6DFRA

Crystal structures of escherichia coli dihydrofolate reductase. the nadp+ holoenzyme and the folate(dot)nadp+ ternary complex. substrate binding and a model for the transition state
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
159
structure length
154
Chain Sequence
MISLIAALAVDRVIGPWNLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Escherichia coli dihydrofolate reductase: the NADP+ holoenzyme and the folate.NADP+ ternary complex. Substrate binding and a model for the transition state.
pubmed doi rcsb
molecule keywords DIHYDROFOLATE REDUCTASE
molecule tags Oxidoreductase
source organism Escherichia coli
total genus 40
structure length 154
sequence length 159
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 1988-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 6dfrA00
3F0SX 1DR1A 4FHBA 3CSEA 3FQ0A 2W3AA 4P3QA 1DG7A 3DRCA 1E26A 4G95A 1RX1A 3UM5A 3F8ZA 2FZJA 4KD7A 2W3BA 2C2SA 4X5FA 3GHCA 4QJZD 3CD2A 4X5GA 3SGYA 1RF7A 4X5IA 5DFRA 3CLBA 2D5NA 2BLBA 3NXYA 1M7AA 1DIUA 3QLXA 1S3UA 1DISA 3GHVA 1RA1A 2JYBA 4PSTA 1DHFA 3KJSA 4XT6A 2OBCA 1CZ3A 4IXFX 2W9GA 3TQ9A 3FRAX 3I8AX 1DF7A 3FL9A 1DG5A 2W3VA 1RE7A 1J3KA 4ELEA 4XT5A 5HQZA 8DFRA 3S9UA 1AI9A 2O7PA 5HVEA 1RX8A 3KFYA 2HXVA 3K74A 4KM2A 4H98A 1S3WA 4NX7A 3QYLA 1RC4A 3TQAA 1J3JA 4I1NA 4EILA 1RA8A 3F0QX 4M7UA 4DPHA 1IA2A 1RX2A 4HOFA 3IROA 3QLRA 3E0BA 1TDRA 1VDRA 3SRRX 3SRSX 3JWFA 3SR5X 1DG8A 4H95A 5HSRA 2G6VA 3NZ6X 5HSUA 1PD9A 1U71A 1M79A 4GH8A 4IXED 3K47A 4KJKA 3FRDX 4KNEA 4QJCA 3GHWA 3EEMA 2CIGA 3Q1HA 1DRBA 3NU0A 4M6KA 3DFRA 2C2TA 2BL9A 2ITHA 3M08A 4OR7A 4XE6X 3M09A 5EAJA 3EEJA 2CD2A 2FZHA 3TQ8A 3IRNA 1KMVA 3DGAA 3F91A 1DR3A 1DDSA 1U72A 4EJ1A 1DR7A 1RD7A 2L28A 5HF0X 3FRBX 2AZNA 3FL8A 5HPBA 4Q0EA 1AO8A 1MVTA 3EELA 7DFRA 4CD2A 3IA5A 3F0UX 4P3RA 3L3RA 4FGGA 2W9HA 3NXVA 6DFRA 4ELFA 3FRFX 1DYIA 3EX8A 5DXVA 3GYFA 3FYWX 1RH3A 3KY8A 3D84X 3JVXA 1IA1A 2W3MA 1U70A 2HQPA 1RA3A 1HFRA 1IA4A 1OHJA 3NXTA 4KEBA 1RX9A 4X5JA 2DHFA 3JW5A 5HT4A 4KFJA 4TU5X 1HFQA 4KY4A 4KJJA 5FDAA 4FGHA 2FZIA 4PSYA 3QGTA 1RB2A 3K45A 3QLZA 5HI6A 5JA3A 3NRRA 1RX4A 3NZ9X 3JWCA 1JOMA 3K2HA 1HFPA 1PDBA 2XW7A 3GI2A 3QL3A 5HQYA 2P4GA 3FREX 3QFXA 3FQVA 1PD8A 2QK8A 3QG2A 2B3ZA 4KBNA 1RA9A 4I13A 1D1GA 2W3WA 4EIGA 1CD2A 1DRFA 1MVSA 3ZPGA 4ELGA 2LF1A 3FYVX 4KM0A 1AOEA 3DATA 2DRCA 3EIGA 1RG7A 1S3VA 3FS6A 2W9SA 3IX9A 3DL6A 1RA2A 4LEKX 4P68A 3IRMA 4G8ZX 3SRQX 4PSSA 3NZAX 3FY8X 4M6JA 3JWKA 4ELHA 3SQYX 1JOLA 1RX7A 3JTWA 4OSGA 3FQZA 4QLFA 1DHJA 1RX6A 4X5HA 3JW3A 1DYRA 1BZFA 3NZDA 1DYHA 5ECCA 1DR2A 3DG8A 1QZFA 3NTZA 3NXRA 1JUVA 4QI9A 5JG0X 3NZBX 3VCOA 2BLAA 2W9TA 3TQBA 3F0BX 3I3RA 3LG4A 4XRBA 4PTJA 4KL9A 3ROAA 