4KNZA

Thymidylate synthase ternary complex with dump and cb3717
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
263
structure length
263
Chain Sequence
KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate synthase
publication title Mg(2+) binds to the surface of thymidylate synthase and affects hydride transfer at the interior active site.
pubmed doi rcsb
source organism Escherichia coli
total genus 80
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4knzA00
4KPWA 4JEFA 1HZWA 2VF0A 1TDBA 3HJ3A 3IRNA 4H1IA 1DDUA 3H9KA 4FGTA 1JTQA 1NJEA 3EBUA 1BSPA 3B9HA 4EZ8A 2TSCA 3BZ0A 3EGYX 1EVGA 1BKOA 4O1XD 3B5BA 1FWMA 2OIPA 4KY8A 4E5OA 3EHIX 1BP6A 3KJRA 2G8AA 4DP3A 2VETA 1NJAA 3BGXA 3BNZA 3UWLA 1JG0A 4XSDA 1BO8A 3I3RA 3IRMA 4GD7A 1AXWA 3IROA 4Q0DA 4O1XA 3DL5A 5FCTA 3EF9A 1JUTA 4FQSA 1BKPA 1JMHA 1JTUA 5H3AA 1NCEA 1BP0A 4DQ1A 1HW3A 1F28A 1TSDA 3GH0A 2G8DA 3HBBA 1SEJA 2ONBA 1BDUA 2RD8A 3HB8A 1YPVA 4IQBA 4ECKA 2G8XA 2KCEA 2A9WA 2H2QA 1EVFA 4PSGA 4FOGA 4ISWA 2RDAA 1BQ2A 1HVYA 1THYA 4UP1A 3QJ7A 1TSLA 1TYSA 1NJCA 3QG2A 2FTQA 1I00A 1EV5A 3UWLB 1TLCA 3CLBA 1B5DA 4TMSA 3DL6A 2G86A 3NRRA 3C06A 5WRNA 1QQQA 2BBQA 1B49A 3KGBA 1F4BA 4O7UA 4DPHA 1JMGA 4O1UA 4EB4A 1B02A 4DPDA 4F2VA 1LCBA 1TDUA 4KNZA 2FTOX 1AN5A 1NJBA 1AJMA 1F4DA 1B5EA 1VZEA 1TSNA 3N5GA 4G6WX 3DG8C 2TDMA 2FTNA 3KJSA 4H0UA 1BSFA 1BJGA 1AOBA 1KZIA 3BYXA 3TMSA 1AIQA 3CL9A 2TDDA 4G2OX 3IX6A 2AAZA 1DNAA 1RTSA 4XSCA 1J3IC 3UM6A 1KZJA 3JSUA 4EINA 3IK0A 1TLSA 3INVA 1SYNA 3ED7A 3IJZA 3N5EA 1TVWA 4Q0EA 4KYAA 3GG5A 3EJLA 4IQQA 4GYHA 4FOAA 4KY4A 1JU6A 2RD8B 1F4GA 1CI7A 1TDAA 1JUJA 1VZBA 1TSXA 1F4CA 3IHIA 4GEVA 3BFIA 1TDCA 1BQ1A 3EAWX 1TSYA 3DGAC 3K2HA 1VZCA 1TSVA 3IK1A 4IRRA 3GH2X 1NJDA 4LRRA 1F4FA 1ZPRA 1TRGA 3UM8A 1TVVA 1TISA 2G89A 2TSRA 4E28A 4XSEA 5H39A 3BHLA 1LCAA 3EDWX 1BIDA 3N5EB 1VZAA 1TSMA 1VZDA 1TJSA 5H38A 1J3JC 4EILA 1EV8A 1TSZA 5HS3A 1JMIA 1TVUA 1QZFA 1LCEA 1BPJA 1F4EA 3C0AA 4ISKA 4FOXA 5J7WA 5BY6A 3UM5A 3QGTA 3V8HA 3BHRA 3OB7A 1JMFA 4H0RA 1BO7A 1TSWA 1HW4A 1FFLA 1J3KC 1KCEA
