4ELBA

Structure-activity relationship guides enantiomeric preference among potent inhibitors of b. anthracis dihydrofolate reductase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
166
structure length
166
Chain Sequence
MIVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNEGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHAFEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHVYEKQQLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-activity relationship for enantiomers of potent inhibitors of B. anthracis dihydrofolate reductase.
pubmed doi rcsb
molecule keywords Dihydrofolate reductase
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Bacillus anthracis
total genus 40
structure length 166
sequence length 166
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2012-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 4elbA00
3UM6A 4XE6X 1DG5A 5HQYA 2P4GA 5CCCA 1DYJA 3NZCX 3GHCA 5U26A 2W3WA 1DYHA 3SGYA 2L28A 7DFRA 4KJLA 4QI9A 2W3BA 4M7VA 2INQA 1M7AA 6DFRA 3FRFX 3FRDX 4KL9A 4XRBA 1RX6A 3NXRA 3IRMA 3DL6A 2H2QA 3LG4A 3F0VX 1DR4A 1S3VA 4DFRA 1RX5A 2GD9A 4H95A 3FS6A 3K45A 5CC9A 1MVSA 4LEKX 4CD2A 4XT6A 4P3QA 3IA5A 1RA3A 1DG7A 1S3WA 3OCHA 3DFRA 3JWMA 2D5NA 4OR7A 5HT5A 1JUVA 3IRNA 4NX7A 3DG8A 4DPHA 1DHIA 4ELBA 1DRAA 1J3JA 2CD2A 3QLSA 3E0BA 3QG2A 4KAKA 5ECXA 3IROA 1RE7A 3R33A 3NZAX 4QLEA 3GYFA 5HT4A 3NZDA 4G95A 3JWCA 4PSSA 4KJJA 2W3AA 1AO8A 2DHFA 4HOGA 4M6JA 1DYIA 1D1GA 3SA2A 3ZPCA 4P3RA 3EIGA 3DATA 4ELHA 1TDRA 3QLWA 5DFRA 3TQAA 3TQ8A 3JW3A 1MVTA 4QJCA 4PTHA 3F0UX 1KMVA 4I1NA 1S3UA 3TD8A 2W9HA 2FZHA 3UM5A 1LY3A 4DP3A 3F8YA 3GI2A 3QYOA 1DISA 4Q67A 4TU5X 3EELA 3CL9A 3F0SX 3QLXA 3M09A 4QLFA 4G8ZX 1DR3A 4EIZA 8DFRA 4HOEA 3K47A 1RA1A 1AI9A 1DDRA 5U27A 3K74A 1RB3A 1DLRA 4FHBA 4KM0A 4PTJA 1DIUA 1OHKA 4EJ1A 4XT8A 4Q0EA 3QLRA 3F0QX 2HXVA 2ZZAA 2W9TA 1M79A 4X5HA 3FQOA 5JG0X 4DPDA 2FZJA 2DRCA 3QLYA 3EEMA 4H97A 2B3ZA 4IXFX 1DREA 1IA4A 3S7AA 3NXOA 1DYRA 3NZBX 2FZIA 1PD8A 3FRBX 4GH8A 4Q6AA 3F91A 1HFPA 3NZ6X 3VCOA 3F0XX 3JWFA 4KBNA 3KJRA 5EAJA 1DLSA 1IA3A 4DDRA 1RA9A 2ITHA 4KEBA 4EIGA 5E8QA 1BOZA 1RH3A 4KD7A 5HQZA 3QFXA 1DG8A 2OIPA 2BL9A 2D0KA 1DR2A 3NTZA 3D80A 4EILA 4KJKA 2KGKA 3DGAA 3OAFA 4P68A 4P66A 2CIGA 3JTWA 4QLGA 3QGTA 1DDSA 3SRSX 3KY8A 3N0HA 5HF2X 2BLBA 3FY8X 3SRWX 1DHFA 4XT5A 4RGCA 3UM8A 1OHJA 3KFYA 1RF7A 2W9GA 2QK8A 3ROAA 3JWKA 1RA2A 4XT4A 4M7UA 1U71A 5ECCA 1KMSA 3QL3A 1RG7A 2LF1A 3SRUX 4KY8A 4Q0DA 3FREX 3Q1HA 4M2XA 4M6LA 3FQ0A 3TQ9A 4XT7A 5FDAA 4ELEA 4PSYA 1RC4A 3HJ3A 2O7PA 1RX2A 3ZPGA 1YHOA 4FGHA 5HSUA 2HQPA 4X5JA 4HOFA 3HBBA 1J3IA 3SAIA 3SH2A 2C2TA 1DR7A 4KYAA 1LY4A 3FY9X 2ANOA 1IA2A 3QYLA 1QZFA 2W9SA 2ANQA 3GHWA 