3D80A 3QYOA 1LY4A 1J3IA 1YHOA 4PTHA 3INVA 5U27A 4DPDA 5U26A 3SA2A 4KYAA 2HM9A 3OAFA 5CCCA 1DDRA 1VJ3A 3UM6A 4XT4A 4HOEA 4Q0DA 4Q67A 4P66A 2BLCA 4LAEX 4RGCA 3S3VA 4KLXA 4DDRA 1S3YA 1DLRA 4H96A 3TD8A 3FQCA 4H97A 3F8YA 1RX3A 4HA7A 3NZCX 3NXXA 4XT7A 1SEJA 1BOZA 3NXOA 3N0HA 4M2XA 4LAGX 3ZPCA 4EIZA 1RX5A 3QLWA 4DFRA 2ANOA 5HUIA 2ZZAA 3R33A 1DYJA 1LUDA 5CC9A 3SAIA 2INQA 3IA4A 1RB3A 1M78A 1DLSA 4KAKA 4ECKA 3QLSA 4QLGA 3CL9A 4LAHX 3UM8A 1DHIA 5HF2X 4NX6A 4G3MA 4DP3A 3KJRA 5HVBA 3FY9X 1DR4A 4XT8A 4HA9A 4PDJA 1DR6A 3F0XX 3FQOA 3DL5A 4QHVA 4KY8A 3DAUA 3S7AA 1KMSA 1DRAA 3RG9A 4QLEA 2D0KA 5ECXA 5E8QA 1IA3A 2H2QA 1KLKA 3QLYA 4M7VA 3SRUX 1DAJA 3F0VX 2KGKA 4IXGX 3EEKA 2GD9A 2ANQA 1DR5A 1LY3A 4HOGA 3HJ3A 3SA1A 5HT5A 2OIPA 3SRWX 1ZDRA 4ELBA 1DRHA 3FQFA 3SH2A 3KGYA 4Q6AA 3HBBA 3JSUA 4XECX 1OHKA 3OCHA 4M6LA 3JWMA 1DREA 3QL0A 3RO9A 4KJLA
chains in the Genus database with same CATH superfamily
3F0SX 1DR1A 4FHBA 3CSEA 3FQ0A 2W3AA 4P3QA 1DG7A 3DRCA 1E26A 4G95A 1RX1A 3UM5A 3F8ZA 2FZJA 4KD7A 2W3BA 2C2SA 4X5FA 3GHCA 4QJZD 3CD2A 4X5GA 3SGYA 1RF7A 4X5IA 5DFRA 3CLBA 2D5NA 2BLBA 3NXYA 1M7AA 1DIUA 3QLXA 1S3UA 1DISA 3GHVA 1RA1A 2JYBA 4PSTA 1DHFA 3KJSA 4XT6A 2OBCA 1CZ3A 4IXFX 2W9GA 3TQ9A 3FRAX 3I8AX 1DF7A 3FL9A 1DG5A 2W3VA 1RE7A 1J3KA 4ELEA 4XT5A 5HQZA 8DFRA 3S9UA 1AI9A 2O7PA 5HVEA 1RX8A 3KFYA 2HXVA 3K74A 4KM2A 4H98A 1S3WA 4NX7A 3QYLA 1RC4A 3TQAA 1J3JA 4I1NA 4EILA 1RA8A 3F0QX 4M7UA 4DPHA 1IA2A 1RX2A 4HOFA 3IROA 3QLRA 3E0BA 1TDRA 1VDRA 3SRRX 3SRSX 3JWFA 3SR5X 1DG8A 4H95A 5HSRA 2G6VA 3NZ6X 5HSUA 1PD9A 1U71A 1M79A 4GH8A 4IXED 3K47A 4KJKA 3FRDX 4KNEA 4QJCA 3GHWA 3EEMA 2CIGA 3Q1HA 1DRBA 3NU0A 4M6KA 3DFRA 2C2TA 2BL9A 2ITHA 3M08A 4OR7A 4XE6X 3M09A 5EAJA 3EEJA 2CD2A 2FZHA 3TQ8A 3IRNA 1KMVA 3DGAA 3F91A 1DR3A 1DDSA 1U72A 4EJ1A 1DR7A 1RD7A 2L28A 5HF0X 3FRBX 2AZNA 3FL8A 5HPBA 4Q0EA 1AO8A 1MVTA 3EELA 7DFRA 4CD2A 3IA5A 3F0UX 4P3RA 3L3RA 4FGGA 2W9HA 3NXVA 6DFRA 4ELFA 3FRFX 1DYIA 3EX8A 5DXVA 3GYFA 3FYWX 1RH3A 3KY8A 3D84X 3JVXA 1IA1A 2W3MA 1U70A 2HQPA 1RA3A 1HFRA 1IA4A 1OHJA 3NXTA 4KEBA 1RX9A 4X5JA 2DHFA 3JW5A 5HT4A 4KFJA 4TU5X 1HFQA 4KY4A 4KJJA 5FDAA 4FGHA 2FZIA 4PSYA 3QGTA 1RB2A 3K45A 3QLZA 5HI6A 5JA3A 3NRRA 1RX4A 3NZ9X 3JWCA 1JOMA 3K2HA 1HFPA 1PDBA 2XW7A 3GI2A 3QL3A 5HQYA 2P4GA 3FREX 3QFXA 3FQVA 1PD8A 2QK8A 3QG2A 2B3ZA 4KBNA 1RA9A 4I13A 1D1GA 2W3WA 4EIGA 1CD2A 1DRFA 1MVSA 3ZPGA 4ELGA 2LF1A 3FYVX 4KM0A 1AOEA 3DATA 2DRCA 3EIGA 1RG7A 1S3VA 3FS6A 2W9SA 3IX9A 3DL6A 1RA2A 4LEKX 4P68A 3IRMA 4G8ZX 3SRQX 4PSSA 3NZAX 3FY8X 4M6JA 3JWKA 4ELHA 3SQYX 1JOLA 1RX7A 3JTWA 4OSGA 3FQZA 4QLFA 1DHJA 1RX6A 4X5HA 3JW3A 1DYRA 1BZFA 3NZDA 1DYHA 5ECCA 1DR2A 3DG8A 1QZFA 3NTZA 3NXRA 1JUVA 4QI9A 