHA 4HA9A 3FQCA 2BL9A 4QI9A 3FS6A 3IA4A 3GHVA 3JWKA 3OAFA 2ZZAA 4H96A 3KGYA 4IXGX 5U27A 2ANQA 3SGYA
chains in the Genus database with same CATH topology
4KEBA 3FL9A 3TQBA 2FZIA 4XE6X 4QLGA 1RX7A 3SAIA 2KGKA 3FRBX 3M09A 1DYRA 3RG9A 4HOFA 3K74A 2W9TA 3S7AA 4H97A 5HVEA 1DRAA 3F0UX 1DHFA 3LG4A 3CLBA 5JG0X 2D0KA 3QYOA 3TQ9A 3CSEA 3FY9X 4Q0EA 8DFRA 1DR7A 3UM8A 1PDBA 2B3ZA 5HT5A 3CL9A 2W3BA 1RX5A 4HA7A 4ELBA 3F91A 3FQ0A 1RB3A 1DRFA 3F8ZA 4XT6A 3JW3A 3FREX 3QLRA 3DL6A 2L28A 3JWFA 4I13A 3QGTA 4X5JA 4KY8A 4DP3A 3DAUA 3L3RA 4EIZA 5CC9A 3HJ3A 4P66A 3DL5A 1AI9A 1DR4A 3EEKA 3F0XX 1HFRA 3SQYX 3FY8X 3GYFA 3IRNA 5HF0X 2ANOA 1J3KA 3GHWA 4G8ZX 1RX1A 3NXYA 4G95A 4M6JA 4XRBA 4M7UA 1AOEA 4DPHA 3F0SX 3FQZA 4ELGA 5HSRA 3SA2A 1RF7A 4KNEA 1S3WA 1S3UA 2W3MA 3NZAX 1BOZA 1S3VA 4ECKA 4ELFA 3JSUA 3FRDX 1ZDRA 3SRSX 1MVTA 4IXED 2P4GA 1DR5A 4KFJA 3JWMA 4DPDA 3F0BX 2HXVA 1DF7A 2D5NA 3KFYA 1DG5A 3D84X 3UM6A 1J3JA 3CD2A 1IA4A 2BLCA 3JTWA 3IX9A 1HFPA 2FZHA 1JOMA 2HM9A 1SEJA 3ZPGA 4DFRA 1M7AA 1DDRA 5HVBA 4EJ1A 4KBNA 1DDSA 3ROAA 2DRCA 4PTHA 4OR7A 3TD8A 1JUVA 3QFXA 1RX6A 4M7VA 1JOLA 1RA9A 1S3YA 1U71A 3EELA 3R33A 2C2SA 3F0VX 4KLXA 4KJKA 4LAGX 4QHVA 3SA1A 3EEJA 2H2QA 3Q1HA 4QJZD 1DRHA 1RG7A 3F0QX 2JYBA 1QZFA 2W3AA 4OSGA 4HOGA 2W9GA 3TQ8A 5DFRA 1DRBA 1DG7A 3DRCA 3IROA 3JWCA 2BLAA 3SR5X 4HOEA 1KMSA 3JW5A 5HT4A 4GH8A 3HBBA 3FYWX 5DXVA 6DFRA 1LY4A 3ZPCA 4Q6AA 1OHKA 3KY8A 3NXRA 3K45A 4NX7A 2AZNA 3SRRX 2W9SA 1DYJA 7DFRA 5HQZA 1VJ3A 3GI2A 3QYLA 3NZBX 4QJCA 3QG2A 1IA3A 4PSYA 5U26A 1DG8A 3SH2A 1DR2A 1RD7A 4QLEA 4EILA 1IA2A 5CCCA 1DHJA 1RA3A 4X5GA 3FQVA 3QLYA 4LAEX 4X5HA 1DYIA 2G6VA 3N0HA 4X5FA 1IA1A 2FZJA 3NXVA 3UM5A 4KL9A 3DG8A 1J3IA 3E0BA 3TQAA 3D80A 3KJRA 3FRFX 4G3MA 4Q67A 4FHBA 2CIGA 3NU0A 4ELEA 4KD7A 4ELHA 3F8YA 1TDRA 5JA3A 1VDRA 5ECCA 1E26A 1DHIA 5EAJA 2INQA 4P3QA 3NRRA 4M2XA 5HPBA 3FRAX 1OHJA 1PD8A 2O7PA 4XT8A 3S3VA 4XECX 3EEMA 1RA2A 3QL3A 2W9HA 1KLKA 4PSSA 4XT4A 3NZ6X 1DR1A 4FGGA 2CD2A 4X5IA 1DREA 1BZFA 3DFRA 4KJJA 1DLRA 1D1GA 3GHCA 4XT7A 1RX2A 5HQYA 3NZ9X 4EIGA 4M6KA 1LUDA 1RX9A 4CD2A 3QLXA 1RH3A 1RC4A 3EIGA 3S9UA 5FDAA 2C2TA 3NZDA 4KM0A 4KM2A 3IA5A 1DR3A 3DGAA 1RE7A 1RA8A 1DIUA 3DATA 2DHFA 