2AKJA

Structure of spinach nitrite reductase
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
535
structure length
535
Chain Sequence
b'RLEPRVEERDGFWVLKEEFRSGINPAEKVKIEKDPMKLFIEDGISDLATLSMEEVDKSKHNKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLPNGVTTSEQTRYLASVIKKYGKDGCADVTTRQNWQIRGVVLPDVPEIIKGLESVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPFTNLISQFVTANSRGNLSITNLPRKWNPCVIGSHDLYEHPHINDLAYMPATKNGKFGFNLLVGGFFSIKRCEEAIPLDAWVSAEDVVPVCKAMLEAFRDLGFRGNRQKCRMMWLIDELGMEAFRGEVEKRMPEQVLERASSEELVQKDWERREYLGVHPQKQQGLSFVGLHIPVGRLQADEMEELARIADVYGSGELRLTVEQNIIIPNVENSKIDSLLNEPLLKERYSPEPPILMKGLVACTGSQFCGQAIIETKARALKVTEEVQRLVSVTRPVRMHWTGCPNSCGQVQVADIGFMGCMTRDENGKPCEGADVFVGGRIGSDSHLGDIYKKAVPCKDLVPVVAEILINQFGAVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ferredoxin--nitrite reductase, chloroplast
publication title Structure of Spinach Nitrite Reductase: Implications for Multi-electron Reactions by the Iron-Sulfur:Siroheme Cofactor
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Oxidoreductase
total genus 175
structure length 535
sequence length 535
ec nomenclature ec 1.7.7.1: Ferredoxin--nitrite reductase.
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01077 NIR_SIR Nitrite and sulphite reductase 4Fe-4S domain
A PF03460 NIR_SIR_ferr Nitrite/Sulfite reductase ferredoxin-like half domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 2akjA02
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 2akjA03
3.90.480.20 Alpha Beta Alpha-Beta Complex Sulfite Reductase Hemoprotein; domain 2 Sulfite Reductase Hemoprotein; domain 2 2akjA01
4S23A 3MM5A 3VLZA 4GEPA 3VKQA 3B0HA 2XSJB 2Y0FA 3MMAB 3MM9B 3MMBB 3OR2A 3VKPA 3B0MA 4S39A 1ZJ8A 4S3CA 3OR1B 3VKRA 3AOPA 4S3EA 3NOYA 3MM8A 3MMCA 3VKSA 4S3BA 3MM7A 3MM5B 3MM6A 2AKJA 4G39A 3VM1A 2V4JA 4S3FA 1AOPA 5GEPA 3B0GA 3B0LA 3VLXA 4G38A 3B0JA 8GEPA 3VKTA 3OR2B 1ZJ9A 4S3DA 4S3AA 3VM0A 3MM8B 3MMCB 4G9PA 3GEOA 4S38A 3MMAA 3MM7B 5AOPA 4AOPA 2GEPA 2XSJA 2V4JB 3MM6B 3MMBA 3VLYA 3MM9A 4HTRA 7GEPA 2AOPA 3OR1A 6GEPA 3B0NA
chains in the Genus database with same CATH superfamily
4S23A 3MM5A 3VLZA 4GEPA 3VKQA 3B0HA 2XSJB 2Y0FA 3MMAB 3MM9B 3MMBB 3OR2A 3VKPA 3B0MA 4S39A 1ZJ8A 4S3CA 3OR1B 3VKRA 3AOPA 4S3EA 3NOYA 3MM8A 3MMCA 3VKSA 4S3BA 3MM7A 3MM5B 3MM6A 2AKJA 4G39A 3VM1A 2V4JA 4S3FA 1AOPA 5GEPA 3B0GA 3B0LA 3VLXA 4G38A 3B0JA 8GEPA 3VKTA 3OR2B 1ZJ9A 4S3DA 4S3AA 3VM0A 3MM8B 3MMCB 4G9PA 3GEOA 4S38A 3MMAA 3MM7B 5AOPA 4AOPA 2GEPA 2XSJA 2V4JB 3MM6B 3MMBA 3VLYA 3MM9A 4HTRA 7GEPA 2AOPA 3OR1A 6GEPA 3B0NA
chains in the Genus database with same CATH topology