4OSGA 1DR5A 4PSTA 1RD7A 1LUDA 3SA1A 3QL0A 2C2SA 3L3RA 4KY4A 3CSEA 3IA4A 3NU0A 1PDBA 3I8AX 4HA9A 3QLZA 3SQYX 4H98A 4LAHX 3NXVA 5HI6A 1HFRA 3RG9A 3FYVX 5HSRA 4KNEA 1JOLA 1SEJA 4I13A 4FGGA 3I3RA 3GHVA 3NXTA 1J3KA 3TQBA 1RX4A 3JW5A 3FQFA 3JSUA 1DRFA 1DR1A 3M08A 5HUIA 3FYWX 1ZDRA 3S3VA 5DXVA 5HVEA 4IXGX 2AZNA 1DF7A 1M78A 2W3VA 3EX8A 1RX8A 3CLBA 1KLKA 1VJ3A 3NXYA 3CD2A 3DL5A 4LAEX 1DR6A 1RX3A 2BLCA 1CZ3A 1AOEA 3D84X 4QJZD 1RX7A 2HM9A 2G6VA 1RB2A 4QHVA 4IXED 4XECX 3DRCA 3S9UA 4X5IA 5JA3A 1RA8A 4X5GA 3NRRA 3F0BX 1DAJA 3SRRX 4G3MA 4KLXA 2OBCA 1DRBA 1DHJA 5HF0X 3FQZA 1HFQA 5HPBA 4KM2A 3NZ9X 1IA1A 1U72A 1CD2A 3INVA 3RO9A 3F8ZA 4HA7A 2W3MA 3KGYA 1E26A 1PD9A 4M6KA 3EEJA 1S3YA 4ELFA 4ECKA 2BLAA 1VDRA 3FQVA 4X5FA 3FL8A 3FRAX 2XW7A 4LAGX 3NXXA 3SRQX 4NX6A 1RX1A 1DRHA 3DAUA 3FQCA 5HVBA 3JVXA 4KFJA 4ELGA 3EEKA 3KJSA 1JOMA 4PDJA 1U70A 3K2HA 1BZFA 3IX9A 1RX9A 2JYBA 3FL9A 4H96A 3SR5X
chains in the Genus database with same CATH superfamily
3UM6A 4XE6X 1DG5A 5HQYA 2P4GA 5CCCA 1DYJA 3NZCX 3GHCA 5U26A 2W3WA 1DYHA 3SGYA 2L28A 7DFRA 4KJLA 4QI9A 2W3BA 4M7VA 2INQA 1M7AA 6DFRA 3FRFX 3FRDX 4KL9A 4XRBA 1RX6A 3NXRA 3IRMA 3DL6A 2H2QA 3LG4A 3F0VX 1DR4A 1S3VA 4DFRA 1RX5A 2GD9A 4H95A 3FS6A 3K45A 5CC9A 1MVSA 4LEKX 4CD2A 4XT6A 4P3QA 3IA5A 1RA3A 1DG7A 1S3WA 3OCHA 3DFRA 3JWMA 2D5NA 4OR7A 5HT5A 1JUVA 3IRNA 4NX7A 3DG8A 4DPHA 1DHIA 4ELBA 1DRAA 1J3JA 2CD2A 3QLSA 3E0BA 3QG2A 4KAKA 5ECXA 3IROA 1RE7A 3R33A 3NZAX 4QLEA 3GYFA 5HT4A 3NZDA 4G95A 3JWCA 4PSSA 4KJJA 2W3AA 1AO8A 2DHFA 4HOGA 4M6JA 1DYIA 1D1GA 3SA2A 3ZPCA 4P3RA 3EIGA 3DATA 4ELHA 1TDRA 3QLWA 5DFRA 3TQAA 3TQ8A 3JW3A 1MVTA 4QJCA 4PTHA 3F0UX 1KMVA 4I1NA 1S3UA 3TD8A 2W9HA 2FZHA 3UM5A 1LY3A 4DP3A 3F8YA 3GI2A 3QYOA 1DISA 4Q67A 4TU5X 3EELA 3CL9A 3F0SX 3QLXA 3M09A 4QLFA 4G8ZX 1DR3A 4EIZA 8DFRA 4HOEA 3K47A 1RA1A 1AI9A 1DDRA 5U27A 3K74A 1RB3A 1DLRA 4FHBA 4KM0A 4PTJA 1DIUA 1OHKA 4EJ1A 4XT8A 4Q0EA 3QLRA 3F0QX 2HXVA 2ZZAA 2W9TA 1M79A 4X5HA 3FQOA 5JG0X 4DPDA 2FZJA 2DRCA 3QLYA 3EEMA 4H97A 2B3ZA 4IXFX 1DREA 1IA4A 3S7AA 3NXOA 1DYRA 3NZBX 2FZIA 1PD8A 3FRBX 4GH8A 4Q6AA 3F91A 1HFPA 3NZ6X 3VCOA 3F0XX 3JWFA 4KBNA 3KJRA 5EAJA 1DLSA 1IA3A 4DDRA 1RA9A 2ITHA 4KEBA 4EIGA 5E8QA 1BOZA 1RH3A 4KD7A 5HQZA 3QFXA 1DG8A 2OIPA 2BL9A 2D0KA 1DR2A 3NTZA 3D80A 4EILA 4KJKA 2KGKA 3DGAA 3OAFA 4P68A 4P66A 2CIGA 3JTWA 4QLGA 3QGTA 1DDSA 3SRSX 3KY8A 3N0HA 5HF2X 2BLBA 3FY8X 3SRWX 1DHFA 4XT5A 4RGCA 3UM8A 1OHJA 3KFYA 1RF7A 2W9GA 2QK8A 3ROAA 3JWKA 1RA2A 4XT4A 4M7UA 1U71A 5ECCA 1KMSA 3QL3A 1RG7A 2LF1A 3SRUX 4KY8A 4Q0DA 3FREX 3Q1HA 4M2XA 4M6LA 3FQ0A 3TQ9A 4XT7A 5FDAA 4ELEA 4PSYA 1RC4A 3HJ3A 2O7PA 1RX2A 3ZPGA 1YHOA 4FGHA 5HSUA 2HQPA 4X5JA 4HOFA 3HBBA 1J3IA 3SAIA 3SH2A 