4QLFA 2ITHA 3QLWA 4KY4A 2OBCA 5HUIA 1DAJA 2QK8A 3FQFA 2W3WA 4TU5X 2LF1A 3K2HA 3K47A 3QLSA 1CD2A 2OIPA 1U70A 1MVSA 3QLZA 4P3RA 3INVA 5HF2X 1AO8A 4H95A 3KJSA 1U72A 4KYAA 3JVXA 4I1NA 4RGCA 1RA1A 4LAHX 3SRWX 2BLBA 1YHOA 4P68A 4Q0DA 3FQOA 2GD9A 4FGHA 3SRQX 1HFQA 5ECXA 4PSTA 3FL8A 3NTZA 4KJLA 4DDRA 3NXOA 4PTJA 4H98A 2XW7A 1RX4A 5E8QA 1M78A 4XT5A 3NXTA 4PDJA 3FYVX 3I8AX 3VCOA 3I3RA 3IRMA 5HSUA 1PD9A 3M08A 3NZCX 4NX6A 4KAKA 1DISA 3EX8A 3QL0A 3SRUX 1KMVA 4M6LA 3NXXA 1M79A 3RO9A 2HQPA 2W3VA 1LY3A 1RB2A 3OCHA 1CZ3A 4IXFX 1DLSA 1DR6A 1RX3A 5HI6A 1RX8A 4LEKX 1DYHA 4HA9A 3FQCA 2BL9A 4QI9A 3FS6A 3IA4A 3GHVA 3JWKA 3OAFA 2ZZAA 4H96A 3KGYA 4IXGX 5U27A 2ANQA 3SGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KEB A;  3FL9 A;  3TQB A;  2FZI A;  4XE6 X;  4QLG A;  1RX7 A;  3SAI A;  2KGK A;  3FRB X;  3M09 A;  1DYR A;  3RG9 A;  4HOF A;  3K74 A;  2W9T A;  3S7A A;  4H97 A;  5HVE A;  1DRA A;  3F0U X;  1DHF A;  3LG4 A;  3CLB A;  5JG0 X;  2D0K A;  3QYO A;  3TQ9 A;  3CSE A;  3FY9 X;  4Q0E A;  8DFR A;  1DR7 A;  3UM8 A;  1PDB A;  2B3Z A;  5HT5 A;  3CL9 A;  2W3B A;  1RX5 A;  4HA7 A;  4ELB A;  3F91 A;  3FQ0 A;  1RB3 A;  1DRF A;  3F8Z A;  4XT6 A;  3JW3 A;  3FRE X;  3QLR A;  3DL6 A;  2L28 A;  3JWF A;  4I13 A;  3QGT A;  4X5J A;  4KY8 A;  4DP3 A;  3DAU A;  3L3R A;  4EIZ A;  5CC9 A;  3HJ3 A;  4P66 A;  3DL5 A;  1AI9 A;  1DR4 A;  3EEK A;  3F0X X;  1HFR A;  3SQY X;  3FY8 X;  3GYF A;  3IRN A;  5HF0 X;  2ANO A;  1J3K A;  3GHW A;  4G8Z X;  1RX1 A;  3NXY A;  4G95 A;  4M6J A;  4XRB A;  4M7U A;  1AOE A;  4DPH A;  3F0S X;  3FQZ A;  4ELG A;  5HSR A;  3SA2 A;  1RF7 A;  4KNE A;  1S3W A;  1S3U A;  2W3M A;  3NZA X;  1BOZ A;  1S3V A;  4ECK A;  4ELF A;  3JSU A;  3FRD X;  1ZDR A;  3SRS X;  1MVT A;  4IXE D;  2P4G A;  1DR5 A;  4KFJ A;  3JWM A;  4DPD A;  3F0B X;  2HXV A;  1DF7 A;  2D5N A;  3KFY A;  1DG5 A;  3D84 X;  3UM6 A;  1J3J A;  3CD2 A;  1IA4 A;  2BLC A;  3JTW A;  3IX9 A;  1HFP A;  2FZH A;  1JOM A;  2HM9 A;  1SEJ A;  3ZPG A;  4DFR A;  1M7A A;  1DDR A;  5HVB A;  4EJ1 A;  4KBN A;  1DDS A;  3ROA A;  2DRC A;  4PTH A;  4OR7 A;  3TD8 A;  1JUV A;  3QFX A;  1RX6 A;  4M7V A;  1JOL A;  1RA9 A;  1S3Y A;  1U71 