5JG0X 3NZBX 3VCOA 2BLAA 2W9TA 3TQBA 3F0BX 3I3RA 3LG4A 4XRBA 4PTJA 4KL9A 3ROAA 3D80A 3QYOA 1LY4A 1J3IA 1YHOA 4PTHA 3INVA 5U27A 4DPDA 5U26A 3SA2A 4KYAA 2HM9A 3OAFA 5CCCA 1DDRA 1VJ3A 3UM6A 4XT4A 4HOEA 4Q0DA 4Q67A 4P66A 2BLCA 4LAEX 4RGCA 3S3VA 4KLXA 4DDRA 1S3YA 1DLRA 4H96A 3TD8A 3FQCA 4H97A 3F8YA 1RX3A 4HA7A 3NZCX 3NXXA 4XT7A 1SEJA 1BOZA 3NXOA 3N0HA 4M2XA 4LAGX 3ZPCA 4EIZA 1RX5A 3QLWA 4DFRA 2ANOA 5HUIA 2ZZAA 3R33A 1DYJA 1LUDA 5CC9A 3SAIA 2INQA 3IA4A 1RB3A 1M78A 1DLSA 4KAKA 4ECKA 3QLSA 4QLGA 3CL9A 4LAHX 3UM8A 1DHIA 5HF2X 4NX6A 4G3MA 4DP3A 3KJRA 5HVBA 3FY9X 1DR4A 4XT8A 4HA9A 4PDJA 1DR6A 3F0XX 3FQOA 3DL5A 4QHVA 4KY8A 3DAUA 3S7AA 1KMSA 1DRAA 3RG9A 4QLEA 2D0KA 5ECXA 5E8QA 1IA3A 2H2QA 1KLKA 3QLYA 4M7VA 3SRUX 1DAJA 3F0VX 2KGKA 4IXGX 3EEKA 2GD9A 2ANQA 1DR5A 1LY3A 4HOGA 3HJ3A 3SA1A 5HT5A 2OIPA 3SRWX 1ZDRA 4ELBA 1DRHA 3FQFA 3SH2A 3KGYA 4Q6AA 3HBBA 3JSUA 4XECX 1OHKA 3OCHA 4M6LA 3JWMA 1DREA 3QL0A 3RO9A 4KJLA
chains in the Genus database with same CATH topology
3F0SX 1DR1A 4FHBA 3CSEA 3FQ0A 2W3AA 4P3QA 1DG7A 3DRCA 1E26A 4G95A 1RX1A 3UM5A 3F8ZA 2FZJA 4KD7A 2W3BA 2C2SA 4X5FA 3GHCA 4QJZD 3CD2A 4X5GA 3SGYA 1RF7A 4X5IA 5DFRA 3CLBA 2D5NA 2BLBA 3NXYA 1M7AA 1DIUA 3QLXA 1S3UA 1DISA 3GHVA 1RA1A 2JYBA 4PSTA 1DHFA 3KJSA 4XT6A 2OBCA 1CZ3A 4IXFX 2W9GA 3TQ9A 3FRAX 3I8AX 1DF7A 3FL9A 1DG5A 2W3VA 1RE7A 1J3KA 4ELEA 4XT5A 5HQZA 8DFRA 3S9UA 1AI9A 2O7PA 5HVEA 1RX8A 3KFYA 2HXVA 3K74A 4KM2A 4H98A 1S3WA 4NX7A 3QYLA 1RC4A 3TQAA 1J3JA 4I1NA 4EILA 1RA8A 3F0QX 4M7UA 4DPHA 1IA2A 1RX2A 4HOFA 3IROA 3QLRA 3E0BA 1TDRA 1VDRA 3SRRX 3SRSX 3JWFA 3SR5X 1DG8A 4H95A 5HSRA 2G6VA 3NZ6X 5HSUA 1PD9A 1U71A 1M79A 4GH8A 4IXED 3K47A 4KJKA 3FRDX 4KNEA 4QJCA 3GHWA 3EEMA 2CIGA 3Q1HA 1DRBA 3NU0A 4M6KA 3DFRA 2C2TA 2BL9A 2ITHA 3M08A 4OR7A 4XE6X 3M09A 5EAJA 3EEJA 2CD2A 2FZHA 3TQ8A 3IRNA 1KMVA 3DGAA 3F91A 1DR3A 1DDSA 1U72A 4EJ1A 1DR7A 1RD7A 2L28A 5HF0X 3FRBX 2AZNA 3FL8A 5HPBA 4Q0EA 1AO8A 1MVTA 3EELA 7DFRA 4CD2A 3IA5A 3F0UX 4P3RA 3L3RA 4FGGA 2W9HA 3NXVA 6DFRA 4ELFA 3FRFX 1DYIA 3EX8A 5DXVA 3GYFA 3FYWX 1RH3A 3KY8A 3D84X 3JVXA 1IA1A 2W3MA 1U70A 2HQPA 1RA3A 1HFRA 1IA4A 1OHJA 3NXTA 4KEBA 1RX9A 4X5JA 2DHFA 3JW5A 5HT4A 4KFJA 4TU5X 1HFQA 4KY4A 4KJJA 5FDAA 4FGHA 2FZIA 4PSYA 3QGTA 1RB2A 3K45A 3QLZA 5HI6A 5JA3A 3NRRA 1RX4A 3NZ9X 3JWCA 1JOMA 3K2HA 1HFPA 1PDBA 2XW7A 3GI2A 3QL3A 5HQYA 2P4GA 3FREX 3QFXA 3FQVA 1PD8A 2QK8A 3QG2A 2B3ZA 4KBNA 1RA9A 4I13A 1D1GA 2W3WA 4EIGA 1CD2A 1DRFA 1MVSA 3ZPGA 4ELGA 2LF1A 3FYVX 4KM0A 1AOEA 3DATA 2DRCA 3EIGA 1RG7A 1S3VA 3FS6A 2W9SA 3IX9A 3DL6A 1RA2A 4LEKX 4P68A 3IRMA 4G8ZX 3SRQX 4PSSA 3NZAX 3FY8X 4M6JA 3JWKA 4ELHA 3SQYX 1JOLA 1RX7A 3JTWA 4OSGA 3FQZA 4QLFA 1DHJA 1RX6A 4X5HA 3JW3A 