2C2TA 1DR7A 4KYAA 1LY4A 3FY9X 2ANOA 1IA2A 3QYLA 1QZFA 2W9SA 2ANQA 3GHWA 4OSGA 1DR5A 4PSTA 1RD7A 1LUDA 3SA1A 3QL0A 2C2SA 3L3RA 4KY4A 3CSEA 3IA4A 3NU0A 1PDBA 3I8AX 4HA9A 3QLZA 3SQYX 4H98A 4LAHX 3NXVA 5HI6A 1HFRA 3RG9A 3FYVX 5HSRA 4KNEA 1JOLA 1SEJA 4I13A 4FGGA 3I3RA 3GHVA 3NXTA 1J3KA 3TQBA 1RX4A 3JW5A 3FQFA 3JSUA 1DRFA 1DR1A 3M08A 5HUIA 3FYWX 1ZDRA 3S3VA 5DXVA 5HVEA 4IXGX 2AZNA 1DF7A 1M78A 2W3VA 3EX8A 1RX8A 3CLBA 1KLKA 1VJ3A 3NXYA 3CD2A 3DL5A 4LAEX 1DR6A 1RX3A 2BLCA 1CZ3A 1AOEA 3D84X 4QJZD 1RX7A 2HM9A 2G6VA 1RB2A 4QHVA 4IXED 4XECX 3DRCA 3S9UA 4X5IA 5JA3A 1RA8A 4X5GA 3NRRA 3F0BX 1DAJA 3SRRX 4G3MA 4KLXA 2OBCA 1DRBA 1DHJA 5HF0X 3FQZA 1HFQA 5HPBA 4KM2A 3NZ9X 1IA1A 1U72A 1CD2A 3INVA 3RO9A 3F8ZA 4HA7A 2W3MA 3KGYA 1E26A 1PD9A 4M6KA 3EEJA 1S3YA 4ELFA 4ECKA 2BLAA 1VDRA 3FQVA 4X5FA 3FL8A 3FRAX 2XW7A 4LAGX 3NXXA 3SRQX 4NX6A 1RX1A 1DRHA 3DAUA 3FQCA 5HVBA 3JVXA 4KFJA 4ELGA 3EEKA 3KJSA 1JOMA 4PDJA 1U70A 3K2HA 1BZFA 3IX9A 1RX9A 2JYBA 3FL9A 4H96A 3SR5X
chains in the Genus database with same CATH topology
3UM6A 4XE6X 1DG5A 5HQYA 2P4GA 5CCCA 1DYJA 3NZCX 3GHCA 5U26A 2W3WA 1DYHA 3SGYA 2L28A 7DFRA 4KJLA 4QI9A 2W3BA 4M7VA 2INQA 1M7AA 6DFRA 3FRFX 3FRDX 4KL9A 4XRBA 1RX6A 3NXRA 3IRMA 3DL6A 2H2QA 3LG4A 3F0VX 1DR4A 1S3VA 4DFRA 1RX5A 2GD9A 4H95A 3FS6A 3K45A 5CC9A 1MVSA 4LEKX 4CD2A 4XT6A 4P3QA 3IA5A 1RA3A 1DG7A 1S3WA 3OCHA 3DFRA 3JWMA 2D5NA 4OR7A 5HT5A 1JUVA 3IRNA 4NX7A 3DG8A 4DPHA 1DHIA 4ELBA 1DRAA 1J3JA 2CD2A 3QLSA 3E0BA 3QG2A 4KAKA 5ECXA 3IROA 1RE7A 3R33A 3NZAX 4QLEA 3GYFA 5HT4A 3NZDA 4G95A 3JWCA 4PSSA 4KJJA 2W3AA 1AO8A 2DHFA 4HOGA 4M6JA 1DYIA 1D1GA 3SA2A 3ZPCA 4P3RA 3EIGA 3DATA 4ELHA 1TDRA 3QLWA 5DFRA 3TQAA 3TQ8A 3JW3A 1MVTA 4QJCA 4PTHA 3F0UX 1KMVA 4I1NA 1S3UA 3TD8A 2W9HA 2FZHA 3UM5A 1LY3A 4DP3A 3F8YA 3GI2A 3QYOA 1DISA 4Q67A 4TU5X 3EELA 3CL9A 3F0SX 3QLXA 3M09A 4QLFA 4G8ZX 1DR3A 4EIZA 8DFRA 4HOEA 3K47A 1RA1A 1AI9A 1DDRA 5U27A 3K74A 1RB3A 1DLRA 4FHBA 4KM0A 4PTJA 1DIUA 1OHKA 4EJ1A 4XT8A 4Q0EA 3QLRA 3F0QX 2HXVA 2ZZAA 2W9TA 1M79A 4X5HA 3FQOA 5JG0X 4DPDA 2FZJA 2DRCA 3QLYA 3EEMA 4H97A 2B3ZA 4IXFX 1DREA 1IA4A 3S7AA 3NXOA 1DYRA 3NZBX 2FZIA 1PD8A 3FRBX 4GH8A 4Q6AA 3F91A 1HFPA 3NZ6X 3VCOA 3F0XX 3JWFA 4KBNA 3KJRA 5EAJA 1DLSA 1IA3A 4DDRA 1RA9A 2ITHA 4KEBA 4EIGA 5E8QA 1BOZA 1RH3A 4KD7A 5HQZA 3QFXA 1DG8A 2OIPA 2BL9A 2D0KA 1DR2A 3NTZA 3D80A 4EILA 4KJKA 2KGKA 3DGAA 3OAFA 4P68A 4P66A 2CIGA 3JTWA 4QLGA 3QGTA 1DDSA 3SRSX 3KY8A 3N0HA 5HF2X 2BLBA 3FY8X 3SRWX 1DHFA 4XT5A 4RGCA 3UM8A 1OHJA 3KFYA 1RF7A 2W9GA 2QK8A 3ROAA 3JWKA 1RA2A 4XT4A 4M7UA 1U71A 5ECCA 1KMSA 3QL3A 1RG7A 2LF1A 3SRUX 4KY8A 4Q0DA 3FREX 3Q1HA 4M2XA 4M6LA 3FQ0A 3TQ9A 4XT7A 5FDAA 4ELEA 4PSYA 1RC4A 3HJ3A 2O7PA 1RX2A 