A;  3EEL A;  3R33 A;  2C2S A;  3F0V X;  4KLX A;  4KJK A;  4LAG X;  4QHV A;  3SA1 A;  3EEJ A;  2H2Q A;  3Q1H A;  4QJZ D;  1DRH A;  1RG7 A;  3F0Q X;  2JYB A;  1QZF A;  2W3A A;  4OSG A;  4HOG A;  2W9G A;  3TQ8 A;  5DFR A;  1DRB A;  1DG7 A;  3DRC A;  3IRO A;  3JWC A;  2BLA A;  3SR5 X;  4HOE A;  1KMS A;  3JW5 A;  5HT4 A;  4GH8 A;  3HBB A;  3FYW X;  5DXV A;  6DFR A;  1LY4 A;  3ZPC A;  4Q6A A;  1OHK A;  3KY8 A;  3NXR A;  3K45 A;  4NX7 A;  2AZN A;  3SRR X;  2W9S A;  1DYJ A;  7DFR A;  5HQZ A;  1VJ3 A;  3GI2 A;  3QYL A;  3NZB X;  4QJC A;  3QG2 A;  1IA3 A;  4PSY A;  5U26 A;  1DG8 A;  3SH2 A;  1DR2 A;  1RD7 A;  4QLE A;  4EIL A;  1IA2 A;  5CCC A;  1DHJ A;  1RA3 A;  4X5G A;  3FQV A;  3QLY A;  4LAE X;  4X5H A;  1DYI A;  2G6V A;  3N0H A;  4X5F A;  1IA1 A;  2FZJ A;  3NXV A;  3UM5 A;  4KL9 A;  3DG8 A;  1J3I A;  3E0B A;  3TQA A;  3D80 A;  3KJR A;  3FRF X;  4G3M A;  4Q67 A;  4FHB A;  2CIG A;  3NU0 A;  4ELE A;  4KD7 A;  4ELH A;  3F8Y A;  1TDR A;  5JA3 A;  1VDR A;  5ECC A;  1E26 A;  1DHI A;  5EAJ A;  2INQ A;  4P3Q A;  3NRR A;  4M2X A;  5HPB A;  3FRA X;  1OHJ A;  1PD8 A;  2O7P A;  4XT8 A;  3S3V A;  4XEC X;  3EEM A;  1RA2 A;  3QL3 A;  2W9H A;  1KLK A;  4PSS A;  4XT4 A;  3NZ6 X;  1DR1 A;  4FGG A;  2CD2 A;  4X5I A;  1DRE A;  1BZF A;  3DFR A;  4KJJ A;  1DLR A;  1D1G A;  3GHC A;  4XT7 A;  1RX2 A;  5HQY A;  3NZ9 X;  4EIG A;  4M6K A;  1LUD A;  1RX9 A;  4CD2 A;  3QLX A;  1RH3 A;  1RC4 A;  3EIG A;  3S9U A;  5FDA A;  2C2T A;  3NZD A;  4KM0 A;  4KM2 A;  3IA5 A;  1DR3 A;  3DGA A;  1RE7 A;  1RA8 A;  1DIU A;  3DAT A;  2DHF A;  4QLF A;  2ITH A;  3QLW A;  4KY4 A;  2OBC A;  5HUI A;  1DAJ A;  2QK8 A;  3FQF A;  2W3W A;  4TU5 X;  2LF1 A;  3K2H A;  3K47 A;  3QLS A;  1CD2 A;  2OIP A;  1U70 A;  1MVS A;  3QLZ A;  4P3R A;  3INV A;  5HF2 X;  1AO8 A;  4H95 A;  3KJS A;  1U72 A;  4KYA A;  3JVX A;  4I1N A;  4RGC A;  1RA1 A;  4LAH X;  3SRW X;  2BLB A;  1YHO A;  4P68 A;  4Q0D A;  3FQO A;  2GD9 A;  4FGH A;  3SRQ X;  1HFQ A;  5ECX A;  4PST A;  3FL8 A;  3NTZ A;  4KJL A;  4DDR A;  3NXO A;  4PTJ A;  4H98 A;  2XW7 A;  1RX4 A;  5E8Q A;  1M78 A;  4XT5 A;  3NXT A;  4PDJ A;  3FYV X;  3I8A X;  3VCO A;  3I3R A;  