1DYRA 1BZFA 3NZDA 1DYHA 5ECCA 1DR2A 3DG8A 1QZFA 3NTZA 3NXRA 1JUVA 4QI9A 5JG0X 3NZBX 3VCOA 2BLAA 2W9TA 3TQBA 3F0BX 3I3RA 3LG4A 4XRBA 4PTJA 4KL9A 3ROAA 3D80A 3QYOA 1LY4A 1J3IA 1YHOA 4PTHA 3INVA 5U27A 4DPDA 5U26A 3SA2A 4KYAA 2HM9A 3OAFA 5CCCA 1DDRA 1VJ3A 3UM6A 4XT4A 4HOEA 4Q0DA 4Q67A 4P66A 2BLCA 4LAEX 4RGCA 3S3VA 4KLXA 4DDRA 1S3YA 1DLRA 4H96A 3TD8A 3FQCA 4H97A 3F8YA 1RX3A 4HA7A 3NZCX 3NXXA 4XT7A 1SEJA 1BOZA 3NXOA 3N0HA 4M2XA 4LAGX 3ZPCA 4EIZA 1RX5A 3QLWA 4DFRA 2ANOA 5HUIA 2ZZAA 3R33A 1DYJA 1LUDA 5CC9A 3SAIA 2INQA 3IA4A 1RB3A 1M78A 1DLSA 4KAKA 4ECKA 3QLSA 4QLGA 3CL9A 4LAHX 3UM8A 1DHIA 5HF2X 4NX6A 4G3MA 4DP3A 3KJRA 5HVBA 3FY9X 1DR4A 4XT8A 4HA9A 4PDJA 1DR6A 3F0XX 3FQOA 3DL5A 4QHVA 4KY8A 3DAUA 3S7AA 1KMSA 1DRAA 3RG9A 4QLEA 2D0KA 5ECXA 5E8QA 1IA3A 2H2QA 1KLKA 3QLYA 4M7VA 3SRUX 1DAJA 3F0VX 2KGKA 4IXGX 3EEKA 2GD9A 2ANQA 1DR5A 1LY3A 4HOGA 3HJ3A 3SA1A 5HT5A 2OIPA 3SRWX 1ZDRA 4ELBA 1DRHA 3FQFA 3SH2A 3KGYA 4Q6AA 3HBBA 3JSUA 4XECX 1OHKA 3OCHA 4M6LA 3JWMA 1DREA 3QL0A 3RO9A 4KJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0S X;  1DR1 A;  4FHB A;  3CSE A;  3FQ0 A;  2W3A A;  4P3Q A;  1DG7 A;  3DRC A;  1E26 A;  4G95 A;  1RX1 A;  3UM5 A;  3F8Z A;  2FZJ A;  4KD7 A;  2W3B A;  2C2S A;  4X5F A;  3GHC A;  4QJZ D;  3CD2 A;  4X5G A;  3SGY A;  1RF7 A;  4X5I A;  5DFR A;  3CLB A;  2D5N A;  2BLB A;  3NXY A;  1M7A A;  1DIU A;  3QLX A;  1S3U A;  1DIS A;  3GHV A;  1RA1 A;  2JYB A;  4PST A;  1DHF A;  3KJS A;  4XT6 A;  2OBC A;  1CZ3 A;  4IXF X;  2W9G A;  3TQ9 A;  3FRA X;  3I8A X;  1DF7 A;  3FL9 A;  1DG5 A;  2W3V A;  1RE7 A;  1J3K A;  4ELE A;  4XT5 A;  5HQZ A;  8DFR A;  3S9U A;  1AI9 A;  2O7P A;  5HVE A;  1RX8 A;  3KFY A;  2HXV A;  3K74 A;  4KM2 A;  4H98 A;  1S3W A;  4NX7 A;  3QYL A;  1RC4 A;  3TQA A;  1J3J A;  4I1N A;  4EIL A;  1RA8 A;  3F0Q X;  4M7U A;  4DPH A;  1IA2 A;  1RX2 A;  4HOF A;  3IRO A;  3QLR A;  3E0B A;  1TDR A;  1VDR A;  3SRR X;  3SRS X;  3JWF A;  3SR5 X;  1DG8 A;  4H95 A;  5HSR A;  2G6V A;  3NZ6 X;  5HSU A;  1PD9 A;  1U71 A;  1M79 A;  4GH8 A;  4IXE D;  3K47 A;  4KJK A;  3FRD X;  4KNE A;  4QJC A;  3GHW A;  3EEM A;  2CIG A;  3Q1H A;  1DRB A;  3NU0 A;  4M6K A;  3DFR A;  2C2T A;  2BL9 A;  2ITH A;  3M08 A;  4OR7 A;  4XE6 X;  3M09 A;  5EAJ A;  3EEJ A;  2CD2 A;  2FZH A;  3TQ8 A;  3IRN A;  1KMV A;  3DGA A;  3F91 A;  1DR3 A;  1DDS A;  1U72 A;  4EJ1 A;  1DR7 A;  1RD7 A;  2L28 A;  5HF0 X;  3FRB X;  2AZN A;  3FL8 A;  5HPB A;  4Q0E A;  1AO8 A;  1MVT A;  3EEL A;  7DFR A;  4CD2 A;  3IA5 A;  3F0U X;  4P3R A;  3L3R A;  4FGG A;  2W9H A;  3NXV A;  6DFR A;  4ELF A;  3FRF X;  1DYI A;  3EX8 A;  5DXV A;  3GYF A;  3FYW X;  1RH3 A;  3KY8 A;  3D84 X;  3JVX