4UP1A

Crystal structure of native human thymidylate synthase in active form
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
283
structure length
283
Chain Sequence
PPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THYMIDYLATE SYNTHASE
publication title Crystal structure of the active form of native human thymidylate synthase in the absence of bound substrates.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2014-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 4up1A00
4UP1A 4JEFA 3K2HA 4H0UA 1F4BA 3ED7A 1KZIA 3B9HA 1TRGA 3KJSA 1JU6A 1EVFA 3DG8C 4IQQA 3UM6A 1EV5A 4DQ1A 3UM8A 2G86A 4FOAA 1AXWA 1B02A 1F4GA 2G89A 5HS3A 1BDUA 4KNZA 1JTQA 4FQSA 4Q0DA 1JMHA 4O1XD 1F4DA 1AJMA 2KCEA 1TDUA 2TSRA 4IQBA 3BGXA 1B49A 4IRRA 1ZPRA 1SYNA 2OIPA 1TSNA 1TVWA 1KZJA 3DL5A 1LCAA 1J3JC 2RD8B 3UWLB 1JMGA 1AIQA 2FTNA 4EZ8A 3C06A 4F2VA 3EAWX 4GYHA 4O1UA 3N5EA 4KY4A 4KPWA 1BPJA 3H9KA 4PSGA 3TMSA 3IROA 3QG2A 1NCEA 4G2OX 3V8HA 3UM5A 3IX6A 3IK1A 4FOGA 3EBUA 4LRRA 2G8AA 3CLBA 1F4FA 2ONBA 4E28A 1EVGA 4GEVA 2AAZA 1RTSA 3OB7A 1NJCA 4DPDA 1KCEA 1AOBA 2H2QA 1BSFA 1BJGA 1J3KC 1BIDA 3HJ3A 5WRNA 3GH2X 4KYAA 1TSMA 1NJDA 1TJSA 3NRRA 3QJ7A 1F4EA 3BYXA 3EJLA 2RDAA 2RD8A 1TSYA 5J7WA 3UWLA 5BY6A 3B5BA 1TLCA 3JSUA 3EHIX 3CL9A 3IRNA 1VZDA 4O1XA 4O7UA 1FWMA 1NJBA 1QQQA 1VZCA 3GG5A 1DDUA 1TDAA 1DNAA 1TYSA 4EINA 4TMSA 1TSDA 3BFIA 3INVA 1JTUA 2G8DA 3QGTA 1HZWA 3GH0A 3BNZA 1BO8A 1J3IC 3BHLA 4G6WX 3HB8A 2G8XA 4ECKA 1VZBA 4GD7A 3IRMA 1LCBA 3IHIA 1AN5A 1JMIA 3DGAC 3EF9A 4DP3A 1BO7A 1BQ1A 1NJEA 2A9WA 1EV8A 1NJAA 2VETA 4KY8A 3HBBA 4DPHA 1YPVA 1BQ2A 1QZFA 1TDCA 1SEJA 1B5EA 1BP6A 3C0AA 1CI7A 1HW4A 1TSZA 4XSCA 3BZ0A 1TSWA 3KGBA 4E5OA 1TSXA 3DL6A 4H1IA 1TSLA 1LCEA 5FCTA 4EB4A 1TISA 1JG0A 3KJRA 5H3AA 1FFLA 1JMFA 1JUTA 3EGYX 3IJZA 1VZEA 1F28A 2FTQA 4Q0EA 4XSEA 1TSVA 1TVVA 4FGTA 2TSCA 5H39A 1B5DA 1JUJA 1TDBA 1BSPA 2TDDA 4ISWA 1TLSA 2VF0A 1HW3A 1BKOA 4ISKA 2TDMA 1F4CA 1I00A 3EDWX 1TVUA 3BHRA 1HVYA 1VZAA 4H0RA 4FOXA 1BKPA 2BBQA 1BP0A 4XSDA 2FTOX 3N5GA 3I3RA 4EILA 3N5EB 1THYA 5H38A 3IK0A