chains in the Genus database with same CATH superfamily
4KPWA 4JEFA 1HZWA 2VF0A 1TDBA 3HJ3A 3IRNA 4H1IA 1DDUA 3H9KA 4FGTA 1JTQA 1NJEA 3EBUA 1BSPA 3B9HA 4EZ8A 2TSCA 3BZ0A 3EGYX 1EVGA 1BKOA 4O1XD 3B5BA 1FWMA 2OIPA 4KY8A 4E5OA 3EHIX 1BP6A 3KJRA 2G8AA 4DP3A 2VETA 1NJAA 3BGXA 3BNZA 3UWLA 1JG0A 4XSDA 1BO8A 3I3RA 3IRMA 4GD7A 1AXWA 3IROA 4Q0DA 4O1XA 3DL5A 5FCTA 3EF9A 1JUTA 4FQSA 1BKPA 1JMHA 1JTUA 5H3AA 1NCEA 1BP0A 4DQ1A 1HW3A 1F28A 1TSDA 3GH0A 2G8DA 3HBBA 1SEJA 2ONBA 1BDUA 2RD8A 3HB8A 1YPVA 4IQBA 4ECKA 2G8XA 2KCEA 2A9WA 2H2QA 1EVFA 4PSGA 4FOGA 4ISWA 2RDAA 1BQ2A 1HVYA 1THYA 4UP1A 3QJ7A 1TSLA 1TYSA 1NJCA 3QG2A 2FTQA 1I00A 1EV5A 3UWLB 1TLCA 3CLBA 1B5DA 4TMSA 3DL6A 2G86A 3NRRA 3C06A 5WRNA 1QQQA 2BBQA 1B49A 3KGBA 1F4BA 4O7UA 4DPHA 1JMGA 4O1UA 4EB4A 1B02A 4DPDA 4F2VA 1LCBA 1TDUA 4KNZA 2FTOX 1AN5A 1NJBA 1AJMA 1F4DA 1B5EA 1VZEA 1TSNA 3N5GA 4G6WX 3DG8C 2TDMA 2FTNA 3KJSA 4H0UA 1BSFA 1BJGA 1AOBA 1KZIA 3BYXA 3TMSA 1AIQA 3CL9A 2TDDA 4G2OX 3IX6A 2AAZA 1DNAA 1RTSA 4XSCA 1J3IC 3UM6A 1KZJA 3JSUA 4EINA 3IK0A 1TLSA 3INVA 1SYNA 3ED7A 3IJZA 3N5EA 1TVWA 4Q0EA 4KYAA 3GG5A 3EJLA 4IQQA 4GYHA 4FOAA 4KY4A 1JU6A 2RD8B 1F4GA 1CI7A 1TDAA 1JUJA 1VZBA 1TSXA 1F4CA 3IHIA 4GEVA 3BFIA 1TDCA 1BQ1A 3EAWX 1TSYA 3DGAC 3K2HA 1VZCA 1TSVA 3IK1A 4IRRA 3GH2X 1NJDA 4LRRA 1F4FA 1ZPRA 1TRGA 3UM8A 1TVVA 1TISA 2G89A 2TSRA 4E28A 4XSEA 5H39A 3BHLA 1LCAA 3EDWX 1BIDA 3N5EB 1VZAA 1TSMA 1VZDA 1TJSA 5H38A 1J3JC 4EILA 1EV8A 1TSZA 5HS3A 1JMIA 1TVUA 1QZFA 1LCEA 1BPJA 1F4EA 3C0AA 4ISKA 4FOXA 5J7WA 5BY6A 3UM5A 3QGTA 3V8HA 3BHRA 3OB7A 1JMFA 4H0RA 1BO7A 1TSWA 1HW4A 1FFLA 1J3KC 1KCEA
chains in the Genus database with same CATH topology
4KPWA 4JEFA 1HZWA 2VF0A 1TDBA 3HJ3A 3IRNA 4H1IA 1DDUA 3H9KA 4FGTA 1JTQA 1NJEA 3EBUA 1BSPA 3B9HA 4EZ8A 2TSCA 3BZ0A 3EGYX 1EVGA 1BKOA 4O1XD 3B5BA 1FWMA 2OIPA 4KY8A 4E5OA 3EHIX 1BP6A 3KJRA 2G8AA 4DP3A 2VETA 1NJAA 3BGXA 3BNZA 3UWLA 1JG0A 4XSDA 1BO8A 3I3RA 3IRMA 4GD7A 1AXWA 3IROA 4Q0DA 4O1XA 3DL5A 5FCTA 3EF9A 1JUTA 4FQSA 1BKPA 1JMHA 1JTUA 5H3AA 1NCEA 1BP0A 4DQ1A 1HW3A 1F28A 1TSDA 3GH0A 2G8DA 3HBBA 1SEJA 2ONBA 1BDUA 2RD8A 