A;  1IA1 A;  2W3M A;  1U70 A;  2HQP A;  1RA3 A;  1HFR A;  1IA4 A;  1OHJ A;  3NXT A;  4KEB A;  1RX9 A;  4X5J A;  2DHF A;  3JW5 A;  5HT4 A;  4KFJ A;  4TU5 X;  1HFQ A;  4KY4 A;  4KJJ A;  5FDA A;  4FGH A;  2FZI A;  4PSY A;  3QGT A;  1RB2 A;  3K45 A;  3QLZ A;  5HI6 A;  5JA3 A;  3NRR A;  1RX4 A;  3NZ9 X;  3JWC A;  1JOM A;  3K2H A;  1HFP A;  1PDB A;  2XW7 A;  3GI2 A;  3QL3 A;  5HQY A;  2P4G A;  3FRE X;  3QFX A;  3FQV A;  1PD8 A;  2QK8 A;  3QG2 A;  2B3Z A;  4KBN A;  1RA9 A;  4I13 A;  1D1G A;  2W3W A;  4EIG A;  1CD2 A;  1DRF A;  1MVS A;  3ZPG A;  4ELG A;  2LF1 A;  3FYV X;  4KM0 A;  1AOE A;  3DAT A;  2DRC A;  3EIG A;  1RG7 A;  1S3V A;  3FS6 A;  2W9S A;  3IX9 A;  3DL6 A;  1RA2 A;  4LEK X;  4P68 A;  3IRM A;  4G8Z X;  3SRQ X;  4PSS A;  3NZA X;  3FY8 X;  4M6J A;  3JWK A;  4ELH A;  3SQY X;  1JOL A;  1RX7 A;  3JTW A;  4OSG A;  3FQZ A;  4QLF A;  1DHJ A;  1RX6 A;  4X5H A;  3JW3 A;  1DYR A;  1BZF A;  3NZD A;  1DYH A;  5ECC A;  1DR2 A;  3DG8 A;  1QZF A;  3NTZ A;  3NXR A;  1JUV A;  4QI9 A;  5JG0 X;  3NZB X;  3VCO A;  2BLA A;  2W9T A;  3TQB A;  3F0B X;  3I3R A;  3LG4 A;  4XRB A;  4PTJ A;  4KL9 A;  3ROA A;  3D80 A;  3QYO A;  1LY4 A;  1J3I A;  1YHO A;  4PTH A;  3INV A;  5U27 A;  4DPD A;  5U26 A;  3SA2 A;  4KYA A;  2HM9 A;  3OAF A;  5CCC A;  1DDR A;  1VJ3 A;  3UM6 A;  4XT4 A;  4HOE A;  4Q0D A;  4Q67 A;  4P66 A;  2BLC A;  4LAE X;  4RGC A;  3S3V A;  4KLX A;  4DDR A;  1S3Y A;  1DLR A;  4H96 A;  3TD8 A;  3FQC A;  4H97 A;  3F8Y A;  1RX3 A;  4HA7 A;  3NZC X;  3NXX A;  4XT7 A;  1SEJ A;  1BOZ A;  3NXO A;  3N0H A;  4M2X A;  4LAG X;  3ZPC A;  4EIZ A;  1RX5 A;  3QLW A;  4DFR A;  2ANO A;  5HUI A;  2ZZA A;  3R33 A;  1DYJ A;  1LUD A;  5CC9 A;  3SAI A;  2INQ A;  3IA4 A;  1RB3 A;  1M78 A;  1DLS A;  4KAK A;  4ECK A;  3QLS A;  4QLG A;  3CL9 A;  4LAH X;  3UM8 A;  1DHI A;  5HF2 X;  4NX6 A;  4G3M A;  4DP3 A;  3KJR A;  5HVB A;  3FY9 X;  1DR4 A;  4XT8 A;  4HA9 A;  4PDJ A;  1DR6 A;  3F0X X;  3FQO A;  3DL5 A;  4QHV A;  4KY8 A;  3DAU A;  3S7A A;  1KMS A;  1DRA A;  3RG9 A;  4QLE A;  2D0K A;  5ECX A;  5E8Q A;  1IA3 A;  2H2Q A;  1KLK A;  3QLY A;  4M7V A;  3SRU X;  1DAJ A;  3F0V X;  2KGK A;  4IXG X;  3EEK A;  2GD9 A;  2ANQ A;  1DR5 A;  1LY3 A;  4HOG A;  3HJ3 A;  3SA1 A;  5HT5 A;  2OIP A;  3SRW X;  1ZDR A;  4ELB A;  1DRH A;  3FQF A;  3SH2 A;  3KGY A;  4Q6A A;  3HBB A;  3JSU A;  4XEC X;  1OHK A;  3OCH A;  4M6L A;  3JWM A;  1DRE A;  3QL0 A;  3RO9 A;  4KJL A; 
#chains in the Genus database with same CATH topology