chains in the Genus database with same CATH superfamily
4UP1A 4JEFA 3K2HA 4H0UA 1F4BA 3ED7A 1KZIA 3B9HA 1TRGA 3KJSA 1JU6A 1EVFA 3DG8C 4IQQA 3UM6A 1EV5A 4DQ1A 3UM8A 2G86A 4FOAA 1AXWA 1B02A 1F4GA 2G89A 5HS3A 1BDUA 4KNZA 1JTQA 4FQSA 4Q0DA 1JMHA 4O1XD 1F4DA 1AJMA 2KCEA 1TDUA 2TSRA 4IQBA 3BGXA 1B49A 4IRRA 1ZPRA 1SYNA 2OIPA 1TSNA 1TVWA 1KZJA 3DL5A 1LCAA 1J3JC 2RD8B 3UWLB 1JMGA 1AIQA 2FTNA 4EZ8A 3C06A 4F2VA 3EAWX 4GYHA 4O1UA 3N5EA 4KY4A 4KPWA 1BPJA 3H9KA 4PSGA 3TMSA 3IROA 3QG2A 1NCEA 4G2OX 3V8HA 3UM5A 3IX6A 3IK1A 4FOGA 3EBUA 4LRRA 2G8AA 3CLBA 1F4FA 2ONBA 4E28A 1EVGA 4GEVA 2AAZA 1RTSA 3OB7A 1NJCA 4DPDA 1KCEA 1AOBA 2H2QA 1BSFA 1BJGA 1J3KC 1BIDA 3HJ3A 5WRNA 3GH2X 4KYAA 1TSMA 1NJDA 1TJSA 3NRRA 3QJ7A 1F4EA 3BYXA 3EJLA 2RDAA 2RD8A 1TSYA 5J7WA 3UWLA 5BY6A 3B5BA 1TLCA 3JSUA 3EHIX 3CL9A 3IRNA 1VZDA 4O1XA 4O7UA 1FWMA 1NJBA 1QQQA 1VZCA 3GG5A 1DDUA 1TDAA 1DNAA 1TYSA 4EINA 4TMSA 1TSDA 3BFIA 3INVA 1JTUA 2G8DA 3QGTA 1HZWA 3GH0A 3BNZA 1BO8A 1J3IC 3BHLA 4G6WX 3HB8A 2G8XA 4ECKA 1VZBA 4GD7A 3IRMA 1LCBA 3IHIA 1AN5A 1JMIA 3DGAC 3EF9A 4DP3A 1BO7A 1BQ1A 1NJEA 2A9WA 1EV8A 1NJAA 2VETA 4KY8A 3HBBA 4DPHA 1YPVA 1BQ2A 1QZFA 1TDCA 1SEJA 1B5EA 1BP6A 3C0AA 1CI7A 1HW4A 1TSZA 4XSCA 3BZ0A 1TSWA 3KGBA 4E5OA 1TSXA 3DL6A 4H1IA 1TSLA 1LCEA 5FCTA 4EB4A 1TISA 1JG0A 3KJRA 5H3AA 1FFLA 1JMFA 1JUTA 3EGYX 3IJZA 1VZEA 1F28A 2FTQA 4Q0EA 4XSEA 1TSVA 1TVVA 4FGTA 2TSCA 5H39A 1B5DA 1JUJA 1TDBA 1BSPA 2TDDA 4ISWA 1TLSA 2VF0A 1HW3A 1BKOA 4ISKA 2TDMA 1F4CA 1I00A 3EDWX 1TVUA 3BHRA 1HVYA 1VZAA 4H0RA 4FOXA 1BKPA 2BBQA 1BP0A 4XSDA 2FTOX 3N5GA 3I3RA 4EILA 3N5EB 1THYA 5H38A 3IK0A
chains in the Genus database with same CATH topology
4UP1A 4JEFA 3K2HA 4H0UA 1F4BA 3ED7A 1KZIA 3B9HA 1TRGA 3KJSA 1JU6A 1EVFA 3DG8C 4IQQA 3UM6A 1EV5A 4DQ1A 3UM8A 2G86A 4FOAA 1AXWA 1B02A 1F4GA 2G89A 5HS3A 1BDUA 4KNZA 1JTQA 4FQSA 4Q0DA 1JMHA 4O1XD 1F4DA 1AJMA 2KCEA 1TDUA 2TSRA 4IQBA 3BGXA 1B49A 4IRRA 1ZPRA 1SYNA 2OIPA 1TSNA 1TVWA 1KZJA 3DL5A 1LCAA 1J3JC 2RD8B 3UWLB 1JMGA 1AIQA 2FTNA 4EZ8A 3C06A 4F2VA 3EAWX 4GYHA 4O1UA 3N5EA 4KY4A 4KPWA 1BPJA 3H9KA 4PSGA 3TMSA 