1GQ7A

Proclavaminate amidino hydrolase from streptomyces clavuligerus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
Knots found
sequence length
301
structure length
301
Chain Sequence
SPRYAQIPTFMRLPHDPQPRGYDVVVIGAPYDGGTSYRPGARFGPQAIRSESGLIHGVGIDRGPGTFDLINCVDAGDINLTPFDMNIAIDTAQSHLSGLLKANAAFLMIGGDHSLTVAALRAVAEQHGPLAVVHLDAHSDTNPAFYGGRYHHGTPFRHGIDEKLIDPAAMVQIGIRGHNPKPDSLDYARGHGVRVVTADEFGELGVGGTADLIREKVGQRPVYVSVDIDVVDPAFAPGTGTPAPGGLLSREVLALLRCVGDLKPVGFDVMEVSPLYDHGGITSILATEIGAELLYQYARAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROCLAVAMINATE AMIDINO HYDROLASE
publication title Oligomeric structure of proclavaminic acid amidino hydrolase: evolution of a hydrolytic enzyme in clavulanic acid biosynthesis.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
total genus 106
structure length 301
sequence length 301
chains with identical sequence B, C, D, E, F
other databases KnotProt 2.0: S +31 +31 +31
ec nomenclature ec 3.5.3.22: Proclavaminate amidinohydrolase.
pdb deposition date 2001-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1gq7A00
4GWCA 2EF5A 3NIOA 3SKKA 3E6KA 1T4SA 4MXRA 4Q3SA 1TBJA 4RHJA 1T5FA 3NIPA 3GN0A 3GMZA 4IU1A 1P8SA 5CEVA 1PQ3A 4FCIA 4Q3VA 4Q42A 3THHA 2EF4A 4Q3RC 3LHLA 4DZ4A 3PZLA 4IU5A 3LP4A 3F80A 5HJAA 2PLLA 1TBLA 4GWDA 1P8PA 1D3VA 4FCKA 1TBHA 1ZPEA 4HXQA 4MYLA 4IXUA 1HQGA 4IE3A 4IXVA 3MFVA 4G3HA 1P8QA 1WOIA 4HWWA 4CEVA 4ITYA 1HQHA 3SL1A 3LP7A 4I06A 4Q3PA 5RLAA 4MYFA 4Q3TA 4Q3QA 1ZPGA 3CEVA 4GSMA 1P8NA 1RLAA 3E8ZA 1P8MA 1T4PA 1GQ6A 3TF3A 3SL0A 1WOGA 3KV2A 2A0MA 4MYKA 3SJTA 3THEA 1HQ5A 1T5GA 1TA1A 3E9BA 4Q41A 3MJLA 4GSZA 4RHMA 1R1OA 1T4TA 1P8OA 4IU4A 4RLAA 3E6VA 4IE2A 4Q3UA 3RLAA 4Q40A 3MFWA 1WVBA 2ZAVA 3NIQA 1T4RA 3TH7A 1HQXA 3DJ8A 1GQ7A 1WVAA 4IE1A 1HQFA 2PHAA 3MMRA 2PHOA 3THJA 2AEBA 2RLAA 1XFKA 4RHIA 4RHLA 4GSVA 4HZEA 4Q3RA 3E8QA 1P8RA 2CEVA 3M1RA 4MYNA 1CEVA 4RHKA 1WOHA 2EIVA 4IU0A 4RHQA 5HJ9A
chains in the Genus database with same CATH superfamily
4GWCA 5ICNB 2EF5A 3NIOA 5EFKB 3SKKA 3E6KA 1T4SA 3MZ4A 4MXRA 5FCWA 4QA6A 5EF8A 4Q3SA 5THTA 1TBJA 2VQMA 4RHJA 5D1CA 1T5FA 5THUA 3NIPA 5JI5A 1T69A 3MAXA 4BKXB 3GN0A 1T64A 3GMZA 4IU1A 1P8SA 3EZTA 2V5XA 5CEVA 5G0IA 1PQ3A 4FCIA 4Q3VA 4CBTA 2VQJA 2VQOA 4Q42A 3THHA 2V5WA 2EF4A 4Q3RC 5EF7A 4ZUQA 3RQDA 3LHLA 5IWGA 1C3RA 2VQVA 3MZ6A 4DZ4A 3PZLA 4ZUOA 4CBYA 3F07A 5D1DA 4IU5A 3LP4A 3F80A 