3OR2A

Crystal structure of dissimilatory sulfite reductase ii (dsrii)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
435
structure length
435
Chain Sequence
KHPTPMLDELEKGPWPSFVSDIKQECDNRAKNPKGLDYQIPAECPDDLLGILELSFHEGETHWKHGGIVGVFGYGGGVIGRYCDQPEMFPGVAHFHTVRLAQPAAKYYTAEYLEAICDVWDLRGSGLTNMHGSTGDIVLLGTQTPQLEEIFFEMTHNLNTDLGGSGSNLRTPESCLGISRCEFACYDTQLMCYQLTQDYQDELHRPAFPYKFKFKFDGCPNGCVASMARSDFAVIGTWKDDIKIDQEAVKAYVGGEFKPNAGAHAGRDWGKFDIEAEVVGLCPTGCMTYESGTLSIDNKNCTRCMHCINTMPRALKIGDERGASILVGAKAPVLDGAQMGSLLIPFIAAEEPFDEVKEVIENIWEWWMEEGKNRERLGETMKRVGFQKLLEVTGTKAVPQHVSEPRHNPYIFFKEEEVPGGWSRDISDYRKRHMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissimilatory Sulfite Reductase, Sulfate Reduction
rcsb
molecule tags Oxidoreductase
molecule keywords Sulfite redcutase subunit alpha
total genus 122
structure length 435
sequence length 435
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01077 NIR_SIR Nitrite and sulphite reductase 4Fe-4S domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3or2A04
3.30.70.2500 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3or2A02
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 3or2A03
1BD6A 5CH7B 1FXDA 3B0LA 1FRXA 1GTHA 1B0TA 1ZJ8A 3MM6A 4S23A 4S3DA 5E7OB 4S39A 1A6LA 3GYXB 2VPYB 3IR6B 3OR1B 2C3UA 2C3PA 2WSEC 3EGWB 7FD1A 1ROFA 4S3CA 3MMBB 4YDDB 4S3EA 1IR0A 2PDAA 1FRHA 2VPZB 3VKQA 5GEPA 1AXQA 1Y5LB 3EXYA 4XK8C 4S3AA 2C42A 4S3BA 4AOPA 3OR2B 1KQGB 3IR7B 3LW5C 3B0JA 1RGVA 3VKTA 4CI0B 3HKZD 1SIWB 2AKJA 1Y5NB 5AOPA 1FD2A 4XDDA 3PNIA 1Q16B 3VKRA 1F5BA 1FTCA 1VJWA 1DFDA 1H98A 5BYRA 3VM0A 1C4AA 2GMHA 1FRMA 3MM5B 2XSJA 3VLYA 1PC5A 2WB1D 2VPWB 1JB0C 3MM5A 3MM8B 1FRLA 1FRKA 4G9PA 1AOPA 2FJAB 2Z8QA 2C3MA 3VLXA 3VM1A 5FD1A 1FRIA 3MMBA 2WSFC 2GMJA 1FDNA 1IQZA 2XSJB 3B0GA 3MMCB 1FCAA 3B0NA 1FDBA 4XDCA 2C3YA 3B0HA 1GTEA 3MMAA 4G38A 1B0VA 3MM7B 2Y0FA 3MM9B 3C8YA 2ZVSA 7GEPA 3IR5B 8GEPA 4HTRA 2GEPA 1JNZB 2FD2A 2VKRA 1GT8A 2WAQD 3AOPA 4KT0C 2FDNA 5CHCB 4GEPA 3VLZA 1BLUA 3MM9A 1BQXA 4G39A 2FJDB 1PC4A 1R27B 1DURA 1FDDA 2C3OA 4S3FA 1GAOA 4OV1A 5BYSA 5L8RC 1FF2A 1FDAA 2WSCC 3MM7A 1G6BA 1BC6A 2PMZD 1BWEA 2VPXB 1H0HB 1WTFA 3OR2A 4Y28C 1FERA 2UZAA 6FD1A 7FDRA 3OR1A 3B0MA 1FXRA 1D3WA 2V4JA 1F2GA 1B0PA 1G3OA 6GEPA 4L6V3 3NOYA 2FJEB 3EUNA 1HFEL 1SJ1A 3MMAB 4AYBD 3VKPA 2O01C 1DAXA 2Y0SD 1FEHA 2V4JB 1XERA 2FGOA 4S38A 4RKUC 3VKSA 1K0TA 1CLFA 5BYQA 3MM8A 1Y5IB 1JNRB 1ZJ9A 1H7XA 1SIZA 2PA8D 3GEOA 6FDRA 1F5CA 2V2KA 1KQFB 3MMCA 2IVFB 2AOPA 4ID8A 4DHVA 1KEKA 1FRJA 1Y4ZB 1C4CA 1H7WA 3MM6B 4OMFG 2FJBB
chains in the Genus database with same CATH superfamily
3SQOP 3I9V9 3HVTA 2YNFA 2JFKA 4F2RA 4YUDA 1XNQJ 4OHYA 4KB7A 3MHYA 3W9HA 3R5AA 2QYGA 3RU0A 1NSAA 4M5GA 4DV1J 1SL1A 1WEYA 2JVOA 1XQIA 5IWAF 1I94F 4DBQA 4KPYA 3H59A 4P2SA 1N0UA 1Q8IA 1R8PA 1Y0HA 1ZM4A 2C3UA 3M05A 1FX2A 4PXCA 4OHXA 1TP7A 1WG1A 2IAJA 1S10A 2PDAA 4RW8A 3I0RB 2AJQA 1UAWA 3AXMA 4ANDA 2ASLA 2BE7D 3UD5A 3FBEA 4HACA 2RRNA 4RX6A 3A8EA 3RBXA 1JWWA 2LLZA 1Q86T 4DSKA 4DR7F 2MQNA 2KFZA 5D3GA 3FEZA 4ILLA 3ZTRA 1RHJB 1KVKA 3M8PA 2V8GA 1C1CA 1CJUA 3FCVA 5CZVA 2V63A 1SIWB 3DOKA 5CCMA 1CQNA 3EYZA 1QAIA 2M3DA 2AKJA 1Y5NB 3HXMA 2VKZG 2AT1B 2HFNA 4B9MA 5C7PA 1NUEA 4DCOB 1DFDA 2RUGA 2W9BB 3CVKA 1EP4A 1UEVA 3A13A 3D0IE 3R1LA 2AYBA 4WXOA 5ETQA 4RUHA 3CCQS 3C15B 2L41A 2MKHA 4G6VB 2FLLA 2V67A 4JI6F 2N82B 2CJKA 3PR4A 2BE9B 1XMQF 4EO6A 3SZ2A 1E6YA 3ZTOA 5K8OA 4QU6A 2CQ0A 4F67A 3VM1A 2XY5A 5FIIA 4NLUA 4DV6J 4IG3A 2RF2A 2DGUA 1YQHA 3C16A 3TZWA 2B4VA 1RLDA 2DO4A 2RHSB 4HH1A 4AD6A 2J0SD 1AFJA 1FDBA 4LFAJ 4DG1A 1G7CB 1PG5B 3AB2B 3NCPA 4IFYA 4DQRA 1HKAA 4USWA 2ZH8A 1B0VA 4ZS6A 4C98A 2IRUA 1N33F 1N5TA 3MM7B 1OJ4A 1FHTA 1RK8A 4ED4A 1WDTA 2FD2A 3KLFB 2F9DA 5FLXU 2HS0A 2HWIA 3VGUA 1MWQA 2FB0A 2YKQA 1OS5A 1UFWA 2P9CA 4LSZB 3Q2SC 4MMOA 4ZJOA 5LT5A 4ELUA 2F1FA 2HMIA 4KIAA 3K57A 4O4GA 3LP0A 3W61A 5GADI 4ZLJA 5KT5A 3N6LA 2C3OA 2UUCJ 3TYTA 2LECA 1FFWB 3UVJA 1S6QB 1WTBA 2KVQE 4PQUB 2FY8A 1FKAF 4B3RF 2PMZD 1UJ4A 4ECZA 1OO0B 3MI7X 1ICEB 2XMTA 3F41A 4F7VA 3OVBA 2WVCA 2NS1B 1UETA 1DTQA 3DKDA 3M2VB 2UZAA 1AB8A 3J7YI 1K44A 2Q1LA 3N28A 1N36J 1N32J 1Q81T 1VISA 3PIOQ 4NOHA 3QZ8A 3UO0A 4JI3J 2UUAF 3M6UA 1T9YA 4BWMA 4J9MA 3GIIA 3QMQA 1NEEA 5G0RA 2UXCJ 2RDIA 1G3OA 2MGZA 4PG7A 1KOHA 2H54B 4OV6A 3AJ2A 2PIIA 3TA2A 1JLGA 4KO0A 3R7BB 1H3DA 3DYAB 3CMAS 3DM2A 2ZZMA 2C2NA 2KH9A 1HWUA 2ALZA 3J7AN 1UVKA 1S1TB 1UZHA 3M2RA 5GMEA 3T3FA 2ADBA 2PI4A 4B9NA 4N8NA 3TAMA 3TX0A 5EDWA 3QZ7A 1N0VC 2W2QP 2DVIA 2YKAA 3ET6A 4ANCA 2MLYA 2XBPA 4TYAA 4JV2A 1TL1B 2H1YA 3K8WA 4Z2XA 1RAAB 4U95A 1KQFB 5JVHQ 3RRHA 2HMIB 3QGIA 4DV7F 1PYTA 1X5OA 5H9FK 2WOMB 3VAFA 2EI5A 2ZH7A 2VV5A 2FJXA 2BXJA 4OI0A 3IC1A 2ZNZA 5KFRA 3T5JA 3G2XA 3GPAA 4M5LA 5KFPA 3KHLA 4DL7A 1X9MA 4S39A 4HDGA 2RAQA 2B51A 3OR1B 2IVYA 3O6QA 1IM4A 3R6LB 4CM2A 1R0AB 3M6XA 4RBTA 2WVDA 3Q8RB 1PYOB 3I82A 3J81Y 2E5LF 1U8WA 2R7UA 3KWMA 4A48A 4KPCA 3RR8A 3NNHA 4P72A 2KKHA 3EDRB 3GJRB 4CLKA 3FEXB 5HQMA 2ZH3A 2IRXA 4FF1A 1GX6A 1ZM3A 5LJ3Y 4DL5A 2UVVA 2B3TB 1YIJS 2HFSA 3CJKA 4ZPTR 2UV8A 2L08A 2OFHX 1HNXJ 2LA6A 3ISNC 4J9RA 1CJVB 4MFBB 3QIDA 1TTHB 1Q8BA 1TUWA 4P2MA 4NLGA 3B0JA 