3IROA 3QG2A 1NCEA 4G2OX 3V8HA 3UM5A 3IX6A 3IK1A 4FOGA 3EBUA 4LRRA 2G8AA 3CLBA 1F4FA 2ONBA 4E28A 1EVGA 4GEVA 2AAZA 1RTSA 3OB7A 1NJCA 4DPDA 1KCEA 1AOBA 2H2QA 1BSFA 1BJGA 1J3KC 1BIDA 3HJ3A 5WRNA 3GH2X 4KYAA 1TSMA 1NJDA 1TJSA 3NRRA 3QJ7A 1F4EA 3BYXA 3EJLA 2RDAA 2RD8A 1TSYA 5J7WA 3UWLA 5BY6A 3B5BA 1TLCA 3JSUA 3EHIX 3CL9A 3IRNA 1VZDA 4O1XA 4O7UA 1FWMA 1NJBA 1QQQA 1VZCA 3GG5A 1DDUA 1TDAA 1DNAA 1TYSA 4EINA 4TMSA 1TSDA 3BFIA 3INVA 1JTUA 2G8DA 3QGTA 1HZWA 3GH0A 3BNZA 1BO8A 1J3IC 3BHLA 4G6WX 3HB8A 2G8XA 4ECKA 1VZBA 4GD7A 3IRMA 1LCBA 3IHIA 1AN5A 1JMIA 3DGAC 3EF9A 4DP3A 1BO7A 1BQ1A 1NJEA 2A9WA 1EV8A 1NJAA 2VETA 4KY8A 3HBBA 4DPHA 1YPVA 1BQ2A 1QZFA 1TDCA 1SEJA 1B5EA 1BP6A 3C0AA 1CI7A 1HW4A 1TSZA 4XSCA 3BZ0A 1TSWA 3KGBA 4E5OA 1TSXA 3DL6A 4H1IA 1TSLA 1LCEA 5FCTA 4EB4A 1TISA 1JG0A 3KJRA 5H3AA 1FFLA 1JMFA 1JUTA 3EGYX 3IJZA 1VZEA 1F28A 2FTQA 4Q0EA 4XSEA 1TSVA 1TVVA 4FGTA 2TSCA 5H39A 1B5DA 1JUJA 1TDBA 1BSPA 2TDDA 4ISWA 1TLSA 2VF0A 1HW3A 1BKOA 4ISKA 2TDMA 1F4CA 1I00A 3EDWX 1TVUA 3BHRA 1HVYA 1VZAA 4H0RA 4FOXA 1BKPA 2BBQA 1BP0A 4XSDA 2FTOX 3N5GA 3I3RA 4EILA 3N5EB 1THYA 5H38A 3IK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UP1 A;  4JEF A;  3K2H A;  4H0U A;  1F4B A;  3ED7 A;  1KZI A;  3B9H A;  1TRG A;  3KJS A;  1JU6 A;  1EVF A;  3DG8 C;  4IQQ A;  3UM6 A;  1EV5 A;  4DQ1 A;  3UM8 A;  2G86 A;  4FOA A;  1AXW A;  1B02 A;  1F4G A;  2G89 A;  5HS3 A;  1BDU A;  4KNZ A;  1JTQ A;  4FQS A;  4Q0D A;  1JMH A;  4O1X D;  1F4D A;  1AJM A;  2KCE A;  1TDU A;  2TSR A;  4IQB A;  3BGX A;  1B49 A;  4IRR A;  1ZPR A;  1SYN A;  2OIP A;  1TSN A;  1TVW A;  1KZJ A;  3DL5 A;  1LCA A;  1J3J C;  2RD8 B;  3UWL B;  1JMG A;  1AIQ A;  2FTN A;  4EZ8 A;  3C06 A;  4F2V A;  3EAW X;  4GYH A;  4O1U A;  3N5E A;  4KY4 A;  4KPW A;  1BPJ A;  3H9K A;  4PSG A;  3TMS A;  3IRO A;  3QG2 A;  1NCE A;  4G2O X;  3V8H A;  3UM5 A;  3IX6 A;  3IK1 A;  4FOG A;  3EBU A;  4LRR A;  2G8A A;  3CLB A;  1F4F A;  2ONB A;  4E28 A;  1EVG A;  4GEV A;  2AAZ A;  1RTS A;  3OB7 A;  1NJC A;  4DPD A;  1KCE A;  1AOB A;  2H2Q A;  1BSF A;  1BJG A;  