3HB8A 1YPVA 4IQBA 4ECKA 2G8XA 2KCEA 2A9WA 2H2QA 1EVFA 4PSGA 4FOGA 4ISWA 2RDAA 1BQ2A 1HVYA 1THYA 4UP1A 3QJ7A 1TSLA 1TYSA 1NJCA 3QG2A 2FTQA 1I00A 1EV5A 3UWLB 1TLCA 3CLBA 1B5DA 4TMSA 3DL6A 2G86A 3NRRA 3C06A 5WRNA 1QQQA 2BBQA 1B49A 3KGBA 1F4BA 4O7UA 4DPHA 1JMGA 4O1UA 4EB4A 1B02A 4DPDA 4F2VA 1LCBA 1TDUA 4KNZA 2FTOX 1AN5A 1NJBA 1AJMA 1F4DA 1B5EA 1VZEA 1TSNA 3N5GA 4G6WX 3DG8C 2TDMA 2FTNA 3KJSA 4H0UA 1BSFA 1BJGA 1AOBA 1KZIA 3BYXA 3TMSA 1AIQA 3CL9A 2TDDA 4G2OX 3IX6A 2AAZA 1DNAA 1RTSA 4XSCA 1J3IC 3UM6A 1KZJA 3JSUA 4EINA 3IK0A 1TLSA 3INVA 1SYNA 3ED7A 3IJZA 3N5EA 1TVWA 4Q0EA 4KYAA 3GG5A 3EJLA 4IQQA 4GYHA 4FOAA 4KY4A 1JU6A 2RD8B 1F4GA 1CI7A 1TDAA 1JUJA 1VZBA 1TSXA 1F4CA 3IHIA 4GEVA 3BFIA 1TDCA 1BQ1A 3EAWX 1TSYA 3DGAC 3K2HA 1VZCA 1TSVA 3IK1A 4IRRA 3GH2X 1NJDA 4LRRA 1F4FA 1ZPRA 1TRGA 3UM8A 1TVVA 1TISA 2G89A 2TSRA 4E28A 4XSEA 5H39A 3BHLA 1LCAA 3EDWX 1BIDA 3N5EB 1VZAA 1TSMA 1VZDA 1TJSA 5H38A 1J3JC 4EILA 1EV8A 1TSZA 5HS3A 1JMIA 1TVUA 1QZFA 1LCEA 1BPJA 1F4EA 3C0AA 4ISKA 4FOXA 5J7WA 5BY6A 3UM5A 3QGTA 3V8HA 3BHRA 3OB7A 1JMFA 4H0RA 1BO7A 1TSWA 1HW4A 1FFLA 1J3KC 1KCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KPW A;  4JEF A;  1HZW A;  2VF0 A;  1TDB A;  3HJ3 A;  3IRN A;  4H1I A;  1DDU A;  3H9K A;  4FGT A;  1JTQ A;  1NJE A;  3EBU A;  1BSP A;  3B9H A;  4EZ8 A;  2TSC A;  3BZ0 A;  3EGY X;  1EVG A;  1BKO A;  4O1X D;  3B5B A;  1FWM A;  2OIP A;  4KY8 A;  4E5O A;  3EHI X;  1BP6 A;  3KJR A;  2G8A A;  4DP3 A;  2VET A;  1NJA A;  3BGX A;  3BNZ A;  3UWL A;  1JG0 A;  4XSD A;  1BO8 A;  3I3R A;  3IRM A;  4GD7 A;  1AXW A;  3IRO A;  4Q0D A;  4O1X A;  3DL5 A;  5FCT A;  3EF9 A;  1JUT A;  4FQS A;  1BKP A;  1JMH A;  1JTU A;  5H3A A;  1NCE A;  1BP0 A;  4DQ1 A;  1HW3 A;  1F28 A;  1TSD A;  3GH0 A;  2G8D A;  3HBB A;  1SEJ A;  2ONB A;  1BDU A;  2RD8 A;  3HB8 A;  1YPV A;  4IQB A;  4ECK A;  2G8X A;  2KCE A;  2A9W A;  2H2Q A;  1EVF A;  4PSG A;  4FOG A;  4ISW A;  2RDA A;  1BQ2 A;  1HVY A;  1THY A;  4UP1 A;  3QJ7 A;  1TSL A;  1TYS A;  1NJC A;  3QG2 A;  2FTQ A;  1I00 A;  1EV5 A;  3UWL B;  1TLC A;  