3R5CA 3H5YA 1G4CA 2J0QD 4C8YA 4I0WA 5GVQA 2GIRA 1WHXA 2NYHA 2YQ3A 2YNIB 3S1TA 4EGLA 4WIQA 3KLHB 3KK2A 2E7WA 3RBZA 1EQMA 4L3NA 5J2QB 3C6TB 1CEZA 2HBQB 2XTJP 4L75A 4NLQA 3UCZP 3KLIB 1RAFB 4ZPCA 3X3UA 2DIVA 2XSJA 4ECXA 3H2VE 3U1LA 3VZIA 3BR8A 3KJFB 5KFEA 3GQCA 2VPWB 1E6VA 3UDEA 1BXNA 1DTTA 1U2CA 2QA2A 3MGJA 1VBZA 4IRCA 4CO4A 4QPTA 3W2VB 5M2RA 5F8HA 3ZZRA 4JI8F 1WG4A 3VF0B 4Q45A 2VQEJ 4MJKA 5DDPC 3DLGA 5B09A 3OFGA 1F6TA 1QDUB 2CQBA 2E9TA 2B8PA 2VQFF 4ED7A 2BM1A 2BR0A 3PFOA 3B0HA 1ULRA 2BVZA 3V5RA 4UUWA 2RDJA 2FZCB 5IM0A 2DNZA 2KXHA 4UOHA 4ED6A 4H4MB 2AMCB 1T9TA 5H9EJ 2BJ1A 1GXTA 4I1TA 2GVZB 5IT9U 1BLUA 3GG1A 3FZ2A 1BGXT 4WFYA 1P1LA 4DOZA 5HJYA 2G2YA 2QJ3A 2X1AA 2X7IA 3TUPA 2W2PP 3I87A 4F4WA 4AXJA 3W2WA 2KB2A 2KM8C 2ZH1A 2MTLA 2X1BA 2BANB 5IZHA 1ZA2B 3MF5A 4LUBA 3EGVA 5BJRA 4FYWB 3ENQA 2JSXA 1HBMA 1VLYA 2D3UA 2VPXB 2CVEA 2OI2A 1E6VB 3QGHA 4OHWA 1WDDA 2PFDA 4ZLNA 4OX9F 2J6TA 3PO5A 4IQMA 1JQGA 2DHXA 4K7QA 2CYYA 1HI1A 1FWLA 3UW1A 5CA5A 7FDRA 4UOCA 5I4MA 2JC1A 4WU2A 2HHUA 2PI5A 4N77A 4P71A 4NASA 1UPPA 3HZEA 1RHRB 2N4DA 2NPIA 5KFIA 3TW0A 4DN9A 4NLSA 1U24A 4WP8A 3KK2B 3H7HB 2HFVA 1TKZB 3M9NB 4ID5A 1SJ1A 3ILIA 2CJAA 1TR0A 2Y0SD 3CF5Q 1LQ9A 3HFKA 1LOUA 2EFOA 2FGOA 4X64J 4AFFA 1TQLA 2F5GA 2JH3A 2WW8A 4CH1A 4LF6J 4LF5F 2ERRA 4Q0BA 4NA2A 4ED3A 5CZXA 4X62J 1U48A 1X60A 2D3OR 2PMWA 3PG9A 4H4OB 3A3PB 4ZN3A 1Q53A 5KFYA 2XM3A 4HI1A 1NK9A 2KXNB 5D4LA 2F4VJ 3HF5A 3J7A1 4KHPF 2AOPA 2OMOA 3BGOP 1Y4ZB 3NRBA 2FLPA 3KNAA 1X4EA 4USKA 1FK9A 4A8SA 3NOCA 4NMXA 5CYMB 4ATNA 2JEGA 1FRXA 3CCRS 2H48B 1C0UB 3I31A 5B08A 4CCHA 4JI4F 2YXLA 5HP1B 1IBLF 4DWIA 1IWGA 5E0OA 3SSQA 1SL2A 2YWHA 3VTIA 2WONB 1LWFB 5KT4A 2YWGA 1RQ0A 4JI6J 5KFUA 2QV6A 3CNQP 3TI0A 3I4PA 4URQU 1AOPA 1RT2B 1UTAA 2EG2A 4LQ9A 5THWA 4ZPDA 3M6VA 4WK3A 4AOPA 1WI8A 4NX9A 4RWXA 5D0EA 3SQGB 2PEHA 4HVZA 3TEHB 2QX0A 2IA6A 4H4MA 1C2PA 1SKRA 3D3BJ 2JOQA 1VK8A 2XMUA 1YGYA 4OYPA 2CPJA 1JLAB 3GYNA 2WVBA 3KG1A 5ETSA 5AJ3J 1HNXF 2BKNA 2FVPA 4ELTA 2W9CA 4USHA 5F8GA 1X4HA 1FFGB 2IBOA 4MH8A 3RYLA 3CXCR 1Q7YT 1H98A 4ZCLA 4F0HA 5I3PA 3VM0A 3TWZA 4U7CA 1N5VA 3D1QA 5L9XA 4ECQA 1UVMA 4YOEA 2GHWA 3WIVA 3C66A 2Y3YA 1IWAA 4ZVGA 5J2PA 1NLKL 4C8KA 2UXDJ 1PC5A 2J7KA 2WB1D 3HCXA 1DHMA 3HVWA 3OJSA 5KFHA 4I7FA 2BJ7A 4P2FA 2Y1RI 4S0MA 2POKA 2RNEA 2LU2A 3AT1B 4DPTA 3HO1A 3C2PA 1KQSR 5D3GB 1WF1A 3MMBA 2BA9A 5LOQA 3AD8C 1GMWA 4NPOA 1IQZA 3BPDA 3SXLA 4EFAC 2DHGA 4QOTA 3MPYA 1FE0A 5KOWA 5F8NA 3B0NA 3GFZA 4F2SA 3I0SA 4U96A 4RJVA 4GC7A 3BZQA 4H4KC 4LJMA 5E3QA 2B9EA 1HBUB 2EFNA 4OFZA 2DBBA 4OYMA 3QFHA 4RW9B 1HHQA 1UJ6A 2C2RA 3OSNA 3B4MA 1U0HA 2HWHA 3GE9A 3L7OA 4DR1F 4DN0A 5LJ5Y 5HQ8A 2DR7A 1H2VZ 2W25A 2R7XA 4FZVA 5F8JA 4RBUA 2ZUAA 4WYLA 4DZDA 5JVGQ 1TL1A 2GW8A 1OY9A 2VFRA 2NYIA 4M63A 5A2QU 4B3SJ 1RU2A 2LYVA 3Q2TC 4DR6F 2DNPA 1M5HA 2KZZA 4QPXA 1PO6A 3PHEA 3LP1B 4B9LA 2JRSA 2I5JA 2VG6A 4M5KA 1FDAA 3CDEA 3KUEA 2LDYA 4WJBA 4P7VA 2ZM6J 2LMIA 3KJVB 1PCAA 4X4NA 2HFOA 1KVIA 2LEAA 4LVOP 5ETVA 2UUAJ 4M5HA 2KDOA 3CJ2A 1HI0P 3MAAA 3OPKA 4Y2AA 2OLWA 1N4LA 3KJVA 3B0MA 4YHHF 2EKNA 3QJJA 1C0TA 1Y3JA 1YJVA 2VHGA 4Q7AA 3N9UC 4ZP6A 4DL2A 2HNDA 1XR7A 3LALA 4R0JA 5AXKA 2PA3A 2HNZA 1YZ6A 2C2KB 4OZ5A 6GEPA 3MPWA 3MMAB 3G6YA 3QSYB 3DHXA 3CJQA 4CQ1A 3QRRA 1DAXA 4TVAB 3OVAA 4L74A 4RNFA 4XIUA 3RW6A 1QVGR 2KXFA 3VR1A 4DQQA 1WKKA 1TKXA 5HMXA 1IKWB 1H7XA 3V81B 3UWTA 4DV2F 1IKYA 2BQUA 3GEOA 2R8GA 2P5VA 1S1WA 3OFFA 3PEHA 4F4AA 2XCAA 4WZQA 1UEUA 1VQOS 1JJHA 1M5KC 3V81A 4ED0A 4FVMA 5J2MB 1Y3KA 1RSCA 5KG7A 4DL4A 5HP1A 2PSZA 4WFXA 3RJMB 3D7SB 4ECWA 1WOSA 3RGIA 2WBMA 5KG2A 1MMNA 3J80Y 2AV5A 2OTLS 3WC0A 4QBUA 2B8QA 4Q8FA 2HIYA 3FKBA 3GR1A 3M2VA 1HBOA 3N5FA 4NYZA 3ZTQA 2W1BA 2YNFB 3SMZA 2KG1A 3ADAC 4FDFA 1RT6B 4M5NA 2A0FB 3PYEA 3P5TL 4DR5J 2KT5A 2V34A 4ECRA 4DR3J 3R1HA 4URGA 4S3CA 3BN7A 5L46A 4QWAA 2EK1A 4S3EA 4B3TJ 1NK5A 3TUJC 1RT4B 3BBBA 3N79A 1KD1T 2HHTA 2R7TA 1ZOTA 4XK8C 3SBMA 4CT9A 2E1MC 2V8DA 3VGSA 4QWDA 3G8SA 3GCWP 2J0XA 1IKXA 3QGGA 1VI7A 2IJNA 2SXLA 3IWLA 5CYQB 3H5XA 1MROA 2MQMA 4ED5A 2H3EB 3B54A 1T9VA 3PRDA 4OHVA 1VIOA 3G8TA 4K4VA 1F5BA 4NCBA 3R5BA 2NQPA 1PSDA 3W60A 1FNXH 1NHKL 3JYTA 3DXBA 3WZ0A 2RF2B 1T95A 2C22A 5KFTA 5J2NA 2HHPA 4I2PB 2EFVA 2LEPA 4O3PA 4DUYF 2JHEA 4MAKA 2W4PA 3HLUA 4USUA 5HI7A 1HBMB 3QT7A 4LFCJ 4OX7A 1J5OA 5J1EA 3HVAA 1RAJA 4GVBA 3UQSA 3H20A 1D0EA 4FBUA 3NMAA 4RBVA 2HW3A 4LR8A 3KLEA 1FO1A 1FTRA 1FD8A 1TK5A 1NB2A 1P8GA 3RB4A 8RUCA 3NY0A 3UNGC 4YMEA 3EVMA 5DETA 3PX4A 2HQIA 3GFYA 2GVZA 1FCAA 2FIUA 2RQCA 2BKPA 2DHSA 2NXCA 2OEKA 5A8WA 5B0EA 2J7UA 4PPDA 4EYIB 5DDRC 1SC4B 5CAAA 1JIHA 1FKOB 5K8MA 1V9OA 3G8QA 2BX6A 1ZZFA 2D74B 2DGVA 4CLWA 3IRWP 4DUTA 3H40A 1NB7A 4HTJA 3W3SA 4C8ZA 4WP9A 3I6PA 3CC7S 1R7IA 4CLYA 4U67Q 4MYTA 4RO0A 4TLRA 3CCVS 3NCQA 5D0RA 1LXJA 3JSBA 3HHLA 1OQ6A 3VZHA 3JXOA 2IBKA 4G39A 4JOUA 1Q8LA 1S6UA 2F4FA 2Z58B 3AD9C 3CE8A 4ZVQB 2NPFA 3THTA 3TANA 1QTMA 4J7CA 1XBWA 3OV7A 4C0BA 4UQGA 2D3ZA 3DC2A 2YX1A 2DK2A 1SC3B 1T9UA 2V8HA 3D66A 3U7JA 4RUAA 5CYQA 2LU1A 2BEFA 1T7PA 4B3RJ 1IKXB 3K89A 2EC2A 1FERA 3UN2A 4ZCMA 3H2UB 3UCGA 2XY7A 5GADU 3F73A 4NI2A 4LF9J 4EBCA 3KLEB 4DFPA 2AJ0A 4KFBA 2R2TA 1R0CB 5DRKA 2L9WA 3W2WB 1RKIA 3KLHA 4ZPVR 