2AKJA

Structure of spinach nitrite reductase
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
535
structure length
535
Chain Sequence
RLEPRVEERDGFWVLKEEFRSGINPAEKVKIEKDPMKLFIEDGISDLATLSMEEVDKSKHNKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLPNGVTTSEQTRYLASVIKKYGKDGCADVTTRQNWQIRGVVLPDVPEIIKGLESVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPFTNLISQFVTANSRGNLSITNLPRKWNPCVIGSHDLYEHPHINDLAYMPATKNGKFGFNLLVGGFFSIKRCEEAIPLDAWVSAEDVVPVCKAMLEAFRDLGFRGNRQKCRMMWLIDELGMEAFRGEVEKRMPEQVLERASSEELVQKDWERREYLGVHPQKQQGLSFVGLHIPVGRLQADEMEELARIADVYGSGELRLTVEQNIIIPNVENSKIDSLLNEPLLKERYSPEPPILMKGLVACTGSQFCGQAIIETKARALKVTEEVQRLVSVTRPVRMHWTGCPNSCGQVQVADIGFMGCMTRDENGKPCEGADVFVGGRIGSDSHLGDIYKKAVPCKDLVPVVAEILINQFGAVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Spinach Nitrite Reductase: Implications for Multi-electron Reactions by the Iron-Sulfur:Siroheme Cofactor
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Oxidoreductase
molecule keywords Ferredoxin--nitrite reductase, chloroplast
total genus 175
structure length 535
sequence length 535
ec nomenclature ec 1.7.7.1: Ferredoxin--nitrite reductase.
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01077 NIR_SIR Nitrite and sulphite reductase 4Fe-4S domain
A PF03460 NIR_SIR_ferr Nitrite/Sulfite reductase ferredoxin-like half domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 2akjA02
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 2akjA03
3.90.480.20 Alpha Beta Alpha-Beta Complex Sulfite Reductase Hemoprotein; domain 2 Sulfite Reductase Hemoprotein; domain 2 2akjA01
3MM7B 3MM9B 4AOPA 4S3FA 2V4JB 2GEPA 2Y0FA 3B0JA 3GEOA 4HTRA 4S3AA 3VM0A 2XSJB 3VLXA 2V4JA 4G9PA 2XSJA 2AOPA 3B0NA 3MM9A 3MM7A 4S3DA 3MMAB 3OR2A 5GEPA 7GEPA 4S3EA 3VLYA 3MM6B 3VKRA 3NOYA 3OR1A 8GEPA 3MMCA 6GEPA 3MM8B 3MM5A 3VM1A 1ZJ8A 3MMBB 3VKQA 1ZJ9A 3VLZA 3MM6A 4S3BA 3B0LA 5AOPA 3MMCB 3MM5B 3MM8A 4G39A 3B0HA 3MMBA 3OR1B 4S38A 4S3CA 3B0GA 3AOPA 4G38A 3VKPA 4GEPA 4S39A 2AKJA 3MMAA 3VKTA 3VKSA 3OR2B 3B0MA 4S23A 1AOPA
chains in the Genus database with same CATH superfamily
3MM7B 3MM9B 4AOPA 4S3FA 2V4JB 2GEPA 2Y0FA 3B0JA 3GEOA 4HTRA 4S3AA 3VM0A 2XSJB 3VLXA 2V4JA 4G9PA 2XSJA 2AOPA 3B0NA 3MM9A 3MM7A 4S3DA 3MMAB 3OR2A 5GEPA 7GEPA 4S3EA 3VLYA 3MM6B 3VKRA 3NOYA 3OR1A 8GEPA 3MMCA 6GEPA 3MM8B 3MM5A 3VM1A 1ZJ8A 3MMBB 3VKQA 1ZJ9A 3VLZA 3MM6A 4S3BA 3B0LA 5AOPA 3MMCB 3MM5B 3MM8A 4G39A 3B0HA 3MMBA 3OR1B 4S38A 4S3CA 3B0GA 3AOPA 4G38A 3VKPA 4GEPA 4S39A 2AKJA 3MMAA 3VKTA 3VKSA 3OR2B 3B0MA 4S23A 1AOPA
chains in the Genus database with same CATH topology