3IRM A;  5HSU A;  1PD9 A;  3M08 A;  3NZC X;  4NX6 A;  4KAK A;  1DIS A;  3EX8 A;  3QL0 A;  3SRU X;  1KMV A;  4M6L A;  3NXX A;  1M79 A;  3RO9 A;  2HQP A;  2W3V A;  1LY3 A;  1RB2 A;  3OCH A;  1CZ3 A;  4IXF X;  1DLS A;  1DR6 A;  1RX3 A;  5HI6 A;  1RX8 A;  4LEK X;  1DYH A;  4HA9 A;  3FQC A;  2BL9 A;  4QI9 A;  3FS6 A;  3IA4 A;  3GHV A;  3JWK A;  3OAF A;  2ZZA A;  4H96 A;  3KGY A;  4IXG X;  5U27 A;  2ANQ A;  3SGY A; 
#chains in the Genus database with same CATH topology
 4KEB A;  3FL9 A;  3TQB A;  2FZI A;  4XE6 X;  4QLG A;  1RX7 A;  3SAI A;  2KGK A;  3FRB X;  3M09 A;  1DYR A;  3RG9 A;  4HOF A;  3K74 A;  2W9T A;  3S7A A;  4H97 A;  5HVE A;  1DRA A;  3F0U X;  1DHF A;  3LG4 A;  3CLB A;  5JG0 X;  2D0K A;  3QYO A;  3TQ9 A;  3CSE A;  3FY9 X;  4Q0E A;  8DFR A;  1DR7 A;  3UM8 A;  1PDB A;  2B3Z A;  5HT5 A;  3CL9 A;  2W3B A;  1RX5 A;  4HA7 A;  4ELB A;  3F91 A;  3FQ0 A;  1RB3 A;  1DRF A;  3F8Z A;  4XT6 A;  3JW3 A;  3FRE X;  3QLR A;  3DL6 A;  2L28 A;  3JWF A;  4I13 A;  3QGT A;  4X5J A;  4KY8 A;  4DP3 A;  3DAU A;  3L3R A;  4EIZ A;  5CC9 A;  3HJ3 A;  4P66 A;  3DL5 A;  1AI9 A;  1DR4 A;  3EEK A;  3F0X X;  1HFR A;  3SQY X;  3FY8 X;  3GYF A;  3IRN A;  5HF0 X;  2ANO A;  1J3K A;  3GHW A;  4G8Z X;  1RX1 A;  3NXY A;  4G95 A;  4M6J A;  4XRB A;  4M7U A;  1AOE A;  4DPH A;  3F0S X;  3FQZ A;  4ELG A;  5HSR A;  3SA2 A;  1RF7 A;  4KNE A;  1S3W A;  1S3U A;  2W3M A;  3NZA X;  1BOZ A;  1S3V A;  4ECK A;  4ELF A;  3JSU A;  3FRD X;  1ZDR A;  3SRS X;  1MVT A;  4IXE D;  2P4G A;  1DR5 A;  4KFJ A;  3JWM A;  4DPD A;  3F0B X;  2HXV A;  1DF7 A;  2D5N A;  3KFY A;  1DG5 A;  3D84 X;  3UM6 A;  1J3J A;  3CD2 A;  1IA4 A;  2BLC A;  3JTW A;  3IX9 A;  1HFP A;  2FZH A;  1JOM A;  2HM9 A;  1SEJ A;  3ZPG A;  4DFR A;  1M7A A;  1DDR A;  5HVB A;  4EJ1 A;  4KBN A;  1DDS A;  3ROA A;  2DRC A;  4PTH A;  4OR7 A;  3TD8 A;  1JUV A;  3QFX A;  1RX6 A;  4M7V A;  1JOL A;  1RA9 A;  1S3Y A;  1U71 A;  3EEL A;  3R33 A;  2C2S A;  3F0V X;  4KLX A;  4KJK A;  4LAG X;  4QHV A;  3SA1 A;  3EEJ A;  2H2Q A;  3Q1H A;  4QJZ D;  1DRH A;  1RG7 A;  3F0Q X;  2JYB A;  1QZF A;  2W3A A;  4OSG A;  4HOG A;  2W9G A;  3TQ8 A;  5DFR A;  1DRB A;  