3CLB A;  1B5D A;  4TMS A;  3DL6 A;  2G86 A;  3NRR A;  3C06 A;  5WRN A;  1QQQ A;  2BBQ A;  1B49 A;  3KGB A;  1F4B A;  4O7U A;  4DPH A;  1JMG A;  4O1U A;  4EB4 A;  1B02 A;  4DPD A;  4F2V A;  1LCB A;  1TDU A;  4KNZ A;  2FTO X;  1AN5 A;  1NJB A;  1AJM A;  1F4D A;  1B5E A;  1VZE A;  1TSN A;  3N5G A;  4G6W X;  3DG8 C;  2TDM A;  2FTN A;  3KJS A;  4H0U A;  1BSF A;  1BJG A;  1AOB A;  1KZI A;  3BYX A;  3TMS A;  1AIQ A;  3CL9 A;  2TDD A;  4G2O X;  3IX6 A;  2AAZ A;  1DNA A;  1RTS A;  4XSC A;  1J3I C;  3UM6 A;  1KZJ A;  3JSU A;  4EIN A;  3IK0 A;  1TLS A;  3INV A;  1SYN A;  3ED7 A;  3IJZ A;  3N5E A;  1TVW A;  4Q0E A;  4KYA A;  3GG5 A;  3EJL A;  4IQQ A;  4GYH A;  4FOA A;  4KY4 A;  1JU6 A;  2RD8 B;  1F4G A;  1CI7 A;  1TDA A;  1JUJ A;  1VZB A;  1TSX A;  1F4C A;  3IHI A;  4GEV A;  3BFI A;  1TDC A;  1BQ1 A;  3EAW X;  1TSY A;  3DGA C;  3K2H A;  1VZC A;  1TSV A;  3IK1 A;  4IRR A;  3GH2 X;  1NJD A;  4LRR A;  1F4F A;  1ZPR A;  1TRG A;  3UM8 A;  1TVV A;  1TIS A;  2G89 A;  2TSR A;  4E28 A;  4XSE A;  5H39 A;  3BHL A;  1LCA A;  3EDW X;  1BID A;  3N5E B;  1VZA A;  1TSM A;  1VZD A;  1TJS A;  5H38 A;  1J3J C;  4EIL A;  1EV8 A;  1TSZ A;  5HS3 A;  1JMI A;  1TVU A;  1QZF A;  1LCE A;  1BPJ A;  1F4E A;  3C0A A;  4ISK A;  4FOX A;  5J7W A;  5BY6 A;  3UM5 A;  3QGT A;  3V8H A;  3BHR A;  3OB7 A;  1JMF A;  4H0R A;  1BO7 A;  1TSW A;  1HW4 A;  1FFL A;  1J3K C;  1KCE A; 
#chains in the Genus database with same CATH topology
 4KPW A;  4JEF A;  1HZW A;  2VF0 A;  1TDB A;  3HJ3 A;  3IRN A;  4H1I A;  1DDU A;  3H9K A;  4FGT A;  1JTQ A;  1NJE A;  3EBU A;  1BSP A;  3B9H A;  4EZ8 A;  2TSC A;  3BZ0 A;  3EGY X;  1EVG A;  1BKO A;  4O1X D;  3B5B A;  1FWM A;  2OIP A;  4KY8 A;  4E5O A;  3EHI X;  1BP6 A;  3KJR A;  2G8A A;  4DP3 A;  2VET A;  1NJA A;  3BGX A;  3BNZ A;  3UWL A;  1JG0 A;  4XSD A;  1BO8 A;  3I3R A;  3IRM A;  4GD7 A;  1AXW A;  3IRO A;  4Q0D A;  4O1X A;  3DL5 A;  5FCT A;  3EF9 A;  1JUT A;  4FQS A;  1BKP A;  1JMH A;  1JTU A;  5H3A A;  1NCE A;  1BP0 A;  4DQ1 A;  1HW3 A;  1F28 A;  1TSD A;  3GH0 A;  2G8D