2AKJA

Structure of spinach nitrite reductase
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
535
structure length
535
Chain Sequence
RLEPRVEERDGFWVLKEEFRSGINPAEKVKIEKDPMKLFIEDGISDLATLSMEEVDKSKHNKDDIDVRLKWLGLFHRRKHHYGRFMMRLKLPNGVTTSEQTRYLASVIKKYGKDGCADVTTRQNWQIRGVVLPDVPEIIKGLESVGLTSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPFTNLISQFVTANSRGNLSITNLPRKWNPCVIGSHDLYEHPHINDLAYMPATKNGKFGFNLLVGGFFSIKRCEEAIPLDAWVSAEDVVPVCKAMLEAFRDLGFRGNRQKCRMMWLIDELGMEAFRGEVEKRMPEQVLERASSEELVQKDWERREYLGVHPQKQQGLSFVGLHIPVGRLQADEMEELARIADVYGSGELRLTVEQNIIIPNVENSKIDSLLNEPLLKERYSPEPPILMKGLVACTGSQFCGQAIIETKARALKVTEEVQRLVSVTRPVRMHWTGCPNSCGQVQVADIGFMGCMTRDENGKPCEGADVFVGGRIGSDSHLGDIYKKAVPCKDLVPVVAEILINQFGAVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Spinach Nitrite Reductase: Implications for Multi-electron Reactions by the Iron-Sulfur:Siroheme Cofactor
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Oxidoreductase
molecule keywords Ferredoxin--nitrite reductase, chloroplast
total genus 175
structure length 535
sequence length 535
ec nomenclature ec 1.7.7.1: Ferredoxin--nitrite reductase.
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01077 NIR_SIR Nitrite and sulphite reductase 4Fe-4S domain
A PF03460 NIR_SIR_ferr Nitrite/Sulfite reductase ferredoxin-like half domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 2akjA02
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 2akjA03
3.90.480.20 Alpha Beta Alpha-Beta Complex Sulfite Reductase Hemoprotein; domain 2 Sulfite Reductase Hemoprotein; domain 2 2akjA01
4S39A 4S38A 3MMBA 4HTRA 4AOPA 3MM5B 4S3FA 3MM9B 3VKSA 3VLZA 3GEOA 3MMBB 4GEPA 6GEPA 3B0GA 7GEPA 3AOPA 3B0HA 2AOPA 2XSJB 3VLXA 1ZJ9A 3OR2A 2AKJA 3NOYA 3MMAA 4G39A 2Y0FA 5AOPA 3B0MA 3VM1A 1ZJ8A 3MM7A 4S23A 3VKQA 3VLYA 3MM6A 3MM8A 3MMAB 2GEPA 2V4JA 3OR1B 4G38A 3OR2B 3MM7B 3MMCB 4S3AA 3VKTA 3VKRA 4S3CA 3MMCA 4S3EA 3B0LA 5GEPA 8GEPA 2V4JB 3B0JA 3MM8B 3MM6B 3OR1A 3MM9A 3B0NA 3MM5A 4G9PA 1AOPA 2XSJA 3VM0A 4S3DA 3VKPA 4S3BA
chains in the Genus database with same CATH superfamily
4S39A 4S38A 3MMBA 4HTRA 4AOPA 3MM5B 4S3FA 3MM9B 3VKSA 3VLZA 3GEOA 3MMBB 4GEPA 6GEPA 3B0GA 7GEPA 3AOPA 3B0HA 2AOPA 2XSJB 3VLXA 1ZJ9A 3OR2A 2AKJA 3NOYA 3MMAA 4G39A 2Y0FA 5AOPA 3B0MA 3VM1A 1ZJ8A 3MM7A 4S23A 3VKQA 3VLYA 3MM6A 3MM8A 3MMAB 2GEPA 2V4JA 3OR1B 4G38A 3OR2B 3MM7B 3MMCB 4S3AA 3VKTA 3VKRA 4S3CA 3MMCA 4S3EA 3B0LA 5GEPA 8GEPA 2V4JB 3B0JA 3MM8B 3MM6B 3OR1A 3MM9A 3B0NA 3MM5A 4G9PA 1AOPA 2XSJA 3VM0A 4S3DA 3VKPA 4S3BA
chains in the Genus database with same CATH topology