1DG7 A;  3DRC A;  3IRO A;  3JWC A;  2BLA A;  3SR5 X;  4HOE A;  1KMS A;  3JW5 A;  5HT4 A;  4GH8 A;  3HBB A;  3FYW X;  5DXV A;  6DFR A;  1LY4 A;  3ZPC A;  4Q6A A;  1OHK A;  3KY8 A;  3NXR A;  3K45 A;  4NX7 A;  2AZN A;  3SRR X;  2W9S A;  1DYJ A;  7DFR A;  5HQZ A;  1VJ3 A;  3GI2 A;  3QYL A;  3NZB X;  4QJC A;  3QG2 A;  1IA3 A;  4PSY A;  5U26 A;  1DG8 A;  3SH2 A;  1DR2 A;  1RD7 A;  4QLE A;  4EIL A;  1IA2 A;  5CCC A;  1DHJ A;  1RA3 A;  4X5G A;  3FQV A;  3QLY A;  4LAE X;  4X5H A;  1DYI A;  2G6V A;  3N0H A;  4X5F A;  1IA1 A;  2FZJ A;  3NXV A;  3UM5 A;  4KL9 A;  3DG8 A;  1J3I A;  3E0B A;  3TQA A;  3D80 A;  3KJR A;  3FRF X;  4G3M A;  4Q67 A;  4FHB A;  2CIG A;  3NU0 A;  4ELE A;  4KD7 A;  4ELH A;  3F8Y A;  1TDR A;  5JA3 A;  1VDR A;  5ECC A;  1E26 A;  1DHI A;  5EAJ A;  2INQ A;  4P3Q A;  3NRR A;  4M2X A;  5HPB A;  3FRA X;  1OHJ A;  1PD8 A;  2O7P A;  4XT8 A;  3S3V A;  4XEC X;  3EEM A;  1RA2 A;  3QL3 A;  2W9H A;  1KLK A;  4PSS A;  4XT4 A;  3NZ6 X;  1DR1 A;  4FGG A;  2CD2 A;  4X5I A;  1DRE A;  1BZF A;  3DFR A;  4KJJ A;  1DLR A;  1D1G A;  3GHC A;  4XT7 A;  1RX2 A;  5HQY A;  3NZ9 X;  4EIG A;  4M6K A;  1LUD A;  1RX9 A;  4CD2 A;  3QLX A;  1RH3 A;  1RC4 A;  3EIG A;  3S9U A;  5FDA A;  2C2T A;  3NZD A;  4KM0 A;  4KM2 A;  3IA5 A;  1DR3 A;  3DGA A;  1RE7 A;  1RA8 A;  1DIU A;  3DAT A;  2DHF A;  4QLF A;  2ITH A;  3QLW A;  4KY4 A;  2OBC A;  5HUI A;  1DAJ A;  2QK8 A;  3FQF A;  2W3W A;  4TU5 X;  2LF1 A;  3K2H A;  3K47 A;  3QLS A;  1CD2 A;  2OIP A;  1U70 A;  1MVS A;  3QLZ A;  4P3R A;  3INV A;  5HF2 X;  1AO8 A;  4H95 A;  3KJS A;  1U72 A;  4KYA A;  3JVX A;  4I1N A;  4RGC A;  1RA1 A;  4LAH X;  3SRW X;  2BLB A;  1YHO A;  4P68 A;  4Q0D A;  3FQO A;  2GD9 A;  4FGH A;  3SRQ X;  1HFQ A;  5ECX A;  4PST A;  3FL8 A;  3NTZ A;  4KJL A;  4DDR A;  3NXO A;  4PTJ A;  4H98 A;  2XW7 A;  1RX4 A;  5E8Q A;  1M78 A;  4XT5 A;  3NXT A;  4PDJ A;  3FYV X;  3I8A X;  3VCO A;  3I3R A;  3IRM A;  5HSU A;  1PD9 A;  3M08 A;  3NZC X;  4NX6 A;  4KAK A;  1DIS A;  3EX8 A;  3QL0 A;  3SRU X;  1KMV A;  4M6L A;  3NXX A;  1M79 A;  3RO9 A;  2HQP A;  2W3V A;  1LY3 A;  1RB2 A;  3OCH A;  1CZ3 A;  4IXF X;  1DLS A;  1DR6 A;  1RX3 A;  5HI6 A;  1RX8 A;  4LEK X;  1DYH A;  4HA9 A;  3FQC A;  2BL9 A;  4QI9 A;  3FS6 A;  3IA4 A;  3GHV A;  3JWK A;  3OAF A;  2ZZA A;  4H96 A;  3KGY A;  4IXG X;  5U27 A;  2ANQ A;  3SGY A; 