A;  3HBB A;  1SEJ A;  2ONB A;  1BDU A;  2RD8 A;  3HB8 A;  1YPV A;  4IQB A;  4ECK A;  2G8X A;  2KCE A;  2A9W A;  2H2Q A;  1EVF A;  4PSG A;  4FOG A;  4ISW A;  2RDA A;  1BQ2 A;  1HVY A;  1THY A;  4UP1 A;  3QJ7 A;  1TSL A;  1TYS A;  1NJC A;  3QG2 A;  2FTQ A;  1I00 A;  1EV5 A;  3UWL B;  1TLC A;  3CLB A;  1B5D A;  4TMS A;  3DL6 A;  2G86 A;  3NRR A;  3C06 A;  5WRN A;  1QQQ A;  2BBQ A;  1B49 A;  3KGB A;  1F4B A;  4O7U A;  4DPH A;  1JMG A;  4O1U A;  4EB4 A;  1B02 A;  4DPD A;  4F2V A;  1LCB A;  1TDU A;  4KNZ A;  2FTO X;  1AN5 A;  1NJB A;  1AJM A;  1F4D A;  1B5E A;  1VZE A;  1TSN A;  3N5G A;  4G6W X;  3DG8 C;  2TDM A;  2FTN A;  3KJS A;  4H0U A;  1BSF A;  1BJG A;  1AOB A;  1KZI A;  3BYX A;  3TMS A;  1AIQ A;  3CL9 A;  2TDD A;  4G2O X;  3IX6 A;  2AAZ A;  1DNA A;  1RTS A;  4XSC A;  1J3I C;  3UM6 A;  1KZJ A;  3JSU A;  4EIN A;  3IK0 A;  1TLS A;  3INV A;  1SYN A;  3ED7 A;  3IJZ A;  3N5E A;  1TVW A;  4Q0E A;  4KYA A;  3GG5 A;  3EJL A;  4IQQ A;  4GYH A;  4FOA A;  4KY4 A;  1JU6 A;  2RD8 B;  1F4G A;  1CI7 A;  1TDA A;  1JUJ A;  1VZB A;  1TSX A;  1F4C A;  3IHI A;  4GEV A;  3BFI A;  1TDC A;  1BQ1 A;  3EAW X;  1TSY A;  3DGA C;  3K2H A;  1VZC A;  1TSV A;  3IK1 A;  4IRR A;  3GH2 X;  1NJD A;  4LRR A;  1F4F A;  1ZPR A;  1TRG A;  3UM8 A;  1TVV A;  1TIS A;  2G89 A;  2TSR A;  4E28 A;  4XSE A;  5H39 A;  3BHL A;  1LCA A;  3EDW X;  1BID A;  3N5E B;  1VZA A;  1TSM A;  1VZD A;  1TJS A;  5H38 A;  1J3J C;  4EIL A;  1EV8 A;  1TSZ A;  5HS3 A;  1JMI A;  1TVU A;  1QZF A;  1LCE A;  1BPJ A;  1F4E A;  3C0A A;  4ISK A;  4FOX A;  5J7W A;  5BY6 A;  3UM5 A;  3QGT A;  3V8H A;  3BHR A;  3OB7 A;  1JMF A;  4H0R A;  1BO7 A;  1TSW A;  1HW4 A;  1FFL A;  1J3K C;  1KCE A; 
#chains in the Genus database with same CATH homology