5DC8A 5HJAA 5EEKA 4CQFA 5EFNA 3F0RA 5DC5A 2PLLA 1TBLA 4QA7A 5G0JA 4GWDA 1P8PA 1D3VA 5EFBD 3MZ7A 1C3PA 4FCKA 1TBHA 3EW8A 5EFHA 5G0GA 1ZPEA 4QA5A 4HXQA 4BZ6A 4MYLA 4IXUA 1HQGA 4IE3A 3EZPA 4IXVA 3MFVA 4QA4A 5EEMA 4G3HA 4ZURA 5G1CA 4QA0A 1P8QA 1WOIA 4HWWA 4CEVA 4ITYA 1HQHA 3SL1A 3LP7A 1ZZ1A 4I06A 4Q3PA 5RLAA 3F06A 5G0XA 4QA2A 5G1AA 5D1BA 5EENA 4MYFA 5DC7A 4Q3TA 5EFGA 5G3WA 5G0YA 3Q9CA 4Q3QA 2VQWG 1ZPGA 3CEVA 3MENA 4GSMA 5G0HA 5G12A 5BWZA 5A2SA 2GH6A 3C0YA 1P8NA 5EEFA 1RLAA 4BZ9A 3E8ZA 1P8MA 1ZZ3A 1T4PA 1GQ6A 5EFJD 5G17A 3TF3A 4RN2A 5G10A 3SL0A 5LI3A 1WOGA 4RN1A 3KV2A 2A0MA 2VQQA 4MYKA 3SJTA 3THEA 1T67A 1HQ5A 4BZ5A 3Q9FA 1T5GA 1TA1A 5G11A 4ZUPA 5G1BA 3E9BA 4Q41A 3MJLA 4GSZA 4QA1A 1R1OA 4RHMA 1T4TA 2VCGA 4RN0A 1P8OA 5EEIA 5DC6A 4IU4A 3SFFA 4RLAA 3C10A 4LXZA 3E6VA 3MZ3A 4A69A 4IE2A 4Q3UA 3Q9EA 3RLAA 5FUEA 4ZUNA 4Q40A 3SFHA 3MFWA 1ZZ0A 1WVBA 2ZAVA 3NIQA 1T4RA 1W22A 3TH7A 1HQXA 4ZUMA 5THSA 3DJ8A 1GQ7A 1WVAA 4BZ8A 1VKGA 4LY1A 4IE1A 1HQFA 2PHAA 3C0ZA 3MMRA 2PHOA 3EWFA 3ZNSA 3THJA 5G13A 2AEBA 2RLAA 1XFKA 4RHIA 5IX0A 4BZ7A 4RHLA 1C3SA 4GSVA 3ZNRA 4QA3A 4HZEA 4Q3RA 3E8QA 1P8RA 2CEVA 3M1RA 4MYNA 3Q9BA 1CEVA 4RHKA 1WOHA 2EIVA 4IU0A 4RHQA 5THVA 5HJ9A
chains in the Genus database with same CATH topology
4GWCA 2EF5A 3NIOA 3SKKA 3E6KA 1T4SA 4MXRA 4Q3SA 1TBJA 4RHJA 1T5FA 3NIPA 3GN0A 3GMZA 4IU1A 1P8SA 5CEVA 1PQ3A 4FCIA 4Q3VA 4Q42A 3THHA 2EF4A 4Q3RC 3LHLA 4DZ4A 3PZLA 4IU5A 3LP4A 3F80A 5HJAA 2PLLA 1TBLA 4GWDA 1P8PA 1D3VA 4FCKA 1TBHA 1ZPEA 4HXQA 4MYLA 4IXUA 1HQGA 4IE3A 4IXVA 3MFVA 4G3HA 1P8QA 1WOIA 4HWWA 4CEVA 4ITYA 1HQHA 3SL1A 3LP7A 4I06A 4Q3PA 5RLAA 4MYFA 4Q3TA 4Q3QA 1ZPGA 3CEVA 4GSMA 1P8NA 1RLAA 3E8ZA 1P8MA 1T4PA 1GQ6A 3TF3A 3SL0A 1WOGA 3KV2A 2A0MA 4MYKA 3SJTA 3THEA 1HQ5A 1T5GA 1TA1A 3E9BA 4Q41A 3MJLA 4GSZA 4RHMA 1R1OA 1T4TA 1P8OA 4IU4A 4RLAA 3E6VA 4IE2A 4Q3UA 3RLAA 4Q40A 3MFWA 1WVBA 2ZAVA 3NIQA 1T4RA 3TH7A 1HQXA 3DJ8A 1GQ7A 1WVAA 4IE1A 1HQFA 2PHAA 3MMRA 2PHOA 3THJA 2AEBA 2RLAA 1XFKA 4RHIA 4RHLA 4GSVA 4HZEA 4Q3RA 3E8QA 1P8RA 2CEVA 3M1RA 4MYNA 1CEVA 4RHKA 1WOHA 2EIVA 4IU0A 4RHQA 5HJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GWC A;  2EF5 A;  3NIO A;  3SKK A;  3E6K A;  1T4S A;  4MXR A;  4Q3S A;  1TBJ A;  4RHJ A;  1T5F A;  3NIP A;  3GN0 A;  3GMZ A;  4IU1 A;  1P8S A;  5CEV A;  1PQ3 A;  4FCI A;  4Q3V A;  4Q42 A;  3THH A;  2EF4 A;  4Q3R C;  3LHL A;  4DZ4 A;  3PZL A;  