 3F0S X;  1DR1 A;  4FHB A;  3CSE A;  3FQ0 A;  2W3A A;  4P3Q A;  1DG7 A;  3DRC A;  1E26 A;  4G95 A;  1RX1 A;  3UM5 A;  3F8Z A;  2FZJ A;  4KD7 A;  2W3B A;  2C2S A;  4X5F A;  3GHC A;  4QJZ D;  3CD2 A;  4X5G A;  3SGY A;  1RF7 A;  4X5I A;  5DFR A;  3CLB A;  2D5N A;  2BLB A;  3NXY A;  1M7A A;  1DIU A;  3QLX A;  1S3U A;  1DIS A;  3GHV A;  1RA1 A;  2JYB A;  4PST A;  1DHF A;  3KJS A;  4XT6 A;  2OBC A;  1CZ3 A;  4IXF X;  2W9G A;  3TQ9 A;  3FRA X;  3I8A X;  1DF7 A;  3FL9 A;  1DG5 A;  2W3V A;  1RE7 A;  1J3K A;  4ELE A;  4XT5 A;  5HQZ A;  8DFR A;  3S9U A;  1AI9 A;  2O7P A;  5HVE A;  1RX8 A;  3KFY A;  2HXV A;  3K74 A;  4KM2 A;  4H98 A;  1S3W A;  4NX7 A;  3QYL A;  1RC4 A;  3TQA A;  1J3J A;  4I1N A;  4EIL A;  1RA8 A;  3F0Q X;  4M7U A;  4DPH A;  1IA2 A;  1RX2 A;  4HOF A;  3IRO A;  3QLR A;  3E0B A;  1TDR A;  1VDR A;  3SRR X;  3SRS X;  3JWF A;  3SR5 X;  1DG8 A;  4H95 A;  5HSR A;  2G6V A;  3NZ6 X;  5HSU A;  1PD9 A;  1U71 A;  1M79 A;  4GH8 A;  4IXE D;  3K47 A;  4KJK A;  3FRD X;  4KNE A;  4QJC A;  3GHW A;  3EEM A;  2CIG A;  3Q1H A;  1DRB A;  3NU0 A;  4M6K A;  3DFR A;  2C2T A;  2BL9 A;  2ITH A;  3M08 A;  4OR7 A;  4XE6 X;  3M09 A;  5EAJ A;  3EEJ A;  2CD2 A;  2FZH A;  3TQ8 A;  3IRN A;  1KMV A;  3DGA A;  3F91 A;  1DR3 A;  1DDS A;  1U72 A;  4EJ1 A;  1DR7 A;  1RD7 A;  2L28 A;  5HF0 X;  3FRB X;  2AZN A;  3FL8 A;  5HPB A;  4Q0E A;  1AO8 A;  1MVT A;  3EEL A;  7DFR A;  4CD2 A;  3IA5 A;  3F0U X;  4P3R A;  3L3R A;  4FGG A;  2W9H A;  3NXV A;  6DFR A;  4ELF A;  3FRF X;  1DYI A;  3EX8 A;  5DXV A;  3GYF A;  3FYW X;  1RH3 A;  3KY8 A;  3D84 X;  3JVX A;  1IA1 A;  2W3M A;  1U70 A;  2HQP A;  1RA3 A;  1HFR A;  1IA4 A;  1OHJ A;  3NXT A;  4KEB A;  1RX9 A;  4X5J A;  2DHF A;  3JW5 A;  5HT4 A;  4KFJ A;  4TU5 X;  1HFQ A;  4KY4 A;  4KJJ A;  5FDA A;  4FGH A;  2FZI A;  4PSY A;  3QGT A;  1RB2 A;  3K45 A;  3QLZ A;  5HI6 A;  5JA3 A;  3NRR A;  1RX4 A;  3NZ9 X;  3JWC A;  1JOM A;  3K2H A;  1HFP A;  1PDB A;  2XW7 A;  3GI2 A;  3QL3 A;  5HQY A;  2P4G A;  3FRE X;  3QFX A;  3FQV A;  1PD8 A;  2QK8 A;  3QG2 A;  2B3Z A;  4KBN A;  1RA9 A;  4I13 A;  1D1G A;  2W3W A;  4EIG A;  1CD2 A;  1DRF A;  1MVS A;  3ZPG A;  4ELG A;  2LF1 A;  3FYV X;  4KM0 A;  1AOE A;  3DAT A;  2DRC A;  3EIG A;  1RG7 A;  1S3V A;  3FS6 A;  2W9S A;  3IX9 A;  3DL6 A;  1RA2 A;  4LEK X;  4P68 A;  3IRM A;  4G8Z X;  3SRQ X;  4PSS A;  3NZA X;  3FY8 X;  4M6J A;  3JWK A;  4ELH A;  3SQY X;  1JOL A;  1RX7 A;  3JTW A;  4OSG A;  3FQZ A;  4QLF A;  1DHJ A;  1RX6 A;  4X5H A;  3JW3 A;  1DYR A;  1BZF A;  3NZD A;  1DYH A;  5ECC A;  1DR2 A;  3DG8 A;  1QZF A;  3NTZ A;  3NXR A;  1JUV A;  4QI9 A;  5JG0 X;  3NZB X;  3VCO A;  2BLA A;  2W9T A;  3TQB A;  3F0B X;  3I3R A;  3LG4 A;  4XRB A;  4PTJ A;  4KL9 A;  3ROA A;  3D80 A;  3QYO A;  1LY4 A;  1J3I A;  1YHO A;  4PTH A;  3INV A;  5U27 A;  4DPD A;  5U26 A;  3SA2 