1WC0A 4LRFA 5DG7A 2ASYA 1SJ4P 1U2FA 1J27A 1RAIB 3Q8UA 5I3UA 2MQQA 4M95A 3NOYA 4OI1A 1HL6A 4M5MA 5KFVA 2V2QA 4I2PA 3MCOA 1LWCA 3BQ1A 2YWKA 4UOFA 5LMUJ 1S5ZA 2HAIA 3PM9A 3W66A 2LCWA 1QAJA 1NU4A 4QZVB 4ALZA 4CNZA 4EUVA 3MAQA 4ECSA 1SXLA 1H74A 3TAQA 1SIZA 2RJZA 2ZUGA 2YPZA 3HD1A 4MKVA 2A10A 5EX3A 1VRQC 2CPFA 4FNHA 1QSLA 5K5MA 2YVSA 1FWPA 4ID8A 5C42B 5CD4A 4ZP9A 1JJ4A 4JI5J 1B64A 2QG9B 4X62F 3LGNA 5E33A 2MB0B 1DLOB 5HVHA 4PXEA 2N3OA 1WOOA 2HQFA 2A6OA 3MEEA 1RHUB 4F3QA 4LFBF 1RAGB 5E7OB 1NHVA 5DLGA 3DLEB 1GK8A 2YKMB 1SI9A 2DNLA 2ZH2A 3KLGB 5B0DA 1HNWJ 1ROFA 1KP6A 3JSMA 3D6TB 4OYIA 3ZZPA 1A0OB 3J7ZT 4C9DA 1HBOB 2V68A 2RIJA 1MN7A 3T1YF 1FRHA 3OJUA 1SC6A 1JXEA 4K4UA 2QO3A 2GIFA 4FXVA 1NPKA 2VONA 4QW9A 3KK3A 4HHUA 2ADCA 2VG5B 1VQ7S 3PX6A 4I2QB 4YP3A 2HHQA 3JQJA 3C14B 4OX8A 2IRYA 1IKYB 2F9JA 4OX6A 1K73T 4ZVRB 2M70A 4L3KA 1S0NA 1UFKA 3MURP 1TMJA 1Q16B 3PDNA 1F9FA 4NXNF 3CD0A 3DRSB 1T03B 1Q82T 4AT1B 1YG0A 4F4XA 4BDPA 2RS8A 3OBIA 2X3GA 4X65J 1MMLA 2HBYB 1WC4A 3GCXP 3IO1A 2QYCA 2PT0A 1J2VA 5HATA 4TKTA 2E1RA 2VDHA 2AU0A 3CMES 1RWWB 1TK8A 3HZGA 3PACA 3I0SB 3EGZA 1YJWS 3K5LA 2FVRA 4Y0FA 3T1HF 2JVRA 2DR8A 1GMVA 1WACA 4DEZA 3C6UB 4U8VA 2BQRA 5C5JA 5LMUF 1IBMF 1AYEA 3IM9A 1IN0A 3LPEA 2HVIA 4O23A 3RW7A 2B5JB 1GXLA 2HGLA 4DX8H 5HN0A 3D0GE 4QIGA 4MK7A 4JI2F 1IUJA 2NZCA 1S1VA 2OTJS 3DRPB 2YBVA 3SDEA 2PD1A 4I68A 3ULHA 2Y8WA 2JNJA 5HMYA 1J5EF 2XZTB 1RA7A 2GC8A 2CPZA 3GSIA 3KLFA 3QSIA 1HBUA 2AEJA 1QE1A 2WSCC 3MM7A 4YS2A 5C25A 3GG0A 4DPYA 1KSPA 2OSRA 2V8PA 5CYMA 3W8GA 1Z2ZA 1PKUA 1RI7A 1R6VA 2J9EA 2W7AA 2YPYA 4NLTA 3TX8A 5KFCA 4Y28C 1VMBA 2CPXA 3WX4A 2FHJA 5KFWA 1HHTP 5SUHA 4UZCA 2AYEA 1RTZA 2D1CA 1D3WA 2E5LJ 4A47A 4DJBA 4KAIA 4ECVA 1LWFA 2XHWA 3ITHB 1S9GB 3L4BC 2XMMA 3MWBA 4OYWA 5EWEA 3CC2S 4KKOA 3R5DA 3FDSA 2V4QA 3UCUP 1VQ5S 3NGKA 2IDEA 1OQ3A 5I3UB 1LW0B 2XB2D 5CXTA 1K0TA 4FYVB 2R7WA 1NMEB 4J9PA 4K50A 5D8HB 4O3RA 3Q8VA 3CJ5A 5FDLA 1OSCA 1UA1A 2GIQA 3A3OB 3LAMA 4NA3A 4CTAB 1HBNB 3DOMA 3TOQA 4DFMA 3E01B 2AEFA 2JWNA 4NEYA 3CCLS 4DV1F 3KLGA 3C16B 4QQBA 3MECB 1X4DA 1FRJA 1TV6B 1WEXA 1C4CA 2HSEB 4D3HA 1KLMB 3KHRA 2UVRA 2CAJA 2YKNB 1KNZA 4BWJA 1NK7A 2FUG9 3TAMB 1SJ3P 3KTQA 1QJHA 2BM0A 2HVDA 1ZJ8A 4TU7A 2F8HA 4IQXA 2WONA 4JI8J 5LMNJ 2V4RA 4NLRA 5B0AA 4M94A 1M5VC 4NXMF 3NEKA 4C8OA 2DYAA 1BWVA 4Q43A 3CCUS 4QIEA 1UA0A 5G0RB 2LXIA 4YDDB 1CVJA 2EKYA 2MY7A 4Y2KA 5E3RA 1VRTA 2FC9A 2OD6A 4QR2A 4I6YA 3HP6A 3VKQA 4DLGA 4ZPWR 2E29A 5L1JA 3HULA 3I96A 1CJUB 4ZJLA 2VBYA 2OSQA 1VRTB 1AUSL 3W8PA 2QA4S 2FHOB 2CIMA 5T7LB 4ECUA 4ZVSB 3CJ8A 3J80U 1XC9A 1TELA 5F0WA 2UXBJ 1AW0A 2V5HG 2DRAA 4O3QA 4NLPA 4XDDA 2GNKA 1HLWA 2W2OP 1DQAA 2GAHC 5GAGU 4EBDA 3MR2A 4ICLB 5RUBA 4OJ3A 1HQ2A 1N56A 1IVZA 4RL1A 3BDPA 1AZSA 2GMHA 2DR9A 3CD7A 3P3DA 3I5AA 3LQVA 4WZMA 2E44A 4OZJA 3OXGA 3EPIA 1NBEB 2BZ2A 2XYHB 1V3ZA 4C0HA 3DDNA 3H5SA 5IM0B 3UD3P 3RBDA 2J9DE 4LFAF 4FXDA 2DNGA 3KG0A 3K5OA 5IC4B 1VQKS 1X4GA 3UDVA 2R42A 2JEJA 2GMJA 2HLUA 2JC0A 1V3RA 3NXZA 2ALYB 2Y8YA 2GO9A 5F8MA 5GAHI 1T11A 2JFDA 4CYUA 3M7VA 2Q79A 4CDIA 5HL7Q 1YWXA 1B7YB 1FX4A 2L9DA 1DTTB 4QWEA 1LXNA 2YQ1A 4IR1A 1HWIA 5A8WB 4B02A 4F0KA 3PFEA 4MYUA 5DQGA 2UUWA 3AOPA 2DRDA 2ZKTA 3IA0A 4AE5A 5KOXA 2V6AA 3EZ5A 1SKSA 3NOGA 4LF7J 3VLZA 2FVSA 2CUYA 1BQXA 1PJ7A 2QLJB 4KJIA 2H51B 1F60B 1AROP 1Q78A 1FT8A 2Y1LB 5AT1B 4CH0S 3T41A 1BC6A 2FGCA 1BQMA 2H5JB 2NSBA 1Q5YA 4IFVA 1BWEA 4QW8A 4ZKAA 4MFBA 3MUTP 3NNAA 4YB7A 5D4OA 5GAEU 4V19J 4TN2A 4DS4A 1KFSA 3F0NA 4M8LA 1UFLA 3HI9A 2X1GA 4DR1J 1L3SA 2BBEA 2P9EA 1X4CA 2GGPB 4KGMA 1C1BB 3OL9A 4IR9A 3T1AA 1JLCB 4BCAA 1M1HA 4WFZA 4ETZA 4DUZJ 3NBPA 3CEDA 4WXWA 5ETOA 3POTB 4USTA 2Q43A 3K0JA 2VASA 5B7WA 5DM6Q 2CQ2A 1GX5A 1PGZA 2R7VA 4HL9A 4CTAA 2HNYA 3QATA 4C6AA 4Y34A 2FHJD 3ZTPA 1L5UA 3W7BA 1WEZA 3TNVA 1J5EJ 2XS5A 4D3GA 4P10A 1Q95G 3O1LA 4G1QB 2MSTA 4WFAQ 1NKEA 4JI5F 1O8BA 1TAQA 1LW0A 4HEA9 1F1BB 4KHMA 1MU2A 2MZTA 1F3FA 3MEDA 3MMCA 4ELVA 4DR4J 4W92B 5MLCV 3ISND 4FS1A 1VRUB 2UP1A 3CJSA 2IM1A 2MYFA 4FF2A 5GMKa 1BD6A 4U7UD 2J8SA 3ENAA 1R8HA 2N3LA 2UVUA 2B5JA 2HQDA 3L7PA 2QL7B 3AODA 5ETPA 3DNCA 2WBRA 1Z4UA 3D6FB 4RW6B 4DU7A 2IA0A 2IMOA 3T5KA 4X4UA 4PAAA 3EGWB 4J37A 2NXNA 1YJ7A 4OI4A 4I2QA 4G1PA 1XMQJ 1FJGJ 1IQTA 1RTHB 1WC1A 2MJNA 1NZ8A 3EZUA 4FVCA 1R43A 4RW7B 4C3LA 2D41A 1XEZA 3GFXA 3TUIC 1LFPA 2Z2YB 2YTCA 5KFMA 4WF9Q 2R8HA 1S77D 2OEMA 4LBPA 1RWOB 1S7HA 2AJ1A 1NKCA 1CJKB 2UUCF 2W8KA 1REGX 3R3TA 4RNNA 3C3LA 2R2RA 4OIXA 3P8BB 3NS7B 4ZP8A 2HGMA 4ZVUB 4O44B 3DRSA 4DX7A 2J5AA 2UUBF 1N34F 2E5HA 4E98A 3MFIA 2VG7B 1N6QA 2MLXA 4RU9A 1AA1B 2ZD1A 1WOPA 2CQDA 2HHHJ 4N76A 1PAUB 5BYRA 2YNGA 1HWJA 4OZNA 1FRMA 1DLOA 1ZH5A 4Q2LA 4JYAF 1DARA 1YRUA 4Y2IA 1VHFA 3DRRB 4WE1B 3OL7A 1HI8A 4DR6J 4P52A 1R31A 1FVQA 1RT5A 1S9EA 2MQ8A 2WW4A 2FVQA 3D3CJ 1S4EA 3P45B 1RBAA 3HHKA 2XQCA 2VBXA 2XMVA 1FDNA 2Z57B 3IBFB 1LWXA 3DLKB 4OLPA 3ZZOA 5C2GA 3B0GA 1SH2A 4EZ6A 2APOA 3VAMA 4LRDA 2D3O1 1RP5A 1A9NB 3M30A 3GR0A 2ZDOA 3F56A 5D0HA 1TVRA 4OYXA 5A8KA 2KU7A 3TVZA 5B0CA 3BR9A 4DUYJ 2QRRA 3T9ZA 4DV0F 4EYHB 2QFJA 3QAUA 1REVA 2DCUB 1PAEX 2HRYA 4PZVA 2AEMA 2H4YB 2K1RB 5CHCB 4YY3F 1XNRF 4TQSA 2K8GA 3MM9A 4LMZA 2BMBA 1U1NA 1KDNA 3M32B 3MEGB 4KGKA 