4IU5 A;  3LP4 A;  3F80 A;  5HJA A;  2PLL A;  1TBL A;  4GWD A;  1P8P A;  1D3V A;  4FCK A;  1TBH A;  1ZPE A;  4HXQ A;  4MYL A;  4IXU A;  1HQG A;  4IE3 A;  4IXV A;  3MFV A;  4G3H A;  1P8Q A;  1WOI A;  4HWW A;  4CEV A;  4ITY A;  1HQH A;  3SL1 A;  3LP7 A;  4I06 A;  4Q3P A;  5RLA A;  4MYF A;  4Q3T A;  4Q3Q A;  1ZPG A;  3CEV A;  4GSM A;  1P8N A;  1RLA A;  3E8Z A;  1P8M A;  1T4P A;  1GQ6 A;  3TF3 A;  3SL0 A;  1WOG A;  3KV2 A;  2A0M A;  4MYK A;  3SJT A;  3THE A;  1HQ5 A;  1T5G A;  1TA1 A;  3E9B A;  4Q41 A;  3MJL A;  4GSZ A;  4RHM A;  1R1O A;  1T4T A;  1P8O A;  4IU4 A;  4RLA A;  3E6V A;  4IE2 A;  4Q3U A;  3RLA A;  4Q40 A;  3MFW A;  1WVB A;  2ZAV A;  3NIQ A;  1T4R A;  3TH7 A;  1HQX A;  3DJ8 A;  1GQ7 A;  1WVA A;  4IE1 A;  1HQF A;  2PHA A;  3MMR A;  2PHO A;  3THJ A;  2AEB A;  2RLA A;  1XFK A;  4RHI A;  4RHL A;  4GSV A;  4HZE A;  4Q3R A;  3E8Q A;  1P8R A;  2CEV A;  3M1R A;  4MYN A;  1CEV A;  4RHK A;  1WOH A;  2EIV A;  4IU0 A;  4RHQ A;  5HJ9 A; 
#chains in the Genus database with same CATH topology
 4GWC A;  5ICN B;  2EF5 A;  3NIO A;  5EFK B;  3SKK A;  3E6K A;  1T4S A;  3MZ4 A;  4MXR A;  5FCW A;  4QA6 A;  5EF8 A;  4Q3S A;  5THT A;  1TBJ A;  2VQM A;  4RHJ A;  5D1C A;  1T5F A;  5THU A;  3NIP A;  5JI5 A;  1T69 A;  3MAX A;  4BKX B;  3GN0 A;  1T64 A;  3GMZ A;  4IU1 A;  1P8S A;  3EZT A;  2V5X A;  5CEV A;  5G0I A;  1PQ3 A;  4FCI A;  4Q3V A;  4CBT A;  2VQJ A;  2VQO A;  4Q42 A;  3THH A;  2V5W A;  2EF4 A;  4Q3R C;  5EF7 A;  4ZUQ A;  3RQD A;  3LHL A;  5IWG A;  1C3R A;  2VQV A;  3MZ6 A;  4DZ4 A;  3PZL A;  4ZUO A;  4CBY A;  3F07 A;  5D1D A;  4IU5 A;  3LP4 A;  3F80 A;  5DC8 A;  5HJA A;  5EEK A;  4CQF A;  5EFN A;  3F0R A;  5DC5 A;  2PLL A;  1TBL A;  4QA7 A;  5G0J A;  4GWD A;  1P8P A;  1D3V A;  5EFB D;  3MZ7 A;  1C3P A;  4FCK A;  1TBH A;  3EW8 A;  5EFH A;  5G0G A;  1ZPE A;  4QA5 A;  4HXQ A;  4BZ6 A;  4MYL A;  4IXU A;  1HQG A;  4IE3 A;  3EZP A;  4IXV A;  3MFV A;  4QA4 A;  5EEM A;  4G3H A;  4ZUR A;  5G1C A;  4QA0 A;  1P8Q A;  1WOI A;  4HWW A;  4CEV A;  4ITY A;  1HQH A;  3SL1 A;  3LP7 A;  1ZZ1 A;  4I06 A;  4Q3P A;  5RLA A;  3F06 A;  5G0X A;  4QA2 A;  5G1A A;  5D1B A;  5EEN A;  4MYF A;  5DC7 A;  4Q3T A;  5EFG A;  5G3W A;  5G0Y A;  3Q9C A;  4Q3Q A;  2VQW G;  1ZPG A;  3CEV A;  3MEN A;  4GSM A;  5G0H A;  5G12 A;  5BWZ A;  5A2S A;  2GH6 A;  3C0Y A;  1P8N A;  5EEF A;  1RLA A;  4BZ9 A;  3E8Z A;  