3MM7B 3MM9B 4AOPA 4S3FA 2V4JB 2GEPA 2Y0FA 3B0JA 3GEOA 4HTRA 4S3AA 3VM0A 2XSJB 3VLXA 2V4JA 4G9PA 2XSJA 2AOPA 3B0NA 3MM9A 3MM7A 4S3DA 3MMAB 3OR2A 5GEPA 7GEPA 4S3EA 3VLYA 3MM6B 3VKRA 3NOYA 3OR1A 8GEPA 3MMCA 6GEPA 3MM8B 3MM5A 3VM1A 1ZJ8A 3MMBB 3VKQA 1ZJ9A 3VLZA 3MM6A 4S3BA 3B0LA 5AOPA 3MMCB 3MM5B 3MM8A 4G39A 3B0HA 3MMBA 3OR1B 4S38A 4S3CA 3B0GA 3AOPA 4G38A 3VKPA 4GEPA 4S39A 2AKJA 3MMAA 3VKTA 3VKSA 3OR2B 3B0MA 4S23A 1AOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MM7 B;  3MM9 B;  4AOP A;  4S3F A;  2V4J B;  2GEP A;  2Y0F A;  3B0J A;  3GEO A;  4HTR A;  4S3A A;  3VM0 A;  2XSJ B;  3VLX A;  2V4J A;  4G9P A;  2XSJ A;  2AOP A;  3B0N A;  3MM9 A;  3MM7 A;  4S3D A;  3MMA B;  3OR2 A;  5GEP A;  7GEP A;  4S3E A;  3VLY A;  3MM6 B;  3VKR A;  3NOY A;  3OR1 A;  8GEP A;  3MMC A;  6GEP A;  3MM8 B;  3MM5 A;  3VM1 A;  1ZJ8 A;  3MMB B;  3VKQ A;  1ZJ9 A;  3VLZ A;  3MM6 A;  4S3B A;  3B0L A;  5AOP A;  3MMC B;  3MM5 B;  3MM8 A;  4G39 A;  3B0H A;  3MMB A;  3OR1 B;  4S38 A;  4S3C A;  3B0G A;  3AOP A;  4G38 A;  3VKP A;  4GEP A;  4S39 A;  2AKJ A;  3MMA A;  3VKT A;  3VKS A;  3OR2 B;  3B0M A;  4S23 A;  1AOP A; 
#chains in the Genus database with same CATH topology
 3MM7 B;  3MM9 B;  4AOP A;  4S3F A;  2V4J B;  2GEP A;  2Y0F A;  3B0J A;  3GEO A;  4HTR A;  4S3A A;  3VM0 A;  2XSJ B;  3VLX A;  2V4J A;  4G9P A;  2XSJ A;  2AOP A;  3B0N A;  3MM9 A;  3MM7 A;  4S3D A;  3MMA B;  3OR2 A;  5GEP A;  7GEP A;  4S3E A;  3VLY A;  3MM6 B;  3VKR A;  3NOY A;  3OR1 A;  8GEP A;  3MMC A;  6GEP A;  3MM8 B;  3MM5 A;  3VM1 A;  1ZJ8 A;  3MMB B;  3VKQ A;  1ZJ9 A;  3VLZ A;  3MM6 A;  4S3B A;  3B0L A;  5AOP A;  3MMC B;  3MM5 B;  3MM8 A;  4G39 A;  3B0H A;  3MMB A;  3OR1 B;  4S38 A;  4S3C A;  3B0G A;  3AOP A;  4G38 A;  3VKP A;  4GEP A;  4S39 A;  2AKJ A;  3MMA A;  3VKT A;  3VKS A;  3OR2 B;  3B0M A;  4S23 A;  1AOP A; 
#chains in the Genus database with same CATH homology
 3MM7 B;  3MM9 B;  4AOP A;  4S3F A;  2V4J B;  2GEP A;  2Y0F A;  3B0J A;  3GEO A;  4HTR A;  4S3A A;  3VM0 A;  2XSJ B;  3VLX A;  2V4J A;  4G9P A;  2XSJ A;  2AOP A;  3B0N A;  3MM9 A;  3MM7 A;  4S3D A;  3MMA B;  3OR2 A;  5GEP A;  7GEP A;  4S3E A;  3VLY A;  3MM6 B;  3VKR A;  3NOY A;  3OR1 A;  8GEP A;  3MMC A;  6GEP A;  3MM8 B;  3MM5 A;  3VM1 A;  1ZJ8 A;  3MMB B;  3VKQ A;  1ZJ9 A;  3VLZ A;  3MM6 A;  4S3B A;  3B0L A;  5AOP A;  3MMC B;  3MM5 B;  3MM8 A;  4G39 A;  3B0H A;  3MMB A;  3OR1 B;  4S38 A;  4S3C A;  3B0G A;  3AOP A;  4G38 A;  3VKP A;  4GEP A;  4S39 A;  2AKJ A;  3MMA A;  3VKT A;  3VKS A;  3OR2 B;  3B0M A;  4S23 A;  1AOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...