3ZPGA 1YHOA 4FGHA 5HSUA 2HQPA 4X5JA 4HOFA 3HBBA 1J3IA 3SAIA 3SH2A 2C2TA 1DR7A 4KYAA 1LY4A 3FY9X 2ANOA 1IA2A 3QYLA 1QZFA 2W9SA 2ANQA 3GHWA 4OSGA 1DR5A 4PSTA 1RD7A 1LUDA 3SA1A 3QL0A 2C2SA 3L3RA 4KY4A 3CSEA 3IA4A 3NU0A 1PDBA 3I8AX 4HA9A 3QLZA 3SQYX 4H98A 4LAHX 3NXVA 5HI6A 1HFRA 3RG9A 3FYVX 5HSRA 4KNEA 1JOLA 1SEJA 4I13A 4FGGA 3I3RA 3GHVA 3NXTA 1J3KA 3TQBA 1RX4A 3JW5A 3FQFA 3JSUA 1DRFA 1DR1A 3M08A 5HUIA 3FYWX 1ZDRA 3S3VA 5DXVA 5HVEA 4IXGX 2AZNA 1DF7A 1M78A 2W3VA 3EX8A 1RX8A 3CLBA 1KLKA 1VJ3A 3NXYA 3CD2A 3DL5A 4LAEX 1DR6A 1RX3A 2BLCA 1CZ3A 1AOEA 3D84X 4QJZD 1RX7A 2HM9A 2G6VA 1RB2A 4QHVA 4IXED 4XECX 3DRCA 3S9UA 4X5IA 5JA3A 1RA8A 4X5GA 3NRRA 3F0BX 1DAJA 3SRRX 4G3MA 4KLXA 2OBCA 1DRBA 1DHJA 5HF0X 3FQZA 1HFQA 5HPBA 4KM2A 3NZ9X 1IA1A 1U72A 1CD2A 3INVA 3RO9A 3F8ZA 4HA7A 2W3MA 3KGYA 1E26A 1PD9A 4M6KA 3EEJA 1S3YA 4ELFA 4ECKA 2BLAA 1VDRA 3FQVA 4X5FA 3FL8A 3FRAX 2XW7A 4LAGX 3NXXA 3SRQX 4NX6A 1RX1A 1DRHA 3DAUA 3FQCA 5HVBA 3JVXA 4KFJA 4ELGA 3EEKA 3KJSA 1JOMA 4PDJA 1U70A 3K2HA 1BZFA 3IX9A 1RX9A 2JYBA 3FL9A 4H96A 3SR5X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UM6 A;  4XE6 X;  1DG5 A;  5HQY A;  2P4G A;  5CCC A;  1DYJ A;  3NZC X;  3GHC A;  5U26 A;  2W3W A;  1DYH A;  3SGY A;  2L28 A;  7DFR A;  4KJL A;  4QI9 A;  2W3B A;  4M7V A;  2INQ A;  1M7A A;  6DFR A;  3FRF X;  3FRD X;  4KL9 A;  4XRB A;  1RX6 A;  3NXR A;  3IRM A;  3DL6 A;  2H2Q A;  3LG4 A;  3F0V X;  1DR4 A;  1S3V A;  4DFR A;  1RX5 A;  2GD9 A;  4H95 A;  3FS6 A;  3K45 A;  5CC9 A;  1MVS A;  4LEK X;  4CD2 A;  4XT6 A;  4P3Q A;  3IA5 A;  1RA3 A;  1DG7 A;  1S3W A;  3OCH A;  3DFR A;  3JWM A;  2D5N A;  4OR7 A;  5HT5 A;  1JUV A;  3IRN A;  4NX7 A;  3DG8 A;  4DPH A;  1DHI A;  4ELB A;  1DRA A;  1J3J A;  2CD2 A;  3QLS A;  3E0B A;  3QG2 A;  4KAK A;  5ECX A;  3IRO A;  1RE7 A;  3R33 A;  3NZA X;  4QLE A;  3GYF A;  5HT4 A;  3NZD A;  4G95 A;  3JWC A;  4PSS A;  4KJJ A;  2W3A A;  1AO8 A;  2DHF A;  4HOG A;  4M6J A;  1DYI A;  1D1G A;  3SA2 A;  3ZPC A;  4P3R A;  3EIG A;  3DAT A;  4ELH A;  1TDR A;  3QLW A;  5DFR A;  3TQA A;  3TQ8 A;  3JW3 A;  1MVT A;  4QJC A;  4PTH A;  3F0U X;  1KMV A;  4I1N A;  1S3U A;  3TD8 A;  2W9H A;  2FZH A;  3UM5 A;  1LY3 A;  4DP3 A;  3F8Y A;  3GI2 A;  3QYO A;  1DIS A;  4Q67 A;  4TU5 X;  3EEL A;  3CL9 A;  3F0S X;  3QLX A;  3M09 A;  4QLF A;  4G8Z X;  1DR3 A;  4EIZ A;  8DFR A;  4HOE A;  3K47 A;  1RA1 A;  1AI9 A;  1DDR A;  5U27 A;  3K74 A;  1RB3 A;  1DLR A;  4FHB A;  4KM0 A;  4PTJ A;  1DIU A;  1OHK A;  4EJ1 A;  4XT8 A;  4Q0E A;  3QLR A;  3F0Q X;  2HXV A;  2ZZA A;  2W9T A;  1M79 A;  4X5H A;  3FQO A;  5JG0 X;  4DPD A;  2FZJ A;  2DRC A;  3QLY A;  3EEM A;  4H97 A;  2B3Z A;  4IXF X;  1DRE A;  1IA4 