1P8M A;  1ZZ3 A;  1T4P A;  1GQ6 A;  5EFJ D;  5G17 A;  3TF3 A;  4RN2 A;  5G10 A;  3SL0 A;  5LI3 A;  1WOG A;  4RN1 A;  3KV2 A;  2A0M A;  2VQQ A;  4MYK A;  3SJT A;  3THE A;  1T67 A;  1HQ5 A;  4BZ5 A;  3Q9F A;  1T5G A;  1TA1 A;  5G11 A;  4ZUP A;  5G1B A;  3E9B A;  4Q41 A;  3MJL A;  4GSZ A;  4QA1 A;  1R1O A;  4RHM A;  1T4T A;  2VCG A;  4RN0 A;  1P8O A;  5EEI A;  5DC6 A;  4IU4 A;  3SFF A;  4RLA A;  3C10 A;  4LXZ A;  3E6V A;  3MZ3 A;  4A69 A;  4IE2 A;  4Q3U A;  3Q9E A;  3RLA A;  5FUE A;  4ZUN A;  4Q40 A;  3SFH A;  3MFW A;  1ZZ0 A;  1WVB A;  2ZAV A;  3NIQ A;  1T4R A;  1W22 A;  3TH7 A;  1HQX A;  4ZUM A;  5THS A;  3DJ8 A;  1GQ7 A;  1WVA A;  4BZ8 A;  1VKG A;  4LY1 A;  4IE1 A;  1HQF A;  2PHA A;  3C0Z A;  3MMR A;  2PHO A;  3EWF A;  3ZNS A;  3THJ A;  5G13 A;  2AEB A;  2RLA A;  1XFK A;  4RHI A;  5IX0 A;  4BZ7 A;  4RHL A;  1C3S A;  4GSV A;  3ZNR A;  4QA3 A;  4HZE A;  4Q3R A;  3E8Q A;  1P8R A;  2CEV A;  3M1R A;  4MYN A;  3Q9B A;  1CEV A;  4RHK A;  1WOH A;  2EIV A;  4IU0 A;  4RHQ A;  5THV A;  5HJ9 A; 
#chains in the Genus database with same CATH homology
 4GWC A;  2EF5 A;  3NIO A;  3SKK A;  3E6K A;  1T4S A;  4MXR A;  4Q3S A;  1TBJ A;  4RHJ A;  1T5F A;  3NIP A;  3GN0 A;  3GMZ A;  4IU1 A;  1P8S A;  5CEV A;  1PQ3 A;  4FCI A;  4Q3V A;  4Q42 A;  3THH A;  2EF4 A;  4Q3R C;  3LHL A;  4DZ4 A;  3PZL A;  4IU5 A;  3LP4 A;  3F80 A;  5HJA A;  2PLL A;  1TBL A;  4GWD A;  1P8P A;  1D3V A;  4FCK A;  1TBH A;  1ZPE A;  4HXQ A;  4MYL A;  4IXU A;  1HQG A;  4IE3 A;  4IXV A;  3MFV A;  4G3H A;  1P8Q A;  1WOI A;  4HWW A;  4CEV A;  4ITY A;  1HQH A;  3SL1 A;  3LP7 A;  4I06 A;  4Q3P A;  5RLA A;  4MYF A;  4Q3T A;  4Q3Q A;  1ZPG A;  3CEV A;  4GSM A;  1P8N A;  1RLA A;  3E8Z A;  1P8M A;  1T4P A;  1GQ6 A;  3TF3 A;  3SL0 A;  1WOG A;  3KV2 A;  2A0M A;  4MYK A;  3SJT A;  3THE A;  1HQ5 A;  1T5G A;  1TA1 A;  3E9B A;  4Q41 A;  3MJL A;  4GSZ A;  4RHM A;  1R1O A;  1T4T A;  1P8O A;  4IU4 A;  4RLA A;  3E6V A;  4IE2 A;  4Q3U A;  3RLA A;  4Q40 A;  3MFW A;  1WVB A;  2ZAV A;  3NIQ A;  1T4R A;  3TH7 A;  1HQX A;  3DJ8 A;  1GQ7 A;  1WVA A;  4IE1 A;  1HQF A;  2PHA A;  3MMR A;  2PHO A;  3THJ A;  2AEB A;  2RLA A;  1XFK A;  4RHI A;  4RHL A;  4GSV A;  4HZE A;  4Q3R A;  3E8Q A;  1P8R A;  2CEV A;  3M1R A;  4MYN A;  1CEV A;  4RHK A;  1WOH A;  2EIV A;  4IU0 A;  4RHQ A;  5HJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...