3SSRA 1YI2S 3BYPA 2UU9J 2X1FA 1DBDA 4DV4F 1FK9B 3WC2A 3WBZA 1EZZB 1K9MT 1Q5VA 5AJ3F 3T1YJ 1K0VA 3B4DA 3F44A 5ETRA 4A4JA 4JI3F 2Z56B 1RWKB 2CA9A 1UKUA 6FD1A 3GWCA 3GIMA 1YK9A 4L72B 5EGYA 3RAQA 2B0GA 3CIMA 4IG0A 2DTJA 3LP0B 1W2IA 2DY9A 4B3TF 2OGUA 4ZDNA 3SI8A 4F4YA 4LBHA 4Z7CA 2V4JA 1LFWA 4EI2A 3TZYA 2FPHX 3V6JA 4C97A 2F63A 2R3VA 3P49B 2R2UA 4QR0A 3QIPB 3VVUA 3PW0A 1LK5A 1TFWA 3O5TB 1NO8A 1TV6A 3I5CA 3TQEA 1CG2A 2VQFJ 2M0GB 3CIZA 2NXEA 3D5MA 3FGVA 3A8IA 3AQOA 3AB4B 3UR0A 4DPOA 4DF8A 2J6SA 4G3IA 4JI2J 1EETA 1KTVA 2HS3A 4LSNB 4JI4J 2AGPA 2CPIA 5A8RA 1PILA 1F5CA 2DNHA 1RT1B 3D9BA 3JAMY 2I2YA 3KG4A 3AD7C 3A8KA 3JSRA 3CCZA 4CLFA 2P2CB 3OHAA 3CJTA 3K5NA 3DCAA 5LSRA 2KT2A 3SEOA 1YITS 4NLWA 1XJWB 3ETOA 4WP3A 1Z1ZA 4LSNA 1GMWD 1RA6A 2V2VA 1RBOB 3MFHA 1WHVA 3BJYA 3R7SB 1I1GA 1WUUA 3GLJA 2E7VA 3DLJA 2F7VA 3PJXA 4KH1B 4ENOA 1Z2LA 1HIYA 5BXIA 2LQ9A 3LWMA 2W7OA 3H25A 4DR2J 2YH1A 4F8RA 1D9DA 1RCXB 4KGVB 3TVYA 4QIVA 5AXLA 3ETMA 3BH7B 1UCNA 3EM1A 1N5YA 2M4MA 3FVYA 2DR6A 2YX4A 2MKIA 2B9YA 1RLCL 3O2IA 4KV8B 3EXYA 3IBCB 3MPDA 2JLFA 3P4UB 3IBWA 1L3VA 1VJQA 3NNCA 3OUYB 2ZH4A 1LWEB 4R8UB 1M0SA 2EWHA 2GQ2A 4C8MA 4K8RA 3W5YA 3PO4A 3V4MA 2VOOA 5GMDA 4JV5F 4M5JA 3HKZD 2BE2A 5A8RB 4ILMA 4MIBA 4X4RA 4XAKA 3FEYB 3W65A 3VKRA 3OTBA 3OTOF 1U1RA 1RISA 2B4UA 5HBMB 4J9NA 3L3CA 1C4AA 1VQLS 2ATLA 1BUXA 4YN3B 5G4DA 2CNNB 3THVA 4K2JA 3OT9A 4ZPAA 1G2EA 2AX0A 2KO1A 2IDLA 5DGAA 3MTKA 4UF4A 3KMSA 1WC3A 3O8WA 4DR3F 5D4PA 2AJ4A 2DISA 2C3MA 3MDFA 1RWNB 1RHMB 3SCLE 4DR5F 2DXEA 1VQNS 2KRRA 3QYYA 4NMLA 1EX8A 3DN9A 4KC5A 5KFNA 3BKTA 2X51A 4DV5J 3DMJA 4IH5A 5IT4A 4DV3J 2XMAA 4M5DB 3OQ2A 1WSRA 2AF6A 2KFNA 1S9GA 2MQOA 2C3YA 4ZIVA 2XZDB 2Z2MA 3MMAA 4DHVA 2MMYA 2K3KA 4OYOA 1HR0F 4Y65A 3C8YA 1KRPA 3T6JA 2BYCA 4RW4B 4HTRA 1JNZB 1FNOA 3BH6B 2XSFA 5HROB 2ZH5A 1R0AA 1SKWA 2FJVA 4AUKA 3OXFA 1IBCB 4CWBA 1SKUB 1V3SA 1KONA 2KVIA 2ROPA 5EUHA 1RTIB 2V8VA 3NWRA 1R27B 4IH7A 4WFNQ 3JB9k 2V0NA 2YNGB 4OZLA 5IC6B 4OV1A 1FF2A 2B7BB 1FJEB 2YKNA 4KE5A 2WOMA 3VAIA 4HT5A 4V19X 4R5PA 4N47A 4EMDA 2AKWB 3QRQA 4AL5A 2LQBA 3WIUA 2V94A 3M2UA 4X4SA 1FNMA 1VYAA 2YNIA 3IAS9 1NM2A 4ZVTB 4TU8A 1HQUB 3MTJA 4LBIA 2HVEA 2UUTA 2DNRA 5IQQA 1P1TA 3H5UA 5F3ZA 4LF4J 1YJUA 3M2RB 2O1PA 4KYZA 4DZ6A 1N33J 2XG8A 1QTNB 2BJ8A 2QIFA 4WK1A 3AHPA 2NUHA 1U1KA 5GAGI 1FEHA 1NDPA 2V4JB 3PJ9A 4DSEA 1O51A 2VL1A 5B0FA 1FA0A 3FCWA 1X8DA 3I56S 1U8SA 2NREA 3L9ZA 3MM8A 1UW4A 1VQSA 1RDRA 2MQPA 2LQ8A 3Q23A 4IO9Q 4O0NA 6FDRA 2GCFA 4PWUA 1VC5A 4JV0A 3KYLA 2FZGB 4DV7J 4X65F 1RYRA 2OHDA 1XTZA 2IVMA 2AW0A 4J5OA 3PRVA 2W9AA 1TL4A 2RILA 3IG1B 2VJUA 2MEWA 1RWUA 4N7TA 5D78A 1FI4A 5KFLA 4DCPB 1A6LA 1M1GA 1WHWA 4NLOA 4J9OA 3VQTA 2KYXA 2CQCA 2U1AA 1LK7A 2WSEC 5M2UA 1QSSA 3JS9A 1TKTA 1NJWA 2ZH9A 2NXUA 2GO8A 3V6KA 3MMBB 3QWUA 3M8QA 4AL6A 3DGPB 4CH7A 1NDCA 3CO0P 2VG6B 2XZWA 1NJXA 1NPRA 3FQKA 4ZVEA 2DEIA 4WTOB 1H2TZ 1N6QB 4DI6A 1AXQA 1EARA 2ZFHA 3KKFA 4IFYB 3M8QB 2C42A 2WHOA 5KT6A 1VOMA 3L09A 2RQMA 2V50A 2L48A 2CDRB 3DI6A 3CCES 2HHHF 4NE9C 1N32F 2UXCF 2OEJA 1HNVA 3AA9A 4J9KA 2IMWP 5LXRA 2N7YA 2ZJPQ 2H5IB 3HM9A 1KVJA 3D1HA 3OUYA 1NHUA 2R7OA 2KHDA 1GEHA 5HAOA 4DQIA 1EKSA 1WF0A 3T19A 4K0KF 5HK4A 4LFBJ 1WKJA 3FRYA 5EX0A 5CABA 2MSSA 5KFKA 1S7IA 4DSJA 3TP2A 3POTA 3RAMA 3UN3A 2D9OA 3S01A 4CT8A 1XMBA 3CUNA 4N5SA 1UW9A 4RU2A 3R2CJ 4K2XA 1SVDA 2RD5C 1VC0A 2B6AA 4F36A 3MM8B 1FRKA 4WIIA 3DDIA 3H90A 1JMTA 1HMVB 3NGSA 2ROGA 3SV4A 4A8XA 3N5BA 4LIWA 2CG8A 3PKMA 3NS5A 4CYUB 3NLCA 3D4JA 2Y1JA 4JI1F 2CRLA 2IM0A 2BRLA 2JLGA 1VC6A 1H38A 3MMCB 2Z4PA 1N52B 4URSA 5F9LA 4FYYB 4X84A 3R5JB 1TAUA 1GTEA 2HLTA 4IOCQ 2A2DA 2CDQA 2XMWA 1Q7LB 1ZS6A 4YB1P 3AOCA 2V9WA 3K7RA 4DU8A 1UWAA 2Y1IA 2OP5A 4DG1B 8GEPA 1SCJB 2MKYA 3IR5B 1TKDA 3MR3A 2VKRA 4WFBQ 2NZ4A 2YY3A 3GIJA 3CJ0A 1SPBP 2EG1A 3EICA 3ICLA 3BN4A 4UQTA 1UEKA 2Y9HA 4PG8A 3UNYA 2GJ2A 3MEKA 1SH0A 1RT2A 2MKJA 4HT7A 3W1YC 2HRUA 3R27A 1EB0A 3NGDA 3HJFA 3EWGA 4AQYJ 3VGTA 1TL3B 4ZN1A 4DQSA 1SJRA 3ISZA 3V6DB 4P6QA 2DH9A 4QYZJ 5EN1A 2VICA 3BEGB 5KFXA 3ZZ0A 1YSJA 3M9OB 3EVWA 2ZJRQ 2QA4G 1GQEA 1XN9A 3EMTA 3FMWA 3MMJA 1U6ZA 2MHEA 4WU3A 3GJQB 4B3OA 2ZBIA 4B9VA 3OSPA 1FESA 1WI6A 2AJFE 2GX8A 2WRMA 3FBFA 4KHRA 1HR0J 5DLFA 3LGMA 1U0SA 1TFYA 2DGSA 5L39A 1UVIA 1WELA 4I69A 3CCMS 1JXLA 3MR6A 2YH0A 3ZC4A 4KH0B 2FC8A 4KY3A 1X31C 5FJ4A 5ADZA 1JNRB 4QIWD 3VWSA 3Q24A 3GYGA 2M8DB 4H4KA 1MSWD 2YKPA 1ZBTA 3R2DJ 3IXQA 2BW7A 5HVGA 5CD4H 1EIYB 3D0HE 3M8YA 3HFVA 4IKAA 2VC1A 2ZH6A 1U25A 5E3PA 2ZHBA 3W9JA 3AOBA 5IOLA 4HKQA 3UFCX 3E01A 2IM3A 2VBWA 2W7PA 1N5YB 2WVEA 2R8IA 2G1DA 2R4FA 1EETB 3LP2B 4KQZA 5IT9Y 4A46A 1VQYA 1QSYA 3EPGA 3OTOJ 2DNMA 1WD6A 3TR5A 5I3QA 3A3NB 2CQIA 3R97A 4NCAA 3IR6B 1T0TV 4Y6IA 4F4KA 2C28A 1RACB 1S1XA 3LF0A 2M88A 4YDXA 4LF8J 3C46A 3DU6A 3IGNA 2LEBA 1HNZF 2VJVA 2RMLA 3FC9A 3G82B 3HJVA 3CJKB 3QJPA 4QYRA 3FSYA 4B08A 3Q8YA 1TK0A 1VCTA 2GQQA 2J76E 1TZ0A 2I5JB 5C24B 2RRAA 1U4BA 1S0MA 2KZMA 5HVFA 4S3AA 1LW2A 4FN5A 2VZ9A 2FHMA 1TUVA 2FZKB 4RNMA 3MUVP 2FY1A 3R9LA 1NSPA 2M8HA 1YJ9S 2F8EX 4EZ9A 2QL5B 1XK8A 2JJ4D 2EFGA 2YNHB 3CJ4A 1LNQA 3DDKA 3LA0A 4TYBA 5J1EB 3DOLA 5HO4A 2DY1A 1FTCA 1FVSA 1NDLA 3S7RA 3AFGA 5H9FJ 4ZK7M 3TA0A 3KHGA 1JLEB 2NCKL 