#chains in the Genus database with same CATH homology
 4KEB A;  3FL9 A;  3TQB A;  2FZI A;  4XE6 X;  4QLG A;  1RX7 A;  3SAI A;  2KGK A;  3FRB X;  3M09 A;  1DYR A;  3RG9 A;  4HOF A;  3K74 A;  2W9T A;  3S7A A;  4H97 A;  5HVE A;  1DRA A;  3F0U X;  1DHF A;  3LG4 A;  3CLB A;  5JG0 X;  2D0K A;  3QYO A;  3TQ9 A;  3CSE A;  3FY9 X;  4Q0E A;  8DFR A;  1DR7 A;  3UM8 A;  1PDB A;  2B3Z A;  5HT5 A;  3CL9 A;  2W3B A;  1RX5 A;  4HA7 A;  4ELB A;  3F91 A;  3FQ0 A;  1RB3 A;  1DRF A;  3F8Z A;  4XT6 A;  3JW3 A;  3FRE X;  3QLR A;  3DL6 A;  2L28 A;  3JWF A;  4I13 A;  3QGT A;  4X5J A;  4KY8 A;  4DP3 A;  3DAU A;  3L3R A;  4EIZ A;  5CC9 A;  3HJ3 A;  4P66 A;  3DL5 A;  1AI9 A;  1DR4 A;  3EEK A;  3F0X X;  1HFR A;  3SQY X;  3FY8 X;  3GYF A;  3IRN A;  5HF0 X;  2ANO A;  1J3K A;  3GHW A;  4G8Z X;  1RX1 A;  3NXY A;  4G95 A;  4M6J A;  4XRB A;  4M7U A;  1AOE A;  4DPH A;  3F0S X;  3FQZ A;  4ELG A;  5HSR A;  3SA2 A;  1RF7 A;  4KNE A;  1S3W A;  1S3U A;  2W3M A;  3NZA X;  1BOZ A;  1S3V A;  4ECK A;  4ELF A;  3JSU A;  3FRD X;  1ZDR A;  3SRS X;  1MVT A;  4IXE D;  2P4G A;  1DR5 A;  4KFJ A;  3JWM A;  4DPD A;  3F0B X;  2HXV A;  1DF7 A;  2D5N A;  3KFY A;  1DG5 A;  3D84 X;  3UM6 A;  1J3J A;  3CD2 A;  1IA4 A;  2BLC A;  3JTW A;  3IX9 A;  1HFP A;  2FZH A;  1JOM A;  2HM9 A;  1SEJ A;  3ZPG A;  4DFR A;  1M7A A;  1DDR A;  5HVB A;  4EJ1 A;  4KBN A;  1DDS A;  3ROA A;  2DRC A;  4PTH A;  4OR7 A;  3TD8 A;  1JUV A;  3QFX A;  1RX6 A;  4M7V A;  1JOL A;  1RA9 A;  1S3Y A;  1U71 A;  3EEL A;  3R33 A;  2C2S A;  3F0V X;  4KLX A;  4KJK A;  4LAG X;  4QHV A;  3SA1 A;  3EEJ A;  2H2Q A;  3Q1H A;  4QJZ D;  1DRH A;  1RG7 A;  3F0Q X;  2JYB A;  1QZF A;  2W3A A;  4OSG A;  4HOG A;  2W9G A;  3TQ8 A;  5DFR A;  1DRB A;  1DG7 A;  3DRC A;  3IRO A;  3JWC A;  2BLA A;  3SR5 X;  4HOE A;  1KMS A;  3JW5 A;  5HT4 A;  4GH8 A;  3HBB A;  3FYW X;  5DXV A;  6DFR A;  1LY4 A;  3ZPC A;  4Q6A A;  1OHK A;  3KY8 A;  3NXR A;  3K45 A;  4NX7 A;  2AZN A;  3SRR X;  2W9S A;  