A;  3S7A A;  3NXO A;  1DYR A;  3NZB X;  2FZI A;  1PD8 A;  3FRB X;  4GH8 A;  4Q6A A;  3F91 A;  1HFP A;  3NZ6 X;  3VCO A;  3F0X X;  3JWF A;  4KBN A;  3KJR A;  5EAJ A;  1DLS A;  1IA3 A;  4DDR A;  1RA9 A;  2ITH A;  4KEB A;  4EIG A;  5E8Q A;  1BOZ A;  1RH3 A;  4KD7 A;  5HQZ A;  3QFX A;  1DG8 A;  2OIP A;  2BL9 A;  2D0K A;  1DR2 A;  3NTZ A;  3D80 A;  4EIL A;  4KJK A;  2KGK A;  3DGA A;  3OAF A;  4P68 A;  4P66 A;  2CIG A;  3JTW A;  4QLG A;  3QGT A;  1DDS A;  3SRS X;  3KY8 A;  3N0H A;  5HF2 X;  2BLB A;  3FY8 X;  3SRW X;  1DHF A;  4XT5 A;  4RGC A;  3UM8 A;  1OHJ A;  3KFY A;  1RF7 A;  2W9G A;  2QK8 A;  3ROA A;  3JWK A;  1RA2 A;  4XT4 A;  4M7U A;  1U71 A;  5ECC A;  1KMS A;  3QL3 A;  1RG7 A;  2LF1 A;  3SRU X;  4KY8 A;  4Q0D A;  3FRE X;  3Q1H A;  4M2X A;  4M6L A;  3FQ0 A;  3TQ9 A;  4XT7 A;  5FDA A;  4ELE A;  4PSY A;  1RC4 A;  3HJ3 A;  2O7P A;  1RX2 A;  3ZPG A;  1YHO A;  4FGH A;  5HSU A;  2HQP A;  4X5J A;  4HOF A;  3HBB A;  1J3I A;  3SAI A;  3SH2 A;  2C2T A;  1DR7 A;  4KYA A;  1LY4 A;  3FY9 X;  2ANO A;  1IA2 A;  3QYL A;  1QZF A;  2W9S A;  2ANQ A;  3GHW A;  4OSG A;  1DR5 A;  4PST A;  1RD7 A;  1LUD A;  3SA1 A;  3QL0 A;  2C2S A;  3L3R A;  4KY4 A;  3CSE A;  3IA4 A;  3NU0 A;  1PDB A;  3I8A X;  4HA9 A;  3QLZ A;  3SQY X;  4H98 A;  4LAH X;  3NXV A;  5HI6 A;  1HFR A;  3RG9 A;  3FYV X;  5HSR A;  4KNE A;  1JOL A;  1SEJ A;  4I13 A;  4FGG A;  3I3R A;  3GHV A;  3NXT A;  1J3K A;  3TQB A;  1RX4 A;  3JW5 A;  3FQF A;  3JSU A;  1DRF A;  1DR1 A;  3M08 A;  5HUI A;  3FYW X;  1ZDR A;  3S3V A;  5DXV A;  5HVE A;  4IXG X;  2AZN A;  1DF7 A;  1M78 A;  2W3V A;  3EX8 A;  1RX8 A;  3CLB A;  1KLK A;  1VJ3 A;  3NXY A;  3CD2 A;  3DL5 A;  4LAE X;  1DR6 A;  1RX3 A;  2BLC A;  1CZ3 A;  1AOE A;  3D84 X;  4QJZ D;  1RX7 A;  2HM9 A;  2G6V A;  1RB2 A;  4QHV A;  4IXE D;  4XEC X;  3DRC A;  3S9U A;  4X5I A;  5JA3 A;  1RA8 A;  4X5G A;  3NRR A;  3F0B X;  1DAJ A;  3SRR X;  4G3M A;  4KLX A;  2OBC A;  1DRB A;  1DHJ A;  5HF0 X;  3FQZ A;  1HFQ A;  5HPB A;  4KM2 A;  3NZ9 X;  1IA1 A;  1U72 A;  1CD2 A;  3INV A;  3RO9 A;  3F8Z A;  4HA7 A;  2W3M A;  3KGY A;  1E26 A;  1PD9 A;  4M6K A;  3EEJ A;  1S3Y A;  4ELF A;  4ECK A;  2BLA A;  1VDR A;  3FQV A;  4X5F A;  3FL8 A;  3FRA X;  2XW7 A;  4LAG X;  3NXX A;  3SRQ X;  4NX6 A;  1RX1 A;  1DRH A;  3DAU A;  3FQC A;  5HVB A;  3JVX A;  4KFJ A;  4ELG A;  3EEK A;  3KJS A;  1JOM A;  4PDJ A;  1U70 A;  3K2H A;  1BZF A;  3IX9 A;  1RX9 A;  2JYB A;  3FL9 A;  4H96 A;  3SR5 X; 
#chains in the Genus database with same CATH topology