A;  4KYA A;  2HM9 A;  3OAF A;  5CCC A;  1DDR A;  1VJ3 A;  3UM6 A;  4XT4 A;  4HOE A;  4Q0D A;  4Q67 A;  4P66 A;  2BLC A;  4LAE X;  4RGC A;  3S3V A;  4KLX A;  4DDR A;  1S3Y A;  1DLR A;  4H96 A;  3TD8 A;  3FQC A;  4H97 A;  3F8Y A;  1RX3 A;  4HA7 A;  3NZC X;  3NXX A;  4XT7 A;  1SEJ A;  1BOZ A;  3NXO A;  3N0H A;  4M2X A;  4LAG X;  3ZPC A;  4EIZ A;  1RX5 A;  3QLW A;  4DFR A;  2ANO A;  5HUI A;  2ZZA A;  3R33 A;  1DYJ A;  1LUD A;  5CC9 A;  3SAI A;  2INQ A;  3IA4 A;  1RB3 A;  1M78 A;  1DLS A;  4KAK A;  4ECK A;  3QLS A;  4QLG A;  3CL9 A;  4LAH X;  3UM8 A;  1DHI A;  5HF2 X;  4NX6 A;  4G3M A;  4DP3 A;  3KJR A;  5HVB A;  3FY9 X;  1DR4 A;  4XT8 A;  4HA9 A;  4PDJ A;  1DR6 A;  3F0X X;  3FQO A;  3DL5 A;  4QHV A;  4KY8 A;  3DAU A;  3S7A A;  1KMS A;  1DRA A;  3RG9 A;  4QLE A;  2D0K A;  5ECX A;  5E8Q A;  1IA3 A;  2H2Q A;  1KLK A;  3QLY A;  4M7V A;  3SRU X;  1DAJ A;  3F0V X;  2KGK A;  4IXG X;  3EEK A;  2GD9 A;  2ANQ A;  1DR5 A;  1LY3 A;  4HOG A;  3HJ3 A;  3SA1 A;  5HT5 A;  2OIP A;  3SRW X;  1ZDR A;  4ELB A;  1DRH A;  3FQF A;  3SH2 A;  3KGY A;  4Q6A A;  3HBB A;  3JSU A;  4XEC X;  1OHK A;  3OCH A;  4M6L A;  3JWM A;  1DRE A;  3QL0 A;  3RO9 A;  4KJL A; 
#chains in the Genus database with same CATH homology
 3F0S X;  1DR1 A;  4FHB A;  3CSE A;  3FQ0 A;  2W3A A;  4P3Q A;  1DG7 A;  3DRC A;  1E26 A;  4G95 A;  1RX1 A;  3UM5 A;  3F8Z A;  2FZJ A;  4KD7 A;  2W3B A;  2C2S A;  4X5F A;  3GHC A;  4QJZ D;  3CD2 A;  4X5G A;  3SGY A;  1RF7 A;  4X5I A;  5DFR A;  3CLB A;  2D5N A;  2BLB A;  3NXY A;  1M7A A;  1DIU A;  3QLX A;  1S3U A;  1DIS A;  3GHV A;  1RA1 A;  2JYB A;  4PST A;  1DHF A;  3KJS A;  4XT6 A;  2OBC A;  1CZ3 A;  4IXF X;  2W9G A;  3TQ9 A;  3FRA X;  3I8A X;  1DF7 A;  3FL9 A;  1DG5 A;  2W3V A;  1RE7 A;  1J3K A;  4ELE A;  4XT5 A;  5HQZ A;  8DFR A;  3S9U A;  1AI9 A;  2O7P A;  5HVE A;  1RX8 A;  3KFY A;  2HXV A;  3K74 A;  4KM2 A;  4H98 A;  1S3W A;  4NX7 A;  3QYL A;  1RC4 A;  3TQA A;  1J3J A;  4I1N A;  4EIL A;  1RA8 A;  3F0Q X;  4M7U A;  4DPH A;  1IA2 A;  1RX2 A;  4HOF A;  3IRO A;  3QLR A;  3E0B A;  1TDR A;  1VDR A;  3SRR X;  3SRS X;  3JWF A;  3SR5 X;  1DG8 A;  4H95 A;  5HSR A;  2G6V A;  3NZ6 X;  5HSU A;  1PD9 A;  1U71 A;  1M79 A;  4GH8 A;  4IXE D;  3K47 A;  4KJK A;  3FRD X;  4KNE A;  4QJC A;  3GHW A;  3EEM A;  2CIG A;  3Q1H A;  1DRB A;  3NU0 A;  4M6K A;  3DFR A;  2C2T A;  2BL9 A;  2ITH A;  3M08 A;  4OR7 A;  4XE6 X;  3M09 A;  5EAJ A;  3EEJ A;  2CD2 A;  2FZH A;  3TQ8 A;  3IRN A;  1KMV A;  3DGA A;  3F91 A;  1DR3 A;  1DDS A;  1U72 A;  4EJ1 A;  1DR7 A;  1RD7 A;  2L28 A;  5HF0 X;  3FRB X;  2AZN A;  3FL8 A;  5HPB A;  4Q0E A;  1AO8 A;  1MVT A;  3EEL A;  7DFR A;  4CD2 