3RB6A 2QL9B 4J9UE 3KXDA 3I32A 3LWLA 5A76A 5KFFA 3VAGA 2B4OA 3DLGB 3K17A 4KKOB 4NRUA 1UPMB 4ZCKA 1N8RT 3VLYA 2G1HA 2DR5A 1IXKA 1IR1A 3W2VA 4TNOA 4KR0B 1JB0C 5KAKA 4B3MJ 4NA1A 2ZWOA 1PIEA 1R6YA 5IV4A 1IKWA 2VQEF 4MT1A 3PY8A 3HX9A 4C2MA 2QT7A 2ZKUA 4A8QA 2AP6A 2QLXA 3R8YA 3M30B 4BBYA 3TJ9A 4I7FB 3B6BA 3ILLA 3NMRA 1IKVA 4ZA1A 3MECA 3IS9B 4KGXB 2XSJB 4OJHA 3K5MA 5HLFB 2MKKA 1X4AA 3NGUA 4XDCA 3QFWA 4CLUA 1JLGB 2XYPB 4KO0B 1XMOJ 1CSJA 4CLPA 3HVTB 4P73A 2ZBRA 3HSGA 3W9IA 1B70B 3E2EA 3R7NB 3MM9B 1U49A 2NSCA 3HFZB 2CJYB 3I4HX 1QAXA 5L1LA 1GT8A 5HMZA 2WAQD 4OI2A 3OL6A 3CWJA 2DIUA 4M1KA 1Y00A 4RPFA 4CRJA 3KUGA 5DQIA 3K59A 4LSLA 2EEYA 3KOAA 2M9KA 3PYDA 2ZZNA 4NWBA 2LQJA 2AHOB 3ZZTA 5E5NA 2G4BA 1TU0B 5BYSA 2Z0GA 2ZITA 1KLMA 1ZZNA 2LXFA 1S6OA 1NRKA 2QSWA 3HSJA 4OYBA 2ZM6F 2AYGA 2VU5A 4USIA 2P6TA 4O4GB 4CO2A 3S6EA 3DYAA 2UVWA 3HHNB 2LQ5A 3OR2A 4U8YA 2C2ZB 4ER8A 2VG5A 3D54A 2E5GA 3IRXA 1VLOA 2EPIA 4UW2A 2KJVA 1FXRA 1T05A 4JV5J 4E2FB 4ZOSA 2RS2A 1IBKJ 2ZHAA 4DQPA 4TY8B 4F50A 4RW7A 5JXSA 2IC3B 1HNIA 1UWBB 1TMMA 2EVZA 2IYGA 3T6BA 4NLVA 4TLQA 3Q0AA 2HVHA 1RCOB 3IP0A 1XERA 1S6PA 5J1NA 4JP8A 2HNZB 3JAMU 3N6NA 4Y2MA 4ED1A 5AXMA 5KFQA 3GONA 4EBEA 3OW2R 3US5A 2DO0A 4E8UA 4DX5A 2QN6B 1U09A 1Y7PA 4FXWA 2MZ1A 2XC9A 3PW5A 1R89A 4ZP7A 2OMLA 4HYKA 3EJMA 5IS2A 3N4WA 1VDHA 3B82A 1QAYA 3QLHA 5GAEI 2DPIA 1CJTA 3FJ2A 4OI3A 3WX8A 3CT9A 4DPWA 1IBMJ 3D28A 1QUPA 2I1RA 5FLXY 4C8NA 2B56A 3M8SA 1NAQA 3DRPA 4K4XA 1RADB 2A2CA 3UE2A 3MAHA 1WHYA 5A8KB 1S0VA 3G6VA 1F2HA 2UUBJ 3M8PB 4PXDA 2GGPA 4F3MA 4QIFA 1IR0A 1F3VA 4F02A 2ZVIA 5D0GA 2BANA 4FKXA 4WWSA 1ZYQA 3P96A 3DM2B 1MW7A 1RTHA 3FBBA 3C14A 2KN4A 2XULA 2VDIA 4J90A 1RTJA 4IDKA 4HTIA 2AGQA 1XR6A 4ANEA 4I4BA 3TZXA 1TL5A 2Q66A 4ZITA 2W9BA 3A1YG 1SV5B 2G13A 2WCXA 2ZBQA 3NCRA 5AXNA 2ZEJA 4IRKA 3EZOA 4DV4J 2COLA 2VA2A 1CULB 1VJWA 3HD2A 4NZ7A 2MZQA 1VRUA 4A8OA 2UU9F 3NBPB 4EU0A 4C8LA 1W7WA 1JLCA 3GSDA 2DNOA 2QLBB 2R9LA 3BSOA 4F4ZA 5I42A 3JQKA 4GVLA 1SB6A 2PC6A 3PEJA 1CS4B 3HSDA 5F8IA 1TL3A 2XO6A 2GZOA 3MM5A 3GJTB 2HBRB 4NZ0A 3EXCX 2OPQB 4G9PA 1X9SA 3VLXA 3GV8B 3B8HA 4Z37A 4K4TA 4YY3J 1OY6A 4DV3F 5FD1A 5A2QY 5DO2A 4LF5J 4LF6F 2XWYA 3VHQA 1Y9OA 1S76D 1V5IB 3HSZA 2VFVA 4QU7A 1DQ8A 1SQFA 4X66F 1OWXA 1U02A 1YRTA 2QGFB 4W98A 2BQ3A 2PE8A 3IFEA 1SL0A 3MD1A 3E8OA 2WTFA 4WBFA 2ZBPA 5K20B 1UVLA 1XWLA 1W2BR 3VALA 2Y0FA 3SYZA 3CC4S 2ZVSA 3HHLB 4PUOB 3IWNC 4PYAA 1C1CB 4W4MA 3A4TA 1SUQA 4R5PB 4IG3B 3PR5B 5KFAA 3DLEA 5LSOA 4UY85 1M5OC 1ZPWX 2ILYA 5KFZA 4GEPA 1VBXA 4UY8T 4LFCF 2QLWA 2XLIA 4JYAJ 1SUQB 5K8PA 1I5OB 3D6MB 4QWCA 2QMXA 2VA3A 3MZIA 2R7QA 3BS9A 4B9UA 4DSLA 3CCWA 5L8RC 2CNOB 5KG4A 5KG6A 3BB5A 2PMHA 1CC8A 4NI2B 1L3TA 1FJGF 1FJ7A 3EVOA 2MDAA 1Q1KA 4HI2A 4CO1A 5T7LA 1X0FA 4C48A 3ZZZA 1CPZA 1MROB 3NGRA 3OR1A 1HNWF 3BV8A 3EGNA 2A18A 2HG4A 2E9RX 3ZZYA 4U6PA 1RWMB 1QE1B 2QSFA 5C25B 5F3TA 2RKIA 4M5DA 1YJNS 3HKWA 4IH6A 1HW9A 4YFUA 1P27B 2IY5B 3Q86A 4IG0B 2B7CB 3GV7B 3ZFVA 1DZ5A 2WZ1A 4JI7J 1MWYA 1H6KX 3TJAA 2HK3A 1PBUA 3SSSA 1NH7A 3X1LB 2RT3A 3PW2A 2XLKA 2W2MP 1TKZA 3DU5A 3BBFA 3FSXA 4CLZA 3DI6B 1YBAA 1NCLA 4S38A 3SFUA 1UJ5A 2E1PA 5MAOA 4EO8A 2EW9A 4PKDB 1D9FA 3TEGA 5IXUA 5F9NA 2XNQA 3OD2A 3KJNB 4FPRA 2NR0A 4DSFA 3LPYA 5LXYA 2BDPA 4OQJA 2V2KA 1MLAA 3L7UA 4YB5A 2YQ0A 4FF3A 3H4DA 1S12A 2DITA 2KT3A 4NLDA 1KFDA 1RAHB 5D15A 4C0OC 1BHNA 5T14A 1RYSA 3AH6A 3C6TA 3I9ZA 1HBNA 3DOMB 2E66A 2VFTA 3C19A 3MCNA 8ATCB 4EWTA 3K8VA 1KC8T 4JI1J 4RZRA 2W8LA 1ZM2A 4A8WA 2E1CA 5A0YB 2IIHA 1T9WA 4DR4F 3QLHB 1OY8A 1EJ7L 2VPYB 4WKYA 2C3PA 4HLBA 2MXYA 1CJVA 3M8ZA 5T41A 4S23A 2QLFB 4KV8A 4O3NA 2RQKA 2C2EA 2G0IA 2J0WA 4LR7A 3O44A 2VPZB 4B17A 3M32A 2WK4A 2PEBA 3FZBA 3MEGA 4GRSA 5DZ7A 5KG3A 4PCQA 3UVJB 1NK6A 2CQ1A 4GO5X 2VUGA 3FFIB 4R25A 1OMSA 3G87A 4MK9A 5KT7A 2W2NP 3T5LA 4NCGB 3RRKA 2FVCA 1N54B 2MLZA 5FDLB 2CG4A 3V4IA 3NKYA 1KTQA 3VKTA 2XMJA 3T9NA 4DR7J 3ENWA 4DDFA 1Q0NA 1FD2A 2XWXA 4F0MA 2XNRA 1RT4A 2VD3A 1ZTTA 1BY9A 2HPUA 4JUZA 3BKFA 4NXMJ 4HHJA 4MK8A 3PJWA 3DLKA 3H42A 2WVFA 5A6WA 1Q8KA 1HMVA 4ERDA 4P74A 2DB1A 9RUBA 1H72C 3AY0A 2YX7A 4FKYA 3PX0A 3U27A 3K5PA 1HD0A 4BS2A 2M52A 2FJAB 2LKZA 4RW9A 1U26A 5KFJA 2I6WA 3DRRA 5HQLA 3FNNA 1LV5A 3LGHA 3NGTA 1UZDA 3J7Z5 1WC5A 4ZVHA 3Q22A 1RT7A 3SCKE 2YWWA 3B78A 3DFEA 1WORA 2L3MA 2OFGX 4RNHA 4LREA 5C42A 4ZIWA 2R2SA 3JQMA 2X3DA 2GV1A 5K14B 1JLFA 3BBCA 3GP9A 3R6GB 4DF4A 3PV8A 4K4WA 2AD9A 2ASDA 2MKSA 2EXUA 2ZJQQ 4BLGA 4GC6A 4IYQA 1NJZA 3PTWA 1HNVB 2XGQA 2VH7A 2LXUA 2V9KA 4DCJB 2YWEA 2J6UA 1HWKA 2HHVA 1RJJA 2DEJA 3DOKB 1AUDA 5F41A 3DLLQ 1G1XA 2GAGC 2MJUA 2A6MA 1HQEA 4KBIA 4ZMMA 4K59A 3HK2A 4OZ0A 5BR8J 3RAXA 2CJBA 3PIPQ 3RUBL 1D8ZA 4J9VA 3TO8A 2DGXA 2KL8A 1ACMB 2PO4A 2HNDB 3LAKA 2CQ3A 3Q83A 1B99A 5KG5A 4AQYF 1N36F 3IRXB 5ETTA 5JUMA 2IHR1 2OKQA 1X4BA 3M4XA 4RR5A 1UVJA 1B7FA 1REVB 2HKEA 3SDEB 1K47A 5IQ6A 2XCPA 2AIRB 3E3XA 5K8NA 4RW6A 5DJBA 1ZTWA 4MKYA 1XR5A 3E51A 3MXHP 3VCDA 3BGRB 1VIXA 2ZHOA 1URNA 2GMLA 3LP1A 1L3UA 1RHQB 2DJWA 1WWHA 2MPUA 4I56A 2OAUA 4B9TA 1S1TA 3QT5A 2FJEB 3PXGa 2N7CA 4N41A 2HAFA 2JX2A 2O01C 2I38A 3QT8A 3VV2B 1IBLJ 2FHKA 2ZOFA 1N5QA 2DT9A 2A3JA 2OD4A 4FYXB 2BABA 2MGZB 3VKSA 1LWEA 4P2XA 1ZA1B 3MR7A 4C4WA 