4S23A 3MM5A 3VLZA 4GEPA 3VKQA 3B0HA 2XSJB 2Y0FA 3MMAB 3MM9B 3MMBB 3OR2A 3VKPA 3B0MA 4S39A 1ZJ8A 4S3CA 3OR1B 3VKRA 3AOPA 4S3EA 3NOYA 3MM8A 3MMCA 3VKSA 4S3BA 3MM7A 3MM5B 3MM6A 2AKJA 4G39A 3VM1A 2V4JA 4S3FA 1AOPA 5GEPA 3B0GA 3B0LA 3VLXA 4G38A 3B0JA 8GEPA 3VKTA 3OR2B 1ZJ9A 4S3DA 4S3AA 3VM0A 3MM8B 3MMCB 4G9PA 3GEOA 4S38A 3MMAA 3MM7B 5AOPA 4AOPA 2GEPA 2XSJA 2V4JB 3MM6B 3MMBA 3VLYA 3MM9A 4HTRA 7GEPA 2AOPA 3OR1A 6GEPA 3B0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S23 A;  3MM5 A;  3VLZ A;  4GEP A;  3VKQ A;  3B0H A;  2XSJ B;  2Y0F A;  3MMA B;  3MM9 B;  3MMB B;  3OR2 A;  3VKP A;  3B0M A;  4S39 A;  1ZJ8 A;  4S3C A;  3OR1 B;  3VKR A;  3AOP A;  4S3E A;  3NOY A;  3MM8 A;  3MMC A;  3VKS A;  4S3B A;  3MM7 A;  3MM5 B;  3MM6 A;  2AKJ A;  4G39 A;  3VM1 A;  2V4J A;  4S3F A;  1AOP A;  5GEP A;  3B0G A;  3B0L A;  3VLX A;  4G38 A;  3B0J A;  8GEP A;  3VKT A;  3OR2 B;  1ZJ9 A;  4S3D A;  4S3A A;  3VM0 A;  3MM8 B;  3MMC B;  4G9P A;  3GEO A;  4S38 A;  3MMA A;  3MM7 B;  5AOP A;  4AOP A;  2GEP A;  2XSJ A;  2V4J B;  3MM6 B;  3MMB A;  3VLY A;  3MM9 A;  4HTR A;  7GEP A;  2AOP A;  3OR1 A;  6GEP A;  3B0N A; 
#chains in the Genus database with same CATH topology
 4S23 A;  3MM5 A;  3VLZ A;  4GEP A;  3VKQ A;  3B0H A;  2XSJ B;  2Y0F A;  3MMA B;  3MM9 B;  3MMB B;  3OR2 A;  3VKP A;  3B0M A;  4S39 A;  1ZJ8 A;  4S3C A;  3OR1 B;  3VKR A;  3AOP A;  4S3E A;  3NOY A;  3MM8 A;  3MMC A;  3VKS A;  4S3B A;  3MM7 A;  3MM5 B;  3MM6 A;  2AKJ A;  4G39 A;  3VM1 A;  2V4J A;  4S3F A;  1AOP A;  5GEP A;  3B0G A;  3B0L A;  3VLX A;  4G38 A;  3B0J A;  8GEP A;  3VKT A;  3OR2 B;  1ZJ9 A;  4S3D A;  4S3A A;  3VM0 A;  3MM8 B;  3MMC B;  4G9P A;  3GEO A;  4S38 A;  3MMA A;  3MM7 B;  5AOP A;  4AOP A;  2GEP A;  2XSJ A;  2V4J B;  3MM6 B;  3MMB A;  3VLY A;  3MM9 A;  4HTR A;  7GEP A;  2AOP A;  3OR1 A;  6GEP A;  3B0N A; 
#chains in the Genus database with same CATH homology
 4S23 A;  3MM5 A;  3VLZ A;  4GEP A;  3VKQ A;  3B0H A;  2XSJ B;  2Y0F A;  3MMA B;  3MM9 B;  3MMB B;  3OR2 A;  3VKP A;  3B0M A;  4S39 A;  1ZJ8 A;  4S3C A;  3OR1 B;  3VKR A;  3AOP A;  4S3E A;  3NOY A;  3MM8 A;  3MMC A;  3VKS A;  4S3B A;  3MM7 A;  3MM5 B;  3MM6 A;  2AKJ A;  4G39 A;  3VM1 A;  2V4J A;  4S3F A;  1AOP A;  5GEP A;  3B0G A;  3B0L A;  3VLX A;  4G38 A;  3B0J A;  8GEP A;  3VKT A;  3OR2 B;  1ZJ9 A;  4S3D A;  4S3A A;  3VM0 A;  3MM8 B;  3MMC B;  4G9P A;  3GEO A;  4S38 A;  3MMA A;  3MM7 B;  5AOP A;  4AOP A;  2GEP A;  2XSJ A;  2V4J B;  3MM6 B;  3MMB A;  3VLY A;  3MM9 A;  4HTR A;  7GEP A;  2AOP A;  3OR1 A;  6GEP A;  3B0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...