The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
175
|
sequence length |
535
|
structure length |
535
|
Chain Sequence |
RLEPRVEERDGFWVLKEEFRSGINPAEKVKIEKDPMKLFIEDGISDLATLSMEEVDKSKHNKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLPNGVTTSEQTRYLASVIKKYGKDGCADVTTRQNWQIRGVVLPDVPEIIKGLESVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPFTNLISQFVTANSRGNLSITNLPRKWNPCVIGSHDLYEHPHINDLAYMPATKNGKFGFNLLVGGFFSIKRCEEAIPLDAWVSAEDVVPVCKAMLEAFRDLGFRGNRQKCRMMWLIDELGMEAFRGEVEKRMPEQVLERASSEELVQKDWERREYLGVHPQKQQGLSFVGLHIPVGRLQADEMEELARIADVYGSGELRLTVEQNIIIPNVENSKIDSLLNEPLLKERYSPEPPILMKGLVACTGSQFCGQAIIETKARALKVTEEVQRLVSVTRPVRMHWTGCPNSCGQVQVADIGFMGCMTRDENGKPCEGADVFVGGRIGSDSHLGDIYKKAVPCKDLVPVVAEILINQFGAVPR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of Spinach Nitrite Reductase: Implications for Multi-electron Reactions by the Iron-Sulfur:Siroheme Cofactor
pubmed doi rcsb |
molecule tags |
Oxidoreductase
|
source organism |
Spinacia oleracea
|
molecule keywords |
Ferredoxin--nitrite reductase, chloroplast
|
total genus |
175
|
structure length |
535
|
sequence length |
535
|
ec nomenclature |
ec
1.7.7.1: Ferredoxin--nitrite reductase. |
pdb deposition date | 2005-08-03 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01077 | NIR_SIR | Nitrite and sulphite reductase 4Fe-4S domain |
A | PF03460 | NIR_SIR_ferr | Nitrite/Sulfite reductase ferredoxin-like half domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Sulfite Reductase Hemoprotein; domain 1 | Sulfite Reductase Hemoprotein, domain 1 | ||
Alpha Beta | 2-Layer Sandwich | Sulfite Reductase Hemoprotein; domain 1 | Sulfite Reductase Hemoprotein, domain 1 | ||
Alpha Beta | Alpha-Beta Complex | Sulfite Reductase Hemoprotein; domain 2 | Sulfite Reductase Hemoprotein; domain 2 |
#chains in the Genus database with same CATH superfamily 3MMA B; 2GEP A; 4S3C A; 2V4J A; 4AOP A; 4S3D A; 3MM5 A; 3VKT A; 2V4J B; 3B0G A; 3GEO A; 4S39 A; 2AKJ A; 3VLY A; 7GEP A; 3MM5 B; 4S3E A; 3VKQ A; 2AOP A; 3MM8 A; 5AOP A; 1ZJ9 A; 3MM8 B; 4G9P A; 3VLX A; 4S38 A; 4GEP A; 4S23 A; 3MMB A; 3MM6 A; 3VKR A; 3MMB B; 3AOP A; 3MM6 B; 3VKP A; 5GEP A; 4G38 A; 3B0H A; 4S3B A; 3B0L A; 4S3A A; 6GEP A; 8GEP A; 2Y0F A; 1ZJ8 A; 3VKS A; 3MM9 A; 3VM0 A; 3B0J A; 3OR1 B; 3B0M A; 3MM9 B; 3MM7 A; 4G39 A; 3VLZ A; 3VM1 A; 3NOY A; 2XSJ A; 3MM7 B; 3MMC A; 3OR1 A; 3OR2 A; 4S3F A; 3MMC B; 3MMA A; 4HTR A; 2XSJ B; 1AOP A; 3OR2 B; 3B0N A; #chains in the Genus database with same CATH topology 3MMA B; 2GEP A; 4S3C A; 2V4J A; 4AOP A; 4S3D A; 3MM5 A; 3VKT A; 2V4J B; 3B0G A; 3GEO A; 4S39 A; 2AKJ A; 3VLY A; 7GEP A; 3MM5 B; 4S3E A; 3VKQ A; 2AOP A; 3MM8 A; 5AOP A; 1ZJ9 A; 3MM8 B; 4G9P A; 3VLX A; 4S38 A; 4GEP A; 4S23 A; 3MMB A; 3MM6 A; 3VKR A; 3MMB B; 3AOP A; 3MM6 B; 3VKP A; 5GEP A; 4G38 A; 3B0H A; 4S3B A; 3B0L A; 4S3A A; 6GEP A; 8GEP A; 2Y0F A; 1ZJ8 A; 3VKS A; 3MM9 A; 3VM0 A; 3B0J A; 3OR1 B; 3B0M A; 3MM9 B; 3MM7 A; 4G39 A; 3VLZ A; 3VM1 A; 3NOY A; 2XSJ A; 3MM7 B; 3MMC A; 3OR1 A; 3OR2 A; 4S3F A; 3MMC B; 3MMA A; 4HTR A; 2XSJ B; 1AOP A; 3OR2 B; 3B0N A; #chains in the Genus database with same CATH homology 3MMA B; 2GEP A; 4S3C A; 2V4J A; 4AOP A; 4S3D A; 3MM5 A; 3VKT A; 2V4J B; 3B0G A; 3GEO A; 4S39 A; 2AKJ A; 3VLY A; 7GEP A; 3MM5 B; 4S3E A; 3VKQ A; 2AOP A; 3MM8 A; 5AOP A; 1ZJ9 A; 3MM8 B; 4G9P A; 3VLX A; 4S38 A; 4GEP A; 4S23 A; 3MMB A; 3MM6 A; 3VKR A; 3MMB B; 3AOP A; 3MM6 B; 3VKP A; 5GEP A; 4G38 A; 3B0H A; 4S3B A; 3B0L A; 4S3A A; 6GEP A; 8GEP A; 2Y0F A; 1ZJ8 A; 3VKS A; 3MM9 A; 3VM0 A; 3B0J A; 3OR1 B; 3B0M A; 3MM9 B; 3MM7 A; 4G39 A; 3VLZ A; 3VM1 A; 3NOY A; 2XSJ A; 3MM7 B; 3MMC A; 3OR1 A; 3OR2 A; 4S3F A; 3MMC B; 3MMA A; 4HTR A; 2XSJ B; 1AOP A; 3OR2 B; 3B0N A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...