1Y5IB 2IM2A 4Q5VA 1D8YA 1QD1A 3W5ZA 1OSDA 2E7XA 3DHWC 1M1KT 4USJC 4PWDA 2YNHA 4ITSA 3SCJE 2GFFA 1GH8A 2RH3A 4WCEQ 1IKVB 1FJCA 3OVSA 4V1Ak 1NJYA 2CQGA 3MM6B 3VQSA 4E0DA 2HHWA 1RAOA 5LSLA 2FJBB 2XYGB 3KFWX 5CH7B 4J9LA 3IN5A 2EBEA 3B0LA 1RUSA 4FS2A 2CJQA 1U7LA 3KK1B 2KFYA 4HH0A 1VQPS 2I0XA 4S3DA 2LDIA 2ZDPA 1J5OB 3G82A 1CJKA 1RWVB 7FD1A 1PBAA 1T8EA 3AQPA 3BO2A 4CLSA 3UI3A 4YHHJ 1JXVA 1WJ9A 4K0KJ 1BQNB 1TL7A 2HZAA 3LH2S 1SH3A 1FWKA 1F9HA 2RKIB 1IBKF 4LF9F 3RG6A 3BSAA 1IR2A 1MNEA 2JDJA 3DGVA 5A0YA 2W9CB 1VQMS 3EX7B 2VODA 2P9GA 5DZ6A 1Y5LB 4NCGA 5H1SV 4ECTA 1O6XA 1FKPA 2DNYA 2EK6A 4L73A 4NYOA 1AFIA 3QWPA 2GHVC 3M6WA 4ES3A 1JLQA 4DPUA 1RB0A 2J7WA 3TARA 2C2OB 1TUGB 1JJ2R 4FPIA 2DXDA 1KLNA 1HA1A 1RGVA 1CQMA 2XMKA 5HBMA 1A7GE 3IGVA 4X4TA 5E3AA 3VAJA 1AZSB 4EEYA 3MOZA 1N34J 4FYDA 4NYPA 5F0UA 4A8KA 1PJ6A 3PNIA 2DCLA 5LL6d 4MIAA 5J2PB 4F25A 1DJ0A 3NL0A 2BE2B 1D9AA 1B4SA 3MM5B 1FEEA 1KQKA 2VBZA 1N48A 1X5TA 4HDHA 2R8JA 4X66J 2J8AA 1XNQF 3BM7A 1YLXA 2Z2LA 1D09B 3FQLA 4Y00A 2I8EA 4F26A 3BSNA 2IPOB 1FKOA 1KR4A 1ZAXA 2A1BA 3Q8PB 3BGUA 3TZZA 2HS4A 3KDNA 5HLFA 1ZM9A 1WNEA 1RTDA 2FLOA 2GJFA 2ZOMA 2RRBA 1K1SA 3UPFA 2R7RA 1S97A 3QO9B 1T02A 5J2MA 2L9NA 5KT3A 1I3OB 1OYDA 2CQPA 2OPRA 3FRZA 1RHKB 4JBCA 2LVWA 4NZ6A 4TXSA 5IV3A 4HACB 1FKPB 4G38A 3GB0A 3T1HJ 3LTOA 1R8AA 3G86A 3H4BA 3QAEA 1ITPA 1PJ5A 3FCHA 3G96A 4GKKJ 1YBUA 4JV1A 2DRBA 4RNOA 3KUHA 2GEPA 6AT1B 2XLJA 3HHDA 3QO9A 2FTRA 4YEAA 4X4QA 1RT1A 1R3NA 4O3SA 1CULA 3EDQB 3P5BP 4PUOA 3R5GA 4B9SA 4IUFA 3JSYA 1FDDA 5J2QA 1PYSB 1HARA 2H4WB 1S57A 4HHHA 3BKUA 2IJRA 2EFQA 4LR9A 2JL9A 2AZ3A 2G0CA 4NLXA 1JX4A 1VQ4S 1YTYA 3RR7A 2CADA 2VB6A 1VFJA 1H0HB 2VFUA 1RTJB 2ROEA 4IDKB 2ZC3A 4TY9A 5L38A 1APSA 3L95X 3CCTA 2AYMA 4YB6A 1FXLA 3HVRA 1YDLA 5EHHA 3RTVA 3CULA 3CMQA 3OLBA 3RB3A 2ZD1B 2EC0A 4GKJF 1Q79A 1RAEB 4N8OA 3JTNA 1CBKA 3OLAA 4L6V3 1NSKL 5J2NB 4MKBA 5EWGA 2G0JA 5I42B 1Q4RA 1U1OA 4OZ2A 2E5JA 2ZE2B 3U1NA 2DHAA 1HNIB 1X4FA 3AXKA 4GVBB 1FE4A 1R0BG 2ILZA 4Q2MA 4LT6A 2H65B 4PXBA 1RT3B 1QY7A 2DHHA 1SV5A 3DRXA 4CO3A 1KS2A 5D4NA 4DL6A 5E2QA 3CGIA 1UP1A 2K3IA 4K5SA 1S1UA 4LRAA 3D2WA 4USMA 3D68A 1KEKA 4ICLA 4DFKA 4C3MA 4LRBA 1RABB 3JYTB 4OMFG 2R7SA 3OFEA 3WHIA 1VHIA 2XI3A 3HMJG 3GZ7A 4ZLLA 3HT0A 1HHSA 1GTHA 4DL0C 1B0TA 2FQQB 2U2FA 1CC7A 1T3OA 2B6AB 2C2MB 2DNNA 3QQCD 4PPZA 5B0GA 4R0EA 1I6JA 4CLLA 3PYFA 3GYXB 1P9YA 3DGPA 2PFFB 2GQCA 1T9XA 3N0VA 5HANA 2ZNYA 4UT4A 3HHLC 1H73A 3ZNJ1 5KTQA 2HGNA 3IMQJ 4AL7A 3DLBA 3PW4A 1VR6A 3VVTA 2GVDA 2HHXA 2YKOA 1IJFB 4PR6A 2KM8B 4TY8A 5H9EK 1S79A 4DSIA 4W90B 3SCIE 3OXLA 4GMKA 5GEPA 4LF4F 1JLFB 3VAHA 2E1AA 2DH7A 2RSQA 5ETKA 4U7UK 2DPJA 4S3BA 3BO3A 1JLAA 2QFIA 5JMNA 3OTDA 3OR2B 5ITHA 3ZXWA 1IJEB 1OPZA 1RT6A 4KGZB 3UN5A 3NWGA 5E3CA 4TU9A 1VQ8S 5DG9A 1DTQB 4J91A 1YVFA 1V5VA 2MZJA 4CM0A 3PCOB 3BREA 3ET6B 2OPPA 3BQ2A 4DR2F 2MZRA 3NAHA 5ETMA 1B3TA 1GFWB 1HQUA 1KBRA 2FYXA 3MD3A 1HW8A 3BGRA 3OL8A 4A8MP 3PYGA 1M90T 3G6ES 4FBTA 1JLBB 2QEXS 2KG0A 3OFHA 2RVJA 1JJCB 3DRYA 4MKAA 1K8AT 4OJGA 2JLEA 2B9XA 2G9OA 3PZPA 3G71S 7AT1B 1QLNA 2W4CA 1RT5B 4OL8A 3D1OA 2OPSA 4ZCIA 1F5AA 2GHPA 1TKXB 3JTPA 1FRLA 2NUUG 4JB8B 1KWMA 1RT3A 3N01A 3TAPA 2BW2A 1F9EB 2OPSB 2GVDB 2Z30B 2WSFC 3BDEA 4I67A 4H54A 2RU3A 3G9CA 4I6WA 1T03A 4P9SA 3CB4A 2W01A 4B3MF 5KFOA 8AT1B 2BOAA 3A12A 3CSKA 3HDSA 1VBKA 5GAHU 2OELA 3O3LA 4RW4A 4ETXA 4TQRA 4ES1A 3DLHA 5M2PA 1U47A 3BPSP 3CTRA 1S48A 3I55S 4O3OA 1H2UX 2IYIA 3MEEB 1OIAA 1U6FA 5K14A 4LSLB 4Q0BB 3W62A 3QNWB 4XPEA 2HQ3A 1RT7B 4DL3A 2FDNA 3SFGA 4K5RA 4PWDB 2DGOA 3MCSA 1KHVA 4X64F 1RXOB 1EQ0A 5KFBA 1MU2B 1KHWA 1R8BA 3GMGA 4QJVA 5DS7A 2PN6A 3CDBA 1PC4A 3QT6A 2KRBA 2Q6BA 3D6HB 4M5IA 4PG4A 4ZLPA 4DLEA 3J7YU 3RBEA 1N5SA 3CJRA 3H8YA 3ILJA 9ATCB 2B9WA 3CJ3A 3ELHA 2JEFA 1G6BA 3H98A 5U47A 2Y0BB 1HYSB 1KN6A 4OYZA 4UZBA 1MWZA 2W24A 2HZVA 4GO7X 2MY8A 5AE3A 3AAWB 4OZ3A 3UDLA 2XEXA 2NXJA 3SQGA 1LWCB 1UL3A 2GJIA 1C1BA 4X2BA 4RLEA 2HFZA 2ACYA 3FBCA 1DQ9A 1S72S 1KOOA 3TJ8A 5LMNF 5C2CA 3G4SS 1F2GA 3C6UA 1B0PA 4ZHRB 3KLVA 3GIKA 4RW8B 2I9SA 4KFBB 4DFJA 3MEDB 1HFEL 4N56A 4DV0J 3KMQA 5D6GA 1WKLA 2CNLB 4JI0F 1X5PA 3PHTA 1NSQA 1YHQS 1NK0A 3LP2A 3J81j 3ZO7A 2O66A 4P75A 3I5BA 2CVIA 1HQEB 1S49A 2PA8D 4A8FA 2O67A 5DDOC 2HURA 3A8JA 3D67A 4QYZK 2Q6CA 2AJ2A 2QMUB 4WYWA 3GJSB 1NNDA 1BE4A 1XIQA 3BYRA 4KSEB 2M7SA 1N88A 5JJBA 1S6QA 2QTWA 3HHEA 1S4FA 2HQGA 3CD5A 4H4OA 4IOAQ 4XO0A 4K4SA 2HBZB 2AX1A 2CZ9A 2DH8A 4DPXA 3I0RA 1RWPB 3V2UC 4LF2A 4ZPBA 5EWFA 2UXDF 2P6SA 2AWZA 2IAJB 4Q8EA 1R8CA 4DV6F 3AJDA 3WQPA 4GKJJ 2HHSA 3RB0A 1S1UB 1NZAA 1ZAVA 2K2PA 5CQGA 4ECYA 4KTQA 1C0UA 2B43A 3GFHA 3ILOA 2GA7A 4OLOA 3PVXA 1QVFR 5D77A 2XI2A 3MCMA 3IWXA 1HD1A 2G2OA 1W26A 5HJXA 1QUVA 3TRGA 2HWTA 2BRKA 2ZE2A 3CDAA 3GILA 4G65A 2OH2A 2F40A 3HPOA 2C2DA 2ZWPA 4LVNP 4JI0J 3W63A 1X5SA 4YR2A 1KQGB 3THPA 2BJ9A 2CZVC 1RE1B 2F65A 1JKHB 3ZTSA 3V6DA 3LW5C 4PEOA 5C24A 2QC3A 2Z2ZA 1ELOA 3IAM9 2D69A 1S99A 1MG7A 2ZOGA 3W5XA 2HK2A 2OPQA 1NH8A 4O4RA 4J9SA 1LEOA 2FLNA 4FF4A 3C15A 4YR0A 3LANA 3TVKA 4C11B 2XO7A 1CS4A 5IFMA 4GKKF 2KYZA 4ILRA 2ATCB 2YWFA 1L3KA 2V2ZA 1JLQB 3VAKA 2ABYA 4PYDA 2VOPA 3MUMP 4X4OA 1UMJA 2K06A 1M5SA 2K7KA 4C11A 5A6PA 5DQHA 1RTDB 