1J3K C;  1BID A;  3HJ3 A;  5WRN A;  3GH2 X;  4KYA A;  1TSM A;  1NJD A;  1TJS A;  3NRR A;  3QJ7 A;  1F4E A;  3BYX A;  3EJL A;  2RDA A;  2RD8 A;  1TSY A;  5J7W A;  3UWL A;  5BY6 A;  3B5B A;  1TLC A;  3JSU A;  3EHI X;  3CL9 A;  3IRN A;  1VZD A;  4O1X A;  4O7U A;  1FWM A;  1NJB A;  1QQQ A;  1VZC A;  3GG5 A;  1DDU A;  1TDA A;  1DNA A;  1TYS A;  4EIN A;  4TMS A;  1TSD A;  3BFI A;  3INV A;  1JTU A;  2G8D A;  3QGT A;  1HZW A;  3GH0 A;  3BNZ A;  1BO8 A;  1J3I C;  3BHL A;  4G6W X;  3HB8 A;  2G8X A;  4ECK A;  1VZB A;  4GD7 A;  3IRM A;  1LCB A;  3IHI A;  1AN5 A;  1JMI A;  3DGA C;  3EF9 A;  4DP3 A;  1BO7 A;  1BQ1 A;  1NJE A;  2A9W A;  1EV8 A;  1NJA A;  2VET A;  4KY8 A;  3HBB A;  4DPH A;  1YPV A;  1BQ2 A;  1QZF A;  1TDC A;  1SEJ A;  1B5E A;  1BP6 A;  3C0A A;  1CI7 A;  1HW4 A;  1TSZ A;  4XSC A;  3BZ0 A;  1TSW A;  3KGB A;  4E5O A;  1TSX A;  3DL6 A;  4H1I A;  1TSL A;  1LCE A;  5FCT A;  4EB4 A;  1TIS A;  1JG0 A;  3KJR A;  5H3A A;  1FFL A;  1JMF A;  1JUT A;  3EGY X;  3IJZ A;  1VZE A;  1F28 A;  2FTQ A;  4Q0E A;  4XSE A;  1TSV A;  1TVV A;  4FGT A;  2TSC A;  5H39 A;  1B5D A;  1JUJ A;  1TDB A;  1BSP A;  2TDD A;  4ISW A;  1TLS A;  2VF0 A;  1HW3 A;  1BKO A;  4ISK A;  2TDM A;  1F4C A;  1I00 A;  3EDW X;  1TVU A;  3BHR A;  1HVY A;  1VZA A;  4H0R A;  4FOX A;  1BKP A;  2BBQ A;  1BP0 A;  4XSD A;  2FTO X;  3N5G A;  3I3R A;  4EIL A;  3N5E B;  1THY A;  5H38 A;  3IK0 A; 
#chains in the Genus database with same CATH topology
 4UP1 A;  4JEF A;  3K2H A;  4H0U A;  1F4B A;  3ED7 A;  1KZI A;  3B9H A;  1TRG A;  3KJS A;  1JU6 A;  1EVF A;  3DG8 C;  4IQQ A;  3UM6 A;  1EV5 A;  4DQ1 A;  3UM8 A;  2G86 A;  4FOA A;  1AXW A;  1B02 A;  1F4G A;  2G89 A;  5HS3 A;  1BDU A;  4KNZ A;  1JTQ A;  4FQS A;  4Q0D A;  1JMH A;  4O1X D;  1F4D A;  1AJM A;  2KCE A;  1TDU A;  2TSR A;  4IQB A;  3BGX A;  1B49 A;  4IRR A;  1ZPR A;  1SYN A;  2OIP A;  1TSN A;  1TVW A;  1KZJ A;  3DL5 A;  1LCA A;  1J3J C;  2RD8 B;  3UWL B;  1JMG A;  1AIQ A;  2FTN A;  4EZ8 A;  3C06 A;  4F2V A;  3EAW X;  4GYH A;  4O1U A;  3N5E A;  4KY4 A;  4KPW A;  