 3UM6 A;  4XE6 X;  1DG5 A;  5HQY A;  2P4G A;  5CCC A;  1DYJ A;  3NZC X;  3GHC A;  5U26 A;  2W3W A;  1DYH A;  3SGY A;  2L28 A;  7DFR A;  4KJL A;  4QI9 A;  2W3B A;  4M7V A;  2INQ A;  1M7A A;  6DFR A;  3FRF X;  3FRD X;  4KL9 A;  4XRB A;  1RX6 A;  3NXR A;  3IRM A;  3DL6 A;  2H2Q A;  3LG4 A;  3F0V X;  1DR4 A;  1S3V A;  4DFR A;  1RX5 A;  2GD9 A;  4H95 A;  3FS6 A;  3K45 A;  5CC9 A;  1MVS A;  4LEK X;  4CD2 A;  4XT6 A;  4P3Q A;  3IA5 A;  1RA3 A;  1DG7 A;  1S3W A;  3OCH A;  3DFR A;  3JWM A;  2D5N A;  4OR7 A;  5HT5 A;  1JUV A;  3IRN A;  4NX7 A;  3DG8 A;  4DPH A;  1DHI A;  4ELB A;  1DRA A;  1J3J A;  2CD2 A;  3QLS A;  3E0B A;  3QG2 A;  4KAK A;  5ECX A;  3IRO A;  1RE7 A;  3R33 A;  3NZA X;  4QLE A;  3GYF A;  5HT4 A;  3NZD A;  4G95 A;  3JWC A;  4PSS A;  4KJJ A;  2W3A A;  1AO8 A;  2DHF A;  4HOG A;  4M6J A;  1DYI A;  1D1G A;  3SA2 A;  3ZPC A;  4P3R A;  3EIG A;  3DAT A;  4ELH A;  1TDR A;  3QLW A;  5DFR A;  3TQA A;  3TQ8 A;  3JW3 A;  1MVT A;  4QJC A;  4PTH A;  3F0U X;  1KMV A;  4I1N A;  1S3U A;  3TD8 A;  2W9H A;  2FZH A;  3UM5 A;  1LY3 A;  4DP3 A;  3F8Y A;  3GI2 A;  3QYO A;  1DIS A;  4Q67 A;  4TU5 X;  3EEL A;  3CL9 A;  3F0S X;  3QLX A;  3M09 A;  4QLF A;  4G8Z X;  1DR3 A;  4EIZ A;  8DFR A;  4HOE A;  3K47 A;  1RA1 A;  1AI9 A;  1DDR A;  5U27 A;  3K74 A;  1RB3 A;  1DLR A;  4FHB A;  4KM0 A;  4PTJ A;  1DIU A;  1OHK A;  4EJ1 A;  4XT8 A;  4Q0E A;  3QLR A;  3F0Q X;  2HXV A;  2ZZA A;  2W9T A;  1M79 A;  4X5H A;  3FQO A;  5JG0 X;  4DPD A;  2FZJ A;  2DRC A;  3QLY A;  3EEM A;  4H97 A;  2B3Z A;  4IXF X;  1DRE A;  1IA4 A;  3S7A A;  3NXO A;  1DYR A;  3NZB X;  2FZI A;  1PD8 A;  3FRB X;  4GH8 A;  4Q6A A;  3F91 A;  1HFP A;  3NZ6 X;  3VCO A;  3F0X X;  3JWF A;  4KBN A;  3KJR A;  5EAJ A;  1DLS A;  1IA3 A;  4DDR A;  1RA9 A;  2ITH A;  4KEB A;  4EIG A;  5E8Q A;  1BOZ A;  1RH3 A;  4KD7 A;  5HQZ A;  3QFX A;  1DG8 A;  2OIP A;  2BL9 A;  2D0K A;  1DR2 A;  3NTZ A;  3D80 A;  4EIL A;  4KJK A;  2KGK A;  3DGA A;  3OAF A;  4P68 A;  4P66 A;  2CIG A;  3JTW A;  4QLG A;  3QGT A;  1DDS A;  3SRS X;  3KY8 A;  3N0H A;  5HF2 X;  2BLB A;  3FY8 X;  3SRW X;  1DHF A;  4XT5 A;  4RGC A;  3UM8 A;  1OHJ A;  3KFY A;  1RF7 A;  2W9G A;  2QK8 A;  3ROA A;  3JWK A;  1RA2 A;  4XT4 A;  4M7U A;  1U71 A;  5ECC A;  1KMS A;  3QL3 A;  1RG7 A;  2LF1 A;  3SRU X;  4KY8 A;  4Q0D A;  3FRE X;  3Q1H A;  4M2X A;  4M6L A;  3FQ0 A;  3TQ9 A;  4XT7 A;  5FDA A;  4ELE A;  4PSY A;  1RC4 A;  3HJ3 A;  2O7P A;  1RX2 A;  3ZPG A;  1YHO A;  4FGH A;  5HSU A;  2HQP A;  4X5J A;  4HOF A;  3HBB A;  1J3I A;  3SAI A;  3SH2 A;  2C2T A;  1DR7 A;  4KYA A;  1LY4 A;  3FY9 X;  2ANO A;  1IA2 A;  3QYL A;  1QZF A;  2W9S A;  2ANQ A;  3GHW A;  4OSG A;  1DR5 A;  4PST A;  1RD7 A;  1LUD A;  3SA1 A;  3QL0 A;  2C2S A;  3L3R A;  4KY4 A;  3CSE A;  3IA4 A;  3NU0 A;  1PDB A;  3I8A X;  4HA9 A;  3QLZ A;  