4CO5A 5L1IA 4B3SF 2KJWA 2LA4A 5B0BA 4BHQA 1NK4A 1GXUA 3FMBA 2Z8QA 4A8YA 1K1QA 2CJ9A 1YKWA 2CPDA 2DGTA 3GTYX 2EFPA 1BQNA 1TL7B 1X0PA 3BGFA 1YX2A 1OYEA 4DV5F 1F0XA 2HQCA 1RKJA 2K1RA 2MKCA 4UOGA 1RBLA 2HEKA 2O3DA 4C3KA 4IO1A 2UXBF 2P8IA 1U45A 5KG0A 4NLYA 1S1VB 3UR3C 2D9PA 2RDDA 4PABA 2CWXA 2OUGA 3Q8SB 4DUZF 4K4ZA 2OPRB 5IT0A 2RE1A 3CW2C 5HSPA 2HYIB 1X7VA 2BJEA 2QZ8A 5HROA 2G2ZA 2OJ3A 4YR3A 2MZSA 1GMUA 2OPPB 2AQ4A 4KT0C 3RZAA 2FJWA 1I51B 3M9MB 1TKTB 5AOPA 1VQ6S 5KT2A 1HYSA 5ETNA 1S1WB 3SV3A 3GIRA 1FFSB 2BKOA 4PQUA 4FNIA 1GAOA 5KG1A 5LM7E 2DKOB 2H5EA 2XY6A 1CJTB 4OX9J 4UUXA 4YQWA 2CXEA 2ASJA 3AA8A 1UVNA 3NAIA 2JZ5A 3P6YC 1WTFA 1EAYC 1S0OA 2R8KA 2DGQA 3Q89A 5ETLA 2OIHA 1NXIA 2CFXA 2DXFA 2EBGA 3ITHA 3BF4A 3K2YA 3M1VB 4LIRA 3ENVA 1NJIT 1D1UA 5IWAJ 3S8SA 2VG7A 1RU1A 1I94J 4PQAA 4PG5A 4FP9A 1MN9A 3LO3A 3NP5A 1O5JA 3PKYA 1VQ9S 3H0PA 3KNGA 3UDCA 2QA1A 1C0TB 1WC6A 2CZ4A 3CDUA 3KLIA 2HIQA 4PWWA 4DS5A 3VKPA 1U6BA 4PG6A 1T94A 3MAAB 3QBCA 4CP5A 2HVZA 4ED8A 2J9CA 1SQEA 4DXLA 2IC3A 2DGWA 1VK3A 4ZHRA 2QMWA 3KK3B 3K58A 4X4PA 3CPWR 1XMOF 3PW7A 1WG5A 1VBYA 1CLFA 1IM6A 3IG1A 1SC1B 5BYQA 4BC7A 4Z7YA 2AGOA 3RRGA 1NDKA 1EHWA 5AE1A 2BJ3A 2F3JA 3CCJS 5F8LA 2HZCA 1EKRA 3VGVA 2CKWA 2RUSA 1RWXB 3V6HA 4QCLA 2MQLA 3MPUB 4I6AA 1SJQA 4CO0A 4CNYA 2NLWA 3FK4A 3ONQA 4UTGA 4F04B 2Q3PA 3KK1A 1H7WA 2RQ4A 2XHCA 3JSMB 1W25A 1ZPVA 2AZ1A 4RWWA 4WTYA 4RUBA 2F4VF 4KHPJ 2YKMA 1HWLA 3U02A 3HT3A 3MOJB 1QM9A 1HPZB 2BJDA 4DX6A 1FXDA 2MHNA 3IM8A 2BOPA 3MM6A 1VS3A 1V6HA 2V69A 3SIPB 4KRWA 1LKZA 4BC9A 1DRZA 3ZNUA 5KFDA 2HFUA 4L76A 5KFSA 3BGLA 1NPPA 2VF3A 4NEZA 1VGYA 3PRBA 2BACA 3FSIA 1HPZA 2ACMA 2M2BA 1YJTA 2CQ4A 3AOAA 4LRCA 4P7TA 5KFGA 1MMDA 5J1PA 4NXNJ 4NRTA 4O44A 1S6PB 1SQGA 3DXSX 2D7SA 4ED2A 4X4VA 3IR7B 1P9QC 5E41A 2E9ZA 4PRFA 3TA1A 4U9RA 4QWBA 4WKRA 5BR8F 1U0HB 3TUZC 1JK9B 4CI0B 2CNKB 2JEIA 2W4DA 2KTQA 1YJRA 4AXIA 1WSVA 2LFVA 3V4IB 1T05B 4USVA 1HNZJ 1RTIA 4XPCA 1URRA 3GU0A 3LUYA 2C1EB 2DD8S 3H2LA 4RUCA 4K4YA 2DNQA 3FFIA 4OZ1A 4XTTA 4ZVPB 1Y11A 4LF1A 4IFVB 1JLBA 1JLEA 3KHHA 3HHLD 1TVRB 2ZC4A 3QPIA 4F3OA 2CJXB 4LF7F 2OO4A 3M1VA 1KKHA 3M2UB 4C7QA 1NKBA 1FRIA 3TQ1A 2HRTA 4IOBA 2M5YA 2ZBCA 4MTPA 4EK2A 5HMWA 2PGCA 2ZZTA 4ZVFA 1S9EB 1O0PA 3QJLA 2N4CA 4WE1A 2B4PA 2BV3A 1OPIA 4WPAA 3QRPA 3M8WA 4ZVOB 1YZ7A 3WDOA 2XS2A 2HNYB 4ZJQA 3OTEA 4MIWA 7GEPA 5DG8A 2J9DA 2KI2A 1P6TA 1DY3A 3LOUA 2H9ZA 3IS9A 1T3NA 3KJQB 4IRDA 2QE5A 2BUNA 1U1PA 4I64A 5K9FA 2GS8A 2FJDB 4OI6A 3OTCA 1BMQB 1DURA 4DMZA 4S3FA 2CQHA 2LP4A 4Y2CA 1NK8A 3J81U 4JI7F 3CD6S 2VIHA 1UWBA 2RU9A 4O0IA 2IFXA 1U1QA 4OHZA 2KHCA 4R8UA 2K7JA 2CPHA 4OJ1A 2RHQB 3OHBA 3T5HA 1YRXA 1JKHA 4OYAA 3MR5A 1BQMB 1S9FA 1GNKA 5DM7Q 3QGPA 4ID5B 3M8RA 3DOLB 4HR2A 3GV5B 1X9WA 2DNKA 2O5DA 2RB7A 3UD4P 5L9NA 1SJFA 3AJ1A 3U1MA 5CYJA 1Y10A 1RZMA 3EUNA 3NG8A 5DGBA 3CCSS 1S59A 1ZAWA 1WF2A 4AYBD 1SBRA 3CDWA 3ZZUA 2XGPA 2IJFA 4ES2A 4J9QA 4LQ3A 3BQ0A 1LW2B 4Q44A 5AE2A 2CWKA 4LF8F 3W64A 4RKUC 4B3OB 2E5IA 2CPEA 3JTOA 3QIPA 3BO4A 3Q8QB 1U1MA 1E6YB 1U2RA 2UV8G 4G1IA 5DDQC 1AT1B 1U1LA 3N6MA 1ZJ9A 3G6XA 4CZCA 2F8MA 5L1KA 3KDOA 4DV2J 3CO9A 4CIOA 5CCLA 3EE3A 1ZETA 2VFSA 3NS6A 1XNRJ 3BSCA 3DMJB 4NL5A 3MPVA 4Y3CA 2XS7A 2IVFB 1S1XB 4CLTA 3FUYA 1M5PC 1YBTA 4QR1A 4G1QA 1EP4B 2CPYA 2WB4A 5SZTA 2VC0A
chains in the Genus database with same CATH topology
3I9V9 3HVTA 2YNFA 2JFKA 4F2RA 4YUDA 4OHYA 4KB7A 3MHYA 3R5AA 3RU0A 1SL1A 1WEYA 2JVOA 5IWAF 1I94F 4DBQA 4KPYA 3H59A 4P2SA 1N0UA 1Q8IA 1R8PA 1Y0HA 1ZM4A 2C3UA 3M05A 4PXCA 4OHXA 1TP7A 1WG1A 2IAJA 1S10A 2PDAA 4RW8A 3I0RB 2AJQA 1UAWA 2ASLA 2RRNA 4RX6A 3A8EA 1JWWA 2LLZA 1Q86T 4DR7F 2KFZA 2MQNA 3FEZA 4ILLA 3M8PA 2V8GA 1C1CA 5CZVA 5CCMA 3EYZA 1SIWB 3DOKA 1CQNA 1QAIA 2M3DA 2AKJA 1Y5NB 3HXMA 2VKZG 2HFNA 4B9MA 1DFDA 2RUGA 2W9BB 3CVKA 1EP4A 1UEVA 3D0IE 3R1LA 2AYBA 4WXOA 4RUHA 3CCQS 2L41A 2MKHA 4G6VB 2FLLA 2CJKA 4JI6F 2N82B 3PR4A 1XMQF 4EO6A 3SZ2A 1E6YA 5K8OA 4QU6A 2CQ0A 4F67A 3VM1A 2XY5A 5FIIA 4NLUA 4IG3A 2RF2A 2DGUA 1YQHA 2B4VA 4HH1A 2DO4A 2J0SD 1AFJA 1FDBA 4DQRA 4DG1A 1G7CB 3AB2B 3NCPA 4IFYA 2ZH8A 1B0VA 4ZS6A 4C98A 2IRUA 1N33F 1N5TA 3MM7B 1FHTA 1RK8A 2FD2A 3KLFB 2F9DA 2HS0A 2HWIA 2FB0A 2YKQA 1OS5A 1UFWA 2P9CA 4MMOA 3Q2SC 5LT5A 4ELUA 2F1FA 2HMIA 4KIAA 3K57A 4O4GA 3LP0A 5L1JA 5GADI 5KT5A 3N6LA 2C3OA 3TYTA 2LECA 1S6QB 1WTBA 1FKAF 4B3RF 2PMZD 1UJ4A 4ECZA 1OO0B 3MI7X 2XMTA 3F41A 2NS1B 1UETA 1DTQA 3M2VB 2UZAA 3J7YI 2Q1LA 1FJGF 3N28A 1KN6A 1Q81T 3PIOQ 3QZ8A 4NOHA 2UUAF 3M6UA 4BWMA 4J9MA 3GIIA 3QMQA 1NEEA 5G0RA 2RDIA 1G3OA 2MGZA 4PG7A 1KOHA 3AJ2A 2PIIA 3TA2A 1JLGA 4KO0A 3CMAS 1H3DA 3DYAB 3DM2A 2ZZMA 2KH9A 1HWUA 2ALZA 1UVKA 1S1TB 3T3FA 3M2RA 2ADBA 4B9NA 2PI4A 4N8NA 3TAMA 3QZ7A 5EDWA 1N0VC 2DVIA 2YKAA 2XBPA 4TYAA 4JV2A 1TL1B 3K8WA 4Z2XA 5JVHQ 1KQFB 3RRHA 2HMIB 3QGIA 4DV7F 1X5OA 2WOMB 3VAFA 2EI5A 2ZH7A 2VV5A 2FJXA 2BXJA 4OI0A 3IC1A 2ZNZA 5KFRA 3T5JA 1X9MA 3KHLA 5KFPA 4DL7A 4S39A 4HDGA 2B51A 3OR1B 2IVYA 3O6QA 1IM4A 1R0AB 3M6XA 4RBTA 3Q8RB 4W90B 2E5LF 3I82A 3J81Y 2R7UA 3KWMA 4A48A 3RR8A 3NNHA 2KKHA 2ZH3A 3FEXB 2IRXA 4FF1A 1GX6A 1ZM3A 5LJ3Y 4DL5A 2UVVA 2B3TB 1YIJS 3CJKA 4ZPTR 2UV8A 2L08A 2OFHX 2LA6A 3ISNC 4J9RA 4MFBB 3QIDA 4NLGA 1Q8BA 3B0JA 