4S39A 4S38A 3MMBA 4HTRA 4AOPA 3MM5B 4S3FA 3MM9B 3VKSA 3VLZA 3GEOA 3MMBB 4GEPA 6GEPA 3B0GA 7GEPA 3AOPA 3B0HA 2AOPA 2XSJB 3VLXA 1ZJ9A 3OR2A 2AKJA 3NOYA 3MMAA 4G39A 2Y0FA 5AOPA 3B0MA 3VM1A 1ZJ8A 3MM7A 4S23A 3VKQA 3VLYA 3MM6A 3MM8A 3MMAB 2GEPA 2V4JA 3OR1B 4G38A 3OR2B 3MM7B 3MMCB 4S3AA 3VKTA 3VKRA 4S3CA 3MMCA 4S3EA 3B0LA 5GEPA 8GEPA 2V4JB 3B0JA 3MM8B 3MM6B 3OR1A 3MM9A 3B0NA 3MM5A 4G9PA 1AOPA 2XSJA 3VM0A 4S3DA 3VKPA 4S3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S39 A;  4S38 A;  3MMB A;  4HTR A;  4AOP A;  3MM5 B;  4S3F A;  3MM9 B;  3VKS A;  3VLZ A;  3GEO A;  3MMB B;  4GEP A;  6GEP A;  3B0G A;  7GEP A;  3AOP A;  3B0H A;  2AOP A;  2XSJ B;  3VLX A;  1ZJ9 A;  3OR2 A;  2AKJ A;  3NOY A;  3MMA A;  4G39 A;  2Y0F A;  5AOP A;  3B0M A;  3VM1 A;  1ZJ8 A;  3MM7 A;  4S23 A;  3VKQ A;  3VLY A;  3MM6 A;  3MM8 A;  3MMA B;  2GEP A;  2V4J A;  3OR1 B;  4G38 A;  3OR2 B;  3MM7 B;  3MMC B;  4S3A A;  3VKT A;  3VKR A;  4S3C A;  3MMC A;  4S3E A;  3B0L A;  5GEP A;  8GEP A;  2V4J B;  3B0J A;  3MM8 B;  3MM6 B;  3OR1 A;  3MM9 A;  3B0N A;  3MM5 A;  4G9P A;  1AOP A;  2XSJ A;  3VM0 A;  4S3D A;  3VKP A;  4S3B A; 
#chains in the Genus database with same CATH topology
 4S39 A;  4S38 A;  3MMB A;  4HTR A;  4AOP A;  3MM5 B;  4S3F A;  3MM9 B;  3VKS A;  3VLZ A;  3GEO A;  3MMB B;  4GEP A;  6GEP A;  3B0G A;  7GEP A;  3AOP A;  3B0H A;  2AOP A;  2XSJ B;  3VLX A;  1ZJ9 A;  3OR2 A;  2AKJ A;  3NOY A;  3MMA A;  4G39 A;  2Y0F A;  5AOP A;  3B0M A;  3VM1 A;  1ZJ8 A;  3MM7 A;  4S23 A;  3VKQ A;  3VLY A;  3MM6 A;  3MM8 A;  3MMA B;  2GEP A;  2V4J A;  3OR1 B;  4G38 A;  3OR2 B;  3MM7 B;  3MMC B;  4S3A A;  3VKT A;  3VKR A;  4S3C A;  3MMC A;  4S3E A;  3B0L A;  5GEP A;  8GEP A;  2V4J B;  3B0J A;  3MM8 B;  3MM6 B;  3OR1 A;  3MM9 A;  3B0N A;  3MM5 A;  4G9P A;  1AOP A;  2XSJ A;  3VM0 A;  4S3D A;  3VKP A;  4S3B A; 
#chains in the Genus database with same CATH homology
 4S39 A;  4S38 A;  3MMB A;  4HTR A;  4AOP A;  3MM5 B;  4S3F A;  3MM9 B;  3VKS A;  3VLZ A;  3GEO A;  3MMB B;  4GEP A;  6GEP A;  3B0G A;  7GEP A;  3AOP A;  3B0H A;  2AOP A;  2XSJ B;  3VLX A;  1ZJ9 A;  3OR2 A;  2AKJ A;  3NOY A;  3MMA A;  4G39 A;  2Y0F A;  5AOP A;  3B0M A;  3VM1 A;  1ZJ8 A;  3MM7 A;  4S23 A;  3VKQ A;  3VLY A;  3MM6 A;  3MM8 A;  3MMA B;  2GEP A;  2V4J A;  3OR1 B;  4G38 A;  3OR2 B;  3MM7 B;  3MMC B;  4S3A A;  3VKT A;  3VKR A;  4S3C A;  3MMC A;  4S3E A;  3B0L A;  5GEP A;  8GEP A;  2V4J B;  3B0J A;  3MM8 B;  3MM6 B;  3OR1 A;  3MM9 A;  3B0N A;  3MM5 A;  4G9P A;  1AOP A;  2XSJ A;  3VM0 A;  4S3D A;  3VKP A;  4S3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...