1DYJ A;  7DFR A;  5HQZ A;  1VJ3 A;  3GI2 A;  3QYL A;  3NZB X;  4QJC A;  3QG2 A;  1IA3 A;  4PSY A;  5U26 A;  1DG8 A;  3SH2 A;  1DR2 A;  1RD7 A;  4QLE A;  4EIL A;  1IA2 A;  5CCC A;  1DHJ A;  1RA3 A;  4X5G A;  3FQV A;  3QLY A;  4LAE X;  4X5H A;  1DYI A;  2G6V A;  3N0H A;  4X5F A;  1IA1 A;  2FZJ A;  3NXV A;  3UM5 A;  4KL9 A;  3DG8 A;  1J3I A;  3E0B A;  3TQA A;  3D80 A;  3KJR A;  3FRF X;  4G3M A;  4Q67 A;  4FHB A;  2CIG A;  3NU0 A;  4ELE A;  4KD7 A;  4ELH A;  3F8Y A;  1TDR A;  5JA3 A;  1VDR A;  5ECC A;  1E26 A;  1DHI A;  5EAJ A;  2INQ A;  4P3Q A;  3NRR A;  4M2X A;  5HPB A;  3FRA X;  1OHJ A;  1PD8 A;  2O7P A;  4XT8 A;  3S3V A;  4XEC X;  3EEM A;  1RA2 A;  3QL3 A;  2W9H A;  1KLK A;  4PSS A;  4XT4 A;  3NZ6 X;  1DR1 A;  4FGG A;  2CD2 A;  4X5I A;  1DRE A;  1BZF A;  3DFR A;  4KJJ A;  1DLR A;  1D1G A;  3GHC A;  4XT7 A;  1RX2 A;  5HQY A;  3NZ9 X;  4EIG A;  4M6K A;  1LUD A;  1RX9 A;  4CD2 A;  3QLX A;  1RH3 A;  1RC4 A;  3EIG A;  3S9U A;  5FDA A;  2C2T A;  3NZD A;  4KM0 A;  4KM2 A;  3IA5 A;  1DR3 A;  3DGA A;  1RE7 A;  1RA8 A;  1DIU A;  3DAT A;  2DHF A;  4QLF A;  2ITH A;  3QLW A;  4KY4 A;  2OBC A;  5HUI A;  1DAJ A;  2QK8 A;  3FQF A;  2W3W A;  4TU5 X;  2LF1 A;  3K2H A;  3K47 A;  3QLS A;  1CD2 A;  2OIP A;  1U70 A;  1MVS A;  3QLZ A;  4P3R A;  3INV A;  5HF2 X;  1AO8 A;  4H95 A;  3KJS A;  1U72 A;  4KYA A;  3JVX A;  4I1N A;  4RGC A;  1RA1 A;  4LAH X;  3SRW X;  2BLB A;  1YHO A;  4P68 A;  4Q0D A;  3FQO A;  2GD9 A;  4FGH A;  3SRQ X;  1HFQ A;  5ECX A;  4PST A;  3FL8 A;  3NTZ A;  4KJL A;  4DDR A;  3NXO A;  4PTJ A;  4H98 A;  2XW7 A;  1RX4 A;  5E8Q A;  1M78 A;  4XT5 A;  3NXT A;  4PDJ A;  3FYV X;  3I8A X;  3VCO A;  3I3R A;  3IRM A;  5HSU A;  1PD9 A;  3M08 A;  3NZC X;  4NX6 A;  4KAK A;  1DIS A;  3EX8 A;  3QL0 A;  3SRU X;  1KMV A;  4M6L A;  3NXX A;  1M79 A;  3RO9 A;  2HQP A;  2W3V A;  1LY3 A;  1RB2 A;  3OCH A;  1CZ3 A;  4IXF X;  1DLS A;  1DR6 A;  1RX3 A;  5HI6 A;  1RX8 A;  4LEK X;  1DYH A;  4HA9 A;  3FQC A;  2BL9 A;  4QI9 A;  3FS6 A;  3IA4 A;  3GHV A;  3JWK A;  3OAF A;  2ZZA A;  4H96 A;  3KGY A;  4IXG X;  5U27 A;  2ANQ A;  3SGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...