1BPJ A;  3H9K A;  4PSG A;  3TMS A;  3IRO A;  3QG2 A;  1NCE A;  4G2O X;  3V8H A;  3UM5 A;  3IX6 A;  3IK1 A;  4FOG A;  3EBU A;  4LRR A;  2G8A A;  3CLB A;  1F4F A;  2ONB A;  4E28 A;  1EVG A;  4GEV A;  2AAZ A;  1RTS A;  3OB7 A;  1NJC A;  4DPD A;  1KCE A;  1AOB A;  2H2Q A;  1BSF A;  1BJG A;  1J3K C;  1BID A;  3HJ3 A;  5WRN A;  3GH2 X;  4KYA A;  1TSM A;  1NJD A;  1TJS A;  3NRR A;  3QJ7 A;  1F4E A;  3BYX A;  3EJL A;  2RDA A;  2RD8 A;  1TSY A;  5J7W A;  3UWL A;  5BY6 A;  3B5B A;  1TLC A;  3JSU A;  3EHI X;  3CL9 A;  3IRN A;  1VZD A;  4O1X A;  4O7U A;  1FWM A;  1NJB A;  1QQQ A;  1VZC A;  3GG5 A;  1DDU A;  1TDA A;  1DNA A;  1TYS A;  4EIN A;  4TMS A;  1TSD A;  3BFI A;  3INV A;  1JTU A;  2G8D A;  3QGT A;  1HZW A;  3GH0 A;  3BNZ A;  1BO8 A;  1J3I C;  3BHL A;  4G6W X;  3HB8 A;  2G8X A;  4ECK A;  1VZB A;  4GD7 A;  3IRM A;  1LCB A;  3IHI A;  1AN5 A;  1JMI A;  3DGA C;  3EF9 A;  4DP3 A;  1BO7 A;  1BQ1 A;  1NJE A;  2A9W A;  1EV8 A;  1NJA A;  2VET A;  4KY8 A;  3HBB A;  4DPH A;  1YPV A;  1BQ2 A;  1QZF A;  1TDC A;  1SEJ A;  1B5E A;  1BP6 A;  3C0A A;  1CI7 A;  1HW4 A;  1TSZ A;  4XSC A;  3BZ0 A;  1TSW A;  3KGB A;  4E5O A;  1TSX A;  3DL6 A;  4H1I A;  1TSL A;  1LCE A;  5FCT A;  4EB4 A;  1TIS A;  1JG0 A;  3KJR A;  5H3A A;  1FFL A;  1JMF A;  1JUT A;  3EGY X;  3IJZ A;  1VZE A;  1F28 A;  2FTQ A;  4Q0E A;  4XSE A;  1TSV A;  1TVV A;  4FGT A;  2TSC A;  5H39 A;  1B5D A;  1JUJ A;  1TDB A;  1BSP A;  2TDD A;  4ISW A;  1TLS A;  2VF0 A;  1HW3 A;  1BKO A;  4ISK A;  2TDM A;  1F4C A;  1I00 A;  3EDW X;  1TVU A;  3BHR A;  1HVY A;  1VZA A;  4H0R A;  4FOX A;  1BKP A;  2BBQ A;  1BP0 A;  4XSD A;  2FTO X;  3N5G A;  3I3R A;  4EIL A;  3N5E B;  1THY A;  5H38 A;  3IK0 A; 
#chains in the Genus database with same CATH homology