3SQY X;  4H98 A;  4LAH X;  3NXV A;  5HI6 A;  1HFR A;  3RG9 A;  3FYV X;  5HSR A;  4KNE A;  1JOL A;  1SEJ A;  4I13 A;  4FGG A;  3I3R A;  3GHV A;  3NXT A;  1J3K A;  3TQB A;  1RX4 A;  3JW5 A;  3FQF A;  3JSU A;  1DRF A;  1DR1 A;  3M08 A;  5HUI A;  3FYW X;  1ZDR A;  3S3V A;  5DXV A;  5HVE A;  4IXG X;  2AZN A;  1DF7 A;  1M78 A;  2W3V A;  3EX8 A;  1RX8 A;  3CLB A;  1KLK A;  1VJ3 A;  3NXY A;  3CD2 A;  3DL5 A;  4LAE X;  1DR6 A;  1RX3 A;  2BLC A;  1CZ3 A;  1AOE A;  3D84 X;  4QJZ D;  1RX7 A;  2HM9 A;  2G6V A;  1RB2 A;  4QHV A;  4IXE D;  4XEC X;  3DRC A;  3S9U A;  4X5I A;  5JA3 A;  1RA8 A;  4X5G A;  3NRR A;  3F0B X;  1DAJ A;  3SRR X;  4G3M A;  4KLX A;  2OBC A;  1DRB A;  1DHJ A;  5HF0 X;  3FQZ A;  1HFQ A;  5HPB A;  4KM2 A;  3NZ9 X;  1IA1 A;  1U72 A;  1CD2 A;  3INV A;  3RO9 A;  3F8Z A;  4HA7 A;  2W3M A;  3KGY A;  1E26 A;  1PD9 A;  4M6K A;  3EEJ A;  1S3Y A;  4ELF A;  4ECK A;  2BLA A;  1VDR A;  3FQV A;  4X5F A;  3FL8 A;  3FRA X;  2XW7 A;  4LAG X;  3NXX A;  3SRQ X;  4NX6 A;  1RX1 A;  1DRH A;  3DAU A;  3FQC A;  5HVB A;  3JVX A;  4KFJ A;  4ELG A;  3EEK A;  3KJS A;  1JOM A;  4PDJ A;  1U70 A;  3K2H A;  1BZF A;  3IX9 A;  1RX9 A;  2JYB A;  3FL9 A;  4H96 A;  3SR5 X; 
#chains in the Genus database with same CATH homology
 3UM6 A;  4XE6 X;  1DG5 A;  5HQY A;  2P4G A;  5CCC A;  1DYJ A;  3NZC X;  3GHC A;  5U26 A;  2W3W A;  1DYH A;  3SGY A;  2L28 A;  7DFR A;  4KJL A;  4QI9 A;  2W3B A;  4M7V A;  2INQ A;  1M7A A;  6DFR A;  3FRF X;  3FRD X;  4KL9 A;  4XRB A;  1RX6 A;  3NXR A;  3IRM A;  3DL6 A;  2H2Q A;  3LG4 A;  3F0V X;  1DR4 A;  1S3V A;  4DFR A;  1RX5 A;  2GD9 A;  4H95 A;  3FS6 A;  3K45 A;  5CC9 A;  1MVS A;  4LEK X;  4CD2 A;  4XT6 A;  4P3Q A;  3IA5 A;  1RA3 A;  1DG7 A;  1S3W A;  3OCH A;  3DFR A;  3JWM A;  2D5N A;  4OR7 A;  5HT5 A;  1JUV A;  3IRN A;  4NX7 A;  3DG8 A;  4DPH A;  1DHI A;  4ELB A;  1DRA A;  1J3J A;  2CD2 A;  3QLS A;  3E0B A;  3QG2 A;  4KAK A;  5ECX A;  3IRO A;  1RE7 A;  3R33 A;  3NZA X;  4QLE A;  3GYF A;  5HT4 A;  3NZD A;  4G95 A;  3JWC A;  4PSS A;  4KJJ A;  2W3A A;  1AO8 A;  2DHF A;  4HOG A;  4M6J A;  1DYI A;  1D1G A;  3SA2 A;  3ZPC A;  4P3R A;  3EIG A;  3DAT A;  4ELH A;  1TDR A;  3QLW A;  5DFR A;  3TQA A;  3TQ8 A;  3JW3 A;  1MVT A;  4QJC A;  4PTH A;  3F0U X;  1KMV A;  4I1N A;  1S3U A;  3TD8 A;  2W9H A;  2FZH A;  3UM5 A;  1LY3 A;  4DP3 A;  3F8Y A;  3GI2 A;  3QYO A;  1DIS A;  4Q67 A;  4TU5 X;  3EEL A;  3CL9 A;  3F0S X;  3QLX A;  3M09 A;  4QLF A;  4G8Z X;  1DR3 A;  4EIZ A;  8DFR A;  4HOE A;  3K47 A;  1RA1 A;  1AI9 A;  1DDR A;  5U27 A;  3K74 A;  1RB3 A;  1DLR A;  4FHB A;  4KM0 A;  4PTJ A;  1DIU A;  1OHK A;  4EJ1 A;  4XT8 A;  4Q0E A;  3QLR A;  3F0Q X;  