3R5CA 3H5YA 2J0QD 4C8YA 4I0WA 5GVQA 2GIRA 1WHXA 2YQ3A 4EGLA 2YNIB 3S1TA 3KLHB 3KK2A 2E7WA 4L3NA 5J2QB 3C6TB 1CEZA 4NLQA 3UCZP 3KLIB 3X3UA 4ZPCA 2DIVA 2XSJA 4ECXA 3H2VE 3U1LA 3VZIA 3BR8A 5KFEA 3GQCA 2VPWB 1E6VA 1DTTA 2QA2A 3MGJA 1VBZA 4IRCA 4CO4A 4QPTA 3W2VB 5M2RA 5F8HA 3ZZRA 4JI8F 1WG4A 3VF0B 4Q45A 4MJKA 5DDPC 3DLGA 5B09A 3OFGA 2CQBA 2E9TA 2VQFF 4ED7A 2BM1A 2BR0A 3PFOA 3B0HA 1ULRA 2BVZA 3V5RA 4UUWA 2RDJA 5IM0A 2DNZA 2KXHA 4ED6A 4H4MB 5H9EJ 1GXTA 4I1TA 1BLUA 3GG1A 3FZ2A 1BGXT 4WFYA 1P1LA 4DOZA 2X1AA 3I87A 4F4WA 4AXJA 3W2WA 2KB2A 2KM8C 2ZH1A 3KMSA 2X1BA 2BANB 5IZHA 3MF5A 4LUBA 5BJRA 3CMES 1M5PC 3OVSA 3ENQA 2JSXA 1HBMA 1VLYA 2D3UA 2VPXB 2CVEA 3QGHA 1E6VB 4OHWA 4OX9F 3PO5A 4IQMA 2DHXA 2CYYA 1HI1A 3UW1A 5CA5A 7FDRA 2HHUA 4UOCA 5I4MA 2JC1A 4WU2A 2PI5A 4N77A 5KFIA 3HZEA 2N4DA 2NPIA 3TW0A 4DN9A 4NLSA 1U24A 3KK2B 1TKZB 4ID5A 1SJ1A 2CJAA 1TR0A 2Y0SD 3CF5Q 1LQ9A 3HFKA 1LOUA 2EFOA 2FGOA 4AFFA 1TQLA 2JH3A 2WW8A 4CH1A 4LF5F 4Q0BA 2ERRA 4NA2A 4ED3A 5CZXA 1U48A 2D3OR 4H4OB 1Q53A 5KFYA 4HI1A 1NK9A 2KXNB 5D4LA 3J7A1 3HF5A 4KHPF 2AOPA 2OMOA 1Y4ZB 3NRBA 2FLPA 3KNAA 1X4EA 1FK9A 4A8SA 5CYMB 2JEGA 4ATNA 1FRXA 3CCRS 5B08A 1C0UB 3I31A 4CCHA 4JI4F 5HP1B 1IBLF 4DWIA 3SSQA 5E0OA 1SL2A 2YWHA 3VTIA 2WONB 1LWFB 5KT4A 2YWGA 1RQ0A 5KFUA 2QV6A 3I4PA 4URQU 1RT2B 2EG2A 4LQ9A 5THWA 4ZPDA 3M6VA 4WK3A 4AOPA 1WI8A 4NX9A 4RWXA 3SQGB 2PEHA 4HVZA 4H4MA 1C2PA 1SKRA 2JOQA 1VK8A 2XMUA 1YGYA 2CPJA 1JLAB 3GYNA 3KG1A 1HNXF 2FVPA 4ELTA 2W9CA 4USHA 5F8GA 1X4HA 3CXCR 2IBOA 4MH8A 3RYLA 1Q7YT 1H98A 5I3PA 3VM0A 1UVMA 4U7CA 1N5VA 3D1QA 5L9XA 4ECQA 4YOEA 2GHWA 3C66A 4ZVGA 5J2PA 4C8KA 1PC5A 2J7KA 2WB1D 1DHMA 3HVWA 3OJSA 5KFHA 4I7FA 2Y1RI 2POKA 2RNEA 2LU2A 3HO1A 3C2PA 1KQSR 5D3GB 1WF1A 3MMBA 2BA9A 4NPOA 1IQZA 4EFAC 3SXLA 5F8NA 2DHGA 4QOTA 3MPYA 1FE0A 5KOWA 3B0NA 3GFZA 4F2SA 3I0SA 4GC7A 3BZQA 4H4KC 4LJMA 5E3QA 1HBUB 2EFNA 4OFZA 2DBBA 4RW9B 1UJ6A 2C2RA 3OSNA 3B4MA 2HWHA 3L7OA 3GE9A 4DR1F 4DN0A 5LJ5Y 5HQ8A 2DR7A 1H2VZ 2W25A 2R7XA 4FZVA 5F8JA 4RBUA 4WYLA 5JVGQ 1TL1A 2GW8A 2VFRA 4M63A 2NYIA 2KZZA 3Q2TC 2LYVA 4DR6F 2DNPA 1M5HA 4QPXA 1PO6A 3PHEA 3LP1B 4B9LA 2JRSA 2I5JA 2VG6A 1FDAA 3CDEA 4WJBA 2LDYA 4X4NA 4P7VA 2LMIA 3KJVB 2HFOA 1KVIA 2LEAA 4LVOP 2KDOA 3CJ2A 3OPKA 4Y2AA 2OLWA 1N4LA 3KJVA 3B0MA 4YHHF 3QJJA 1C0TA 1Y3JA 1YJVA 4Q7AA 3N9UC 4ZP6A 4DL2A 2HNDA 1XR7A 3LALA 4R0JA 5AXKA 2PA3A 2HNZA 4OZ5A 6GEPA 3MPWA 3MMAB 3G6YA 3DHXA 4CQ1A 1DAXA 3OVAA 4RNFA 4XIUA 3RW6A 1QVGR 2KXFA 3VR1A 4DQQA 1TKXA 5HMXA 1IKWB 1H7XA 3V81B 3UWTA 4DV2F 1IKYA 2BQUA 3GEOA 2R8GA 2P5VA 1S1WA 3OFFA 3PEHA 2XCAA 4WZQA 1UEUA 1VQOS 1JJHA 1M5KC 3V81A 4ED0A 4FVMA 5J2MB 1Y3KA 5KG7A 4DL4A 5HP1A 2PSZA 4WFXA 4ECWA 2WBMA 5KG2A 1MMNA 3J80Y 2AV5A 2OTLS 3WC0A 4QBUA 4Q8FA 3GR1A 3M2VA 1HBOA 3N5FA 4NYZA 2KG1A 3SMZA 2YNFB 1RT6B 3P5TL 2KT5A 4ECRA 3R1HA 4S3CA 4URGA 3BN7A 4S3EA 4QWAA 2EK1A 1NK5A 3TUJC 1RT4B 3N79A 1KD1T 2R7TA 2HHTA 1ZOTA 4XK8C 4CT9A 2E1MC 2V8DA 4QWDA 3G8SA 2J0XA 1IKXA 3QGGA 1VI7A 2IJNA 2SXLA 3IWLA 5CYQB 3H5XA 1MROA 2MQMA 4ED5A 3PRDA 4OHVA 1VIOA 3G8TA 4K4VA 1F5BA 3R5BA 2NQPA 1PSDA 1FNXH 3JYTA 3DXBA 3WZ0A 2RF2B 1T95A 2C22A 5KFTA 5J2NA 2HHPA 4I2PB 2EFVA 2LEPA 4O3PA 4DUYF 2JHEA 4MAKA 2W4PA 3HLUA 5HI7A 1HBMB 4OX7A 1J5OA 5J1EA 3HVAA 1RAJA 3UQSA 3H20A 1D0EA 4FBUA 3NMAA 4RBVA 2HW3A 3KLEA 1TK5A 1FO1A 1FTRA 1FD8A 2DRAA 3RB4A 1P8GA 4YMEA 3UNGC 5DETA 3PX4A 2HQIA 3GFYA 1FCAA 2FIUA 2RQCA 2DHSA 5A8WA 5B0EA 2J7UA 4PPDA 4EYIB 5DDRC 1JIHA 1FKOB 1V9OA 3G8QA 1ZZFA 2D74B 2DGVA 3IRWP 3H40A 1NB7A 3W3SA 4C8ZA 4HTJA 3I6PA 3CC7S 1R7IA 4U67Q 4MYTA 4TLRA 3CCVS 3NCQA 1LXJA 3JSBA 3HHLA 1OQ6A 3VZHA 2IBKA 4G39A 4JOUA 1Q8LA 1S6UA 3CE8A 1QTMA 3TANA 2NPFA 3THTA 1XBWA 3OV7A 4C0BA 4UQGA 2D3ZA 3DC2A 2YX1A 2DK2A 2V8HA 3U7JA 4RUAA 1T7PA 5CYQA 2LU1A 1IKXB 1FERA 4ZCMA 3H2UB 3UCGA 2XY7A 5GADU 3F73A 4EBCA 3KLEB 4DFPA 2AJ0A 4KFBA 2R2TA 5DRKA 2L9WA 3W2WB 1RKIA 3KLHA 4ZPVR 5DG7A 2ASYA 1SJ4P 1U2FA 5I3UA 4M95A 3NOYA 2MQQA 4OI1A 1HL6A 5KFVA 4I2PA 3BQ1A 1LWCA 2YWKA 2HAIA 3PM9A 1QAJA 2LCWA 1NU4A 4QZVB 4ALZA 4CNZA 4EUVA 3MAQA 4ECSA 1SXLA 3TAQA 1SIZA 2RJZA 2ZUGA 2VOOA 5EX3A 2A10A 2CPFA 4FNHA 1QSLA 5K5MA 2YVSA 1JJ4A 4ID8A 5C42B 4ZP9A 1B64A 4X62F 3LGNA 5E33A 2MB0B 1DLOB 4PXEA 2N3OA 3MEEA 4F3QA 4LFBF 5E7OB 1NHVA 5DLGA 3DLEB 2YKMB 2ZH2A 1SI9A 2DNLA 3KLGB 5B0DA 1ROFA 3JSMA 3ZZPA 3J7ZT 1HBOB 2RIJA 3T1YF 1FRHA 3OJUA 1SC6A 1JXEA 4K4UA 2QO3A 4FXVA 2VONA 4QW9A 3KK3A 2ADCA 2VG5B 1VQ7S 3PX6A 4I2QB 4YP3A 2HHQA 4OX8A 2IRYA 1IKYB 2F9JA 4OX6A 1K73T 2M70A 1S0NA 3MURP 1Q16B 3PDNA 1F9FA 4NXNF 3CD0A 3DRSB 1T03B 1Q82T 1YG0A 4F4XA 4BDPA 2RS8A 3OBIA 2X3GA 1MMLA 3IO1A 2QYCA 2PT0A 1J2VA 4TKTA 2E1RA 2AU0A 1TK8A 3HZGA 3PACA 3I0SB 3EGZA 1YJWS 3K5LA 2FVRA 4Y0FA 3T1HF 2JVRA 2DR8A 1WACA 4DEZA 3C6UB 2BQRA 5C5JA 5LMUF 1IBMF 2HVIA 1IN0A 4O23A 3RW7A 2B5JB 1GXLA 2HGLA 4DX8H 5HN0A 3D0GE 4QIGA 4MK7A 4JI2F 1IUJA 1S1VA 2OTJS 3DRPB 3SDEA 2PD1A 4I68A 3ULHA 5HMYA 1J5EF 1RA7A 2GC8A 2CPZA 3KLFA 1HBUA 1QE1A 2WSCC 3MM7A 5C25A 1KSPA 3GG0A 2OSRA 5CYMA 1Z2ZA 1RI7A 2J9EA 2W7AA 4NLTA 3TX8A 5KFCA 4Y28C 1VMBA 2CPXA 3WX4A 2FHJA 5KFWA 1HHTP 2AYEA 2D1CA 1D3WA 4A47A 4DJBA 4KAIA 4ECVA 1LWFA 2XHWA 3ITHB 1S9GB 3MWBA 2XMMA