A;  3IA5 A;  3F0U X;  4P3R A;  3L3R A;  4FGG A;  2W9H A;  3NXV A;  6DFR A;  4ELF A;  3FRF X;  1DYI A;  3EX8 A;  5DXV A;  3GYF A;  3FYW X;  1RH3 A;  3KY8 A;  3D84 X;  3JVX A;  1IA1 A;  2W3M A;  1U70 A;  2HQP A;  1RA3 A;  1HFR A;  1IA4 A;  1OHJ A;  3NXT A;  4KEB A;  1RX9 A;  4X5J A;  2DHF A;  3JW5 A;  5HT4 A;  4KFJ A;  4TU5 X;  1HFQ A;  4KY4 A;  4KJJ A;  5FDA A;  4FGH A;  2FZI A;  4PSY A;  3QGT A;  1RB2 A;  3K45 A;  3QLZ A;  5HI6 A;  5JA3 A;  3NRR A;  1RX4 A;  3NZ9 X;  3JWC A;  1JOM A;  3K2H A;  1HFP A;  1PDB A;  2XW7 A;  3GI2 A;  3QL3 A;  5HQY A;  2P4G A;  3FRE X;  3QFX A;  3FQV A;  1PD8 A;  2QK8 A;  3QG2 A;  2B3Z A;  4KBN A;  1RA9 A;  4I13 A;  1D1G A;  2W3W A;  4EIG A;  1CD2 A;  1DRF A;  1MVS A;  3ZPG A;  4ELG A;  2LF1 A;  3FYV X;  4KM0 A;  1AOE A;  3DAT A;  2DRC A;  3EIG A;  1RG7 A;  1S3V A;  3FS6 A;  2W9S A;  3IX9 A;  3DL6 A;  1RA2 A;  4LEK X;  4P68 A;  3IRM A;  4G8Z X;  3SRQ X;  4PSS A;  3NZA X;  3FY8 X;  4M6J A;  3JWK A;  4ELH A;  3SQY X;  1JOL A;  1RX7 A;  3JTW A;  4OSG A;  3FQZ A;  4QLF A;  1DHJ A;  1RX6 A;  4X5H A;  3JW3 A;  1DYR A;  1BZF A;  3NZD A;  1DYH A;  5ECC A;  1DR2 A;  3DG8 A;  1QZF A;  3NTZ A;  3NXR A;  1JUV A;  4QI9 A;  5JG0 X;  3NZB X;  3VCO A;  2BLA A;  2W9T A;  3TQB A;  3F0B X;  3I3R A;  3LG4 A;  4XRB A;  4PTJ A;  4KL9 A;  3ROA A;  3D80 A;  3QYO A;  1LY4 A;  1J3I A;  1YHO A;  4PTH A;  3INV A;  5U27 A;  4DPD A;  5U26 A;  3SA2 A;  4KYA A;  2HM9 A;  3OAF A;  5CCC A;  1DDR A;  1VJ3 A;  3UM6 A;  4XT4 A;  4HOE A;  4Q0D A;  4Q67 A;  4P66 A;  2BLC A;  4LAE X;  4RGC A;  3S3V A;  4KLX A;  4DDR A;  1S3Y A;  1DLR A;  4H96 A;  3TD8 A;  3FQC A;  4H97 A;  3F8Y A;  1RX3 A;  4HA7 A;  3NZC X;  3NXX A;  4XT7 A;  1SEJ A;  1BOZ A;  3NXO A;  3N0H A;  4M2X A;  4LAG X;  3ZPC A;  4EIZ A;  1RX5 A;  3QLW A;  4DFR A;  2ANO A;  5HUI A;  2ZZA A;  3R33 A;  1DYJ A;  1LUD A;  5CC9 A;  3SAI A;  2INQ A;  3IA4 A;  1RB3 A;  1M78 A;  1DLS A;  4KAK A;  4ECK A;  3QLS A;  4QLG A;  3CL9 A;  4LAH X;  3UM8 A;  1DHI A;  5HF2 X;  4NX6 A;  4G3M A;  4DP3 A;  3KJR A;  5HVB A;  3FY9 X;  1DR4 A;  4XT8 A;  4HA9 A;  4PDJ A;  1DR6 A;  3F0X X;  3FQO A;  3DL5 A;  4QHV A;  4KY8 A;  3DAU A;  3S7A A;  1KMS A;  1DRA A;  3RG9 A;  4QLE A;  2D0K A;  5ECX A;  5E8Q A;  1IA3 A;  2H2Q A;  1KLK A;  3QLY A;  4M7V A;  3SRU X;  1DAJ A;  3F0V X;  2KGK A;  4IXG X;  3EEK A;  2GD9 A;  2ANQ A;  1DR5 A;  1LY3 A;  4HOG A;  3HJ3 A;  3SA1 A;  5HT5 A;  2OIP A;  3SRW X;  1ZDR A;  4ELB A;  1DRH A;  3FQF A;  3SH2 A;  3KGY A;  4Q6A A;  3HBB A;  3JSU A;  4XEC X;  1OHK A;  3OCH A;  4M6L A;  3JWM A;  1DRE A;  3QL0 A;  3RO9 A;  4KJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...