The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
53
|
sequence length |
208
|
structure length |
208
|
Chain Sequence |
SRLADFLGFRPKTGDIDVMNRQSVGSVTISQLAKGFYEPNIESAINDVHNFSIKDVGTIITNKTGVSPEGVSQTDYWAFSGTVTDDSLPPGSPITVLVFGLPVSATTGMTAIEFVAKVRVALQEAIASFTAINSYKDHPTDGSKLEVTYLDNQKHVLSTYSTYGITISQEIISESKPGYGTWNLLGAQTVTLDNQQTPTVFYHFERTA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of bacteriophage T4 gene product 11, the interface between the baseplate and short tail fibers.
pubmed doi rcsb |
molecule tags |
Structural protein
|
source organism |
Enterobacteria phage t4
|
molecule keywords |
BASEPLATE STRUCTURAL PROTEIN GP11
|
total genus |
53
|
structure length |
208
|
sequence length |
208
|
chains with identical sequence |
B, C
|
ec nomenclature | |
pdb deposition date | 2000-03-13 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF08677 | GP11 | GP11 baseplate wedge protein |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | GTP Cyclohydrolase I; Chain A, domain 1 | GTP Cyclohydrolase I; Chain A, domain 1 | ||
Mainly Beta | Single Sheet | Anthopleurin-A | Baseplate structural protein gp11 | ||
Alpha Beta | Alpha-Beta Complex | Baseplate Structural Protein Gp11; Chain: A, domain 3 | Baseplate Structural Protein Gp11; Chain: A, domain 3 |
#chains in the Genus database with same CATH superfamily 1EL6 A; #chains in the Genus database with same CATH topology 1GTP A; 1WUR A; 2LO0 A; 2WSE G; 2H9X A; 2WSF G; 1B8W A; 1EFU B; 1ZUF A; 1GKU B; 2QSH A; 5DMZ A; 4QPM A; 4DU6 A; 4E44 B; 2O01 G; 2P11 A; 1WUQ A; 2JTO A; 1SH1 A; 2MUB A; 1ZUE A; 4NE3 B; 1Z99 A; 1GL9 B; 4DRB J; 1H5O A; 1SHI A; 3LMS B; 3MCX A; 3B0B C; 1IS8 A; 4YIR A; 3MYV A; 2JR3 A; 1FBX A; 2IKD A; 2PN0 A; 4Q7J A; 1N3R A; 1D6B A; 1AHL A; 1EL6 A; 1ZHH B; 4E45 B; 2QSG A; 4GV5 A; 2K2X A; 1N3S A; 1A9C A; 2LNZ A; 4NE5 B; 4NE6 B; 1AIP C; 3IF4 A; 4JA3 A; 3LW5 G; 1BDS A; 3BMB A; 2BDS A; 1APF A; 2KR1 A; 2XXL A; 1ATX A; 3KEZ A; 1FB1 A; 2IKE A; 2HJ9 C; 3LW5 K; 1WPL A; 2MN3 A; 2RNG A; 3D4U B; 1A8R A; 4DRA E; 2HJE A; 1ZLH B; 1WXN A; 2QSF A; 1WQK A; 1WM9 A; 2WSC K; 3C38 A; 2DLA A; 1IS7 A; 2B9K A; 1ZLI B; 3C30 A; 2WSC G; 2WSE K; 4R8Q A; 1N3T A; 2SH1 A; 1TFE A; 2WSF K; 3VEJ A; #chains in the Genus database with same CATH homology 4NE3 B; 4E45 B; 1GTP A; 1WUR A; 2LO0 A; 1FB1 A; 1N3S A; 1A9C A; 1WPL A; 2LNZ A; 4DRB J; 1A8R A; 4NE5 B; 1EFU B; 4DRA E; 4NE6 B; 1AIP C; 4JA3 A; 1WM9 A; 5DMZ A; 1IS7 A; 3B0B C; 1IS8 A; 3BMB A; 4QPM A; 4DU6 A; 4E44 B; 2KR1 A; 1FBX A; 4R8Q A; 2P11 A; 1N3T A; 1WUQ A; 2PN0 A; 4Q7J A; 1N3R A; 1TFE A; 1EL6 A; 3VEJ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...