 4KPW A;  4JEF A;  1HZW A;  2VF0 A;  1TDB A;  3HJ3 A;  3IRN A;  4H1I A;  1DDU A;  3H9K A;  4FGT A;  1JTQ A;  1NJE A;  3EBU A;  1BSP A;  3B9H A;  4EZ8 A;  2TSC A;  3BZ0 A;  3EGY X;  1EVG A;  1BKO A;  4O1X D;  3B5B A;  1FWM A;  2OIP A;  4KY8 A;  4E5O A;  3EHI X;  1BP6 A;  3KJR A;  2G8A A;  4DP3 A;  2VET A;  1NJA A;  3BGX A;  3BNZ A;  3UWL A;  1JG0 A;  4XSD A;  1BO8 A;  3I3R A;  3IRM A;  4GD7 A;  1AXW A;  3IRO A;  4Q0D A;  4O1X A;  3DL5 A;  5FCT A;  3EF9 A;  1JUT A;  4FQS A;  1BKP A;  1JMH A;  1JTU A;  5H3A A;  1NCE A;  1BP0 A;  4DQ1 A;  1HW3 A;  1F28 A;  1TSD A;  3GH0 A;  2G8D A;  3HBB A;  1SEJ A;  2ONB A;  1BDU A;  2RD8 A;  3HB8 A;  1YPV A;  4IQB A;  4ECK A;  2G8X A;  2KCE A;  2A9W A;  2H2Q A;  1EVF A;  4PSG A;  4FOG A;  4ISW A;  2RDA A;  1BQ2 A;  1HVY A;  1THY A;  4UP1 A;  3QJ7 A;  1TSL A;  1TYS A;  1NJC A;  3QG2 A;  2FTQ A;  1I00 A;  1EV5 A;  3UWL B;  1TLC A;  3CLB A;  1B5D A;  4TMS A;  3DL6 A;  2G86 A;  3NRR A;  3C06 A;  5WRN A;  1QQQ A;  2BBQ A;  1B49 A;  3KGB A;  1F4B A;  4O7U A;  4DPH A;  1JMG A;  4O1U A;  4EB4 A;  1B02 A;  4DPD A;  4F2V A;  1LCB A;  1TDU A;  4KNZ A;  2FTO X;  1AN5 A;  1NJB A;  1AJM A;  1F4D A;  1B5E A;  1VZE A;  1TSN A;  3N5G A;  4G6W X;  3DG8 C;  2TDM A;  2FTN A;  3KJS A;  4H0U A;  1BSF A;  1BJG A;  1AOB A;  1KZI A;  3BYX A;  3TMS A;  1AIQ A;  3CL9 A;  2TDD A;  4G2O X;  3IX6 A;  2AAZ A;  1DNA A;  1RTS A;  4XSC A;  1J3I C;  3UM6 A;  1KZJ A;  3JSU A;  4EIN A;  3IK0 A;  1TLS A;  3INV A;  1SYN A;  3ED7 A;  3IJZ A;  3N5E A;  1TVW A;  4Q0E A;  4KYA A;  3GG5 A;  3EJL A;  4IQQ A;  4GYH A;  4FOA A;  4KY4 A;  1JU6 A;  2RD8 B;  1F4G A;  1CI7 A;  1TDA A;  1JUJ A;  1VZB A;  1TSX A;  1F4C A;  3IHI A;  4GEV A;  3BFI A;  1TDC A;  1BQ1 A;  3EAW X;  1TSY A;  3DGA C;  3K2H A;  1VZC A;  1TSV A;  3IK1 A;  4IRR A;  3GH2 X;  1NJD A;  4LRR A;  1F4F A;  1ZPR A;  1TRG A;  3UM8 A;  1TVV A;  1TIS A;  2G89 A;  2TSR A;  4E28 A;  4XSE A;  5H39 A;  3BHL A;  1LCA A;  3EDW X;  1BID A;  3N5E B;  1VZA A;  1TSM A;  1VZD A;  1TJS A;  5H38 A;  1J3J C;  4EIL A;  1EV8 A;  1TSZ A;  5HS3 A;  1JMI A;  1TVU A;  1QZF A;  1LCE A;  1BPJ A;  1F4E A;  3C0A A;  4ISK A;  4FOX A;  5J7W A;  5BY6 A;  3UM5 A;  3QGT A;  3V8H A;  3BHR A;  3OB7 A;  1JMF A;  4H0R A;  1BO7 A;  1TSW A;  1HW4 A;  1FFL A;  1J3K C;  1KCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...