 4UP1 A;  4JEF A;  3K2H A;  4H0U A;  1F4B A;  3ED7 A;  1KZI A;  3B9H A;  1TRG A;  3KJS A;  1JU6 A;  1EVF A;  3DG8 C;  4IQQ A;  3UM6 A;  1EV5 A;  4DQ1 A;  3UM8 A;  2G86 A;  4FOA A;  1AXW A;  1B02 A;  1F4G A;  2G89 A;  5HS3 A;  1BDU A;  4KNZ A;  1JTQ A;  4FQS A;  4Q0D A;  1JMH A;  4O1X D;  1F4D A;  1AJM A;  2KCE A;  1TDU A;  2TSR A;  4IQB A;  3BGX A;  1B49 A;  4IRR A;  1ZPR A;  1SYN A;  2OIP A;  1TSN A;  1TVW A;  1KZJ A;  3DL5 A;  1LCA A;  1J3J C;  2RD8 B;  3UWL B;  1JMG A;  1AIQ A;  2FTN A;  4EZ8 A;  3C06 A;  4F2V A;  3EAW X;  4GYH A;  4O1U A;  3N5E A;  4KY4 A;  4KPW A;  1BPJ A;  3H9K A;  4PSG A;  3TMS A;  3IRO A;  3QG2 A;  1NCE A;  4G2O X;  3V8H A;  3UM5 A;  3IX6 A;  3IK1 A;  4FOG A;  3EBU A;  4LRR A;  2G8A A;  3CLB A;  1F4F A;  2ONB A;  4E28 A;  1EVG A;  4GEV A;  2AAZ A;  1RTS A;  3OB7 A;  1NJC A;  4DPD A;  1KCE A;  1AOB A;  2H2Q A;  1BSF A;  1BJG A;  1J3K C;  1BID A;  3HJ3 A;  5WRN A;  3GH2 X;  4KYA A;  1TSM A;  1NJD A;  1TJS A;  3NRR A;  3QJ7 A;  1F4E A;  3BYX A;  3EJL A;  2RDA A;  2RD8 A;  1TSY A;  5J7W A;  3UWL A;  5BY6 A;  3B5B A;  1TLC A;  3JSU A;  3EHI X;  3CL9 A;  3IRN A;  1VZD A;  4O1X A;  4O7U A;  1FWM A;  1NJB A;  1QQQ A;  1VZC A;  3GG5 A;  1DDU A;  1TDA A;  1DNA A;  1TYS A;  4EIN A;  4TMS A;  1TSD A;  3BFI A;  3INV A;  1JTU A;  2G8D A;  3QGT A;  1HZW A;  3GH0 A;  3BNZ A;  1BO8 A;  1J3I C;  3BHL A;  4G6W X;  3HB8 A;  2G8X A;  4ECK A;  1VZB A;  4GD7 A;  3IRM A;  1LCB A;  3IHI A;  1AN5 A;  1JMI A;  3DGA C;  3EF9 A;  4DP3 A;  1BO7 A;  1BQ1 A;  1NJE A;  2A9W A;  1EV8 A;  1NJA A;  2VET A;  4KY8 A;  3HBB A;  4DPH A;  1YPV A;  1BQ2 A;  1QZF A;  1TDC A;  1SEJ A;  1B5E A;  1BP6 A;  3C0A A;  1CI7 A;  1HW4 A;  1TSZ A;  4XSC A;  3BZ0 A;  1TSW A;  3KGB A;  4E5O A;  1TSX A;  3DL6 A;  4H1I A;  1TSL A;  1LCE A;  5FCT A;  4EB4 A;  1TIS A;  1JG0 A;  3KJR A;  5H3A A;  1FFL A;  1JMF A;  1JUT A;  3EGY X;  3IJZ A;  1VZE A;  1F28 A;  2FTQ A;  4Q0E A;  4XSE A;  1TSV A;  1TVV A;  4FGT A;  2TSC A;  5H39 A;  1B5D A;  1JUJ A;  1TDB A;  1BSP A;  2TDD A;  4ISW A;  1TLS A;  2VF0 A;  1HW3 A;  1BKO A;  4ISK A;  2TDM A;  1F4C A;  1I00 A;  3EDW X;  1TVU A;  3BHR A;  1HVY A;  1VZA A;  4H0R A;  4FOX A;  1BKP A;  2BBQ A;  1BP0 A;  4XSD A;  2FTO X;  3N5G A;  3I3R A;  4EIL A;  3N5E B;  1THY A;  5H38 A;  3IK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...