2HXV A;  2ZZA A;  2W9T A;  1M79 A;  4X5H A;  3FQO A;  5JG0 X;  4DPD A;  2FZJ A;  2DRC A;  3QLY A;  3EEM A;  4H97 A;  2B3Z A;  4IXF X;  1DRE A;  1IA4 A;  3S7A A;  3NXO A;  1DYR A;  3NZB X;  2FZI A;  1PD8 A;  3FRB X;  4GH8 A;  4Q6A A;  3F91 A;  1HFP A;  3NZ6 X;  3VCO A;  3F0X X;  3JWF A;  4KBN A;  3KJR A;  5EAJ A;  1DLS A;  1IA3 A;  4DDR A;  1RA9 A;  2ITH A;  4KEB A;  4EIG A;  5E8Q A;  1BOZ A;  1RH3 A;  4KD7 A;  5HQZ A;  3QFX A;  1DG8 A;  2OIP A;  2BL9 A;  2D0K A;  1DR2 A;  3NTZ A;  3D80 A;  4EIL A;  4KJK A;  2KGK A;  3DGA A;  3OAF A;  4P68 A;  4P66 A;  2CIG A;  3JTW A;  4QLG A;  3QGT A;  1DDS A;  3SRS X;  3KY8 A;  3N0H A;  5HF2 X;  2BLB A;  3FY8 X;  3SRW X;  1DHF A;  4XT5 A;  4RGC A;  3UM8 A;  1OHJ A;  3KFY A;  1RF7 A;  2W9G A;  2QK8 A;  3ROA A;  3JWK A;  1RA2 A;  4XT4 A;  4M7U A;  1U71 A;  5ECC A;  1KMS A;  3QL3 A;  1RG7 A;  2LF1 A;  3SRU X;  4KY8 A;  4Q0D A;  3FRE X;  3Q1H A;  4M2X A;  4M6L A;  3FQ0 A;  3TQ9 A;  4XT7 A;  5FDA A;  4ELE A;  4PSY A;  1RC4 A;  3HJ3 A;  2O7P A;  1RX2 A;  3ZPG A;  1YHO A;  4FGH A;  5HSU A;  2HQP A;  4X5J A;  4HOF A;  3HBB A;  1J3I A;  3SAI A;  3SH2 A;  2C2T A;  1DR7 A;  4KYA A;  1LY4 A;  3FY9 X;  2ANO A;  1IA2 A;  3QYL A;  1QZF A;  2W9S A;  2ANQ A;  3GHW A;  4OSG A;  1DR5 A;  4PST A;  1RD7 A;  1LUD A;  3SA1 A;  3QL0 A;  2C2S A;  3L3R A;  4KY4 A;  3CSE A;  3IA4 A;  3NU0 A;  1PDB A;  3I8A X;  4HA9 A;  3QLZ A;  3SQY X;  4H98 A;  4LAH X;  3NXV A;  5HI6 A;  1HFR A;  3RG9 A;  3FYV X;  5HSR A;  4KNE A;  1JOL A;  1SEJ A;  4I13 A;  4FGG A;  3I3R A;  3GHV A;  3NXT A;  1J3K A;  3TQB A;  1RX4 A;  3JW5 A;  3FQF A;  3JSU A;  1DRF A;  1DR1 A;  3M08 A;  5HUI A;  3FYW X;  1ZDR A;  3S3V A;  5DXV A;  5HVE A;  4IXG X;  2AZN A;  1DF7 A;  1M78 A;  2W3V A;  3EX8 A;  1RX8 A;  3CLB A;  1KLK A;  1VJ3 A;  3NXY A;  3CD2 A;  3DL5 A;  4LAE X;  1DR6 A;  1RX3 A;  2BLC A;  1CZ3 A;  1AOE A;  3D84 X;  4QJZ D;  1RX7 A;  2HM9 A;  2G6V A;  1RB2 A;  4QHV A;  4IXE D;  4XEC X;  3DRC A;  3S9U A;  4X5I A;  5JA3 A;  1RA8 A;  4X5G A;  3NRR A;  3F0B X;  1DAJ A;  3SRR X;  4G3M A;  4KLX A;  2OBC A;  1DRB A;  1DHJ A;  5HF0 X;  3FQZ A;  1HFQ A;  5HPB A;  4KM2 A;  3NZ9 X;  1IA1 A;  1U72 A;  1CD2 A;  3INV A;  3RO9 A;  3F8Z A;  4HA7 A;  2W3M A;  3KGY A;  1E26 A;  1PD9 A;  4M6K A;  3EEJ A;  1S3Y A;  4ELF A;  4ECK A;  2BLA A;  1VDR A;  3FQV A;  4X5F A;  3FL8 A;  3FRA X;  2XW7 A;  4LAG X;  3NXX A;  3SRQ X;  4NX6 A;  1RX1 A;  1DRH A;  3DAU A;  3FQC A;  5HVB A;  3JVX A;  4KFJ A;  4ELG A;  3EEK A;  3KJS A;  1JOM A;  4PDJ A;  1U70 A;  3K2H A;  1BZF A;  3IX9 A;  1RX9 A;  2JYB A;  3FL9 A;  4H96 A;  3SR5 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...