3OR2A

Crystal structure of dissimilatory sulfite reductase ii (dsrii)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
435
structure length
435
Chain Sequence
KHPTPMLDELEKGPWPSFVSDIKQECDNRAKNPKGLDYQIPAECPDDLLGILELSFHEGETHWKHGGIVGVFGYGGGVIGRYCDQPEMFPGVAHFHTVRLAQPAAKYYTAEYLEAICDVWDLRGSGLTNMHGSTGDIVLLGTQTPQLEEIFFEMTHNLNTDLGGSGSNLRTPESCLGISRCEFACYDTQLMCYQLTQDYQDELHRPAFPYKFKFKFDGCPNGCVASMARSDFAVIGTWKDDIKIDQEAVKAYVGGEFKPNAGAHAGRDWGKFDIEAEVVGLCPTGCMTYESGTLSIDNKNCTRCMHCINTMPRALKIGDERGASILVGAKAPVLDGAQMGSLLIPFIAAEEPFDEVKEVIENIWEWWMEEGKNRERLGETMKRVGFQKLLEVTGTKAVPQHVSEPRHNPYIFFKEEEVPGGWSRDISDYRKRHMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissimilatory Sulfite Reductase, Sulfate Reduction
rcsb
molecule tags Oxidoreductase
molecule keywords Sulfite redcutase subunit alpha
total genus 122
structure length 435
sequence length 435
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01077 NIR_SIR Nitrite and sulphite reductase 4Fe-4S domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3or2A04
3.30.70.2500 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3or2A02
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 3or2A03
3OR1B 5FD1A 4S3DA 3VLXA 8GEPA 1FERA 1B0TA 3VM1A 7FDRA 1IR0A 1PC4A 2XSJA 4S3FA 3MM7B 2VPXB 3VM0A 4CI0B 3MMCA 1GT8A 1H7WA 1HFEL 1PC5A 2WSEC 1FRIA 6FD1A 1Y5LB 4YDDB 4S39A 4HTRA 1ROFA 2FDNA 1WTFA 4S3CA 1F5BA 1Y5NB 2Y0FA 4KT0C 3IR5B 1FCAA 3VLYA 3EGWB 3B0LA 1JNZB 4XDCA 4AOPA 1BWEA 3GEOA 4GEPA 1FDDA 3GYXB 3VLZA 1H98A 1FRKA 3B0JA 2XSJB 1FXDA 1RGVA 2C3YA 2AKJA 3MM5B 2C3UA 1B0PA 1BC6A 2FJDB 1ZJ8A 1JB0C 1BD6A 1D3WA 3IR7B 2VPZB 2FD2A 4OMFG 5BYSA 1K0TA 5GEPA 5BYQA 2VKRA 2PDAA 1R27B 1DURA 3HKZD 1GTEA 3MMAB 3MM9A 2PA8D 3B0GA 1FRXA 3MMBB 1GAOA 3EXYA 2AOPA 7FD1A 3C8YA 2VPWB 4Y28C 2FJEB 5CH7B 1G3OA 1XERA 3AOPA 3MM9B 3B0MA 4ID8A 2WSCC 1ZJ9A 1SIWB 2V2KA 3VKRA 3VKQA 4AYBD 2GMJA 4XK8C 1H0HB 2WAQD 6GEPA 1IQZA 1C4AA 1FDAA 1KQGB 1SJ1A 2VPYB 4XDDA 2GMHA 1FRLA 1FRHA 4L6V3 2C3PA 1FXRA 1Y4ZB 2C3MA 4S38A 1GTHA 1H7XA 3NOYA 4S23A 4S3AA 2PMZD 3OR1A 3LW5C 2GEPA 3MM6B 2ZVSA 4G39A 2V4JA 1CLFA 1C4CA 2UZAA 3MMAA 4S3EA 1A6LA 3MM8A 1JNRB 2O01C 5CHCB 2FJBB 4RKUC 1FF2A 3OR2A 3VKPA 1FRJA 3OR2B 1DAXA 1Y5IB 5L8RC 3VKSA 2FJAB 1DFDA 3VKTA 4DHVA 3MM5A 2V4JB 4OV1A 1BLUA 1FRMA 3MM6A 4G9PA 2WSFC 1FEHA 1Q16B 3IR6B 5BYRA 1VJWA 1F2GA 3MMCB 3B0NA 3MM7A 1BQXA 2C3OA 2Y0SD 3B0HA 1KEKA 1FDBA 3MM8B 1F5CA 2IVFB 1SIZA 7GEPA 2WB1D 1KQFB 1B0VA 3EUNA 1AOPA 1AXQA 1FDNA 3MMBA 4S3BA 6FDRA 1FTCA 5AOPA 2Z8QA 2C42A 1FD2A 1G6BA 2FGOA 3PNIA 5E7OB 4G38A
chains in the Genus database with same CATH superfamily
4DR6J 3W9IA 2EBEA 2V8GA 1CJVB 5L1JA 4IR9A 2DB1A 1UEVA 2D3ZA 4JI2J 2KVQE 3GFZA 3I5BA 2CWKA 3SQOP 1MMNA 3F73A 3MD3A 1FX2A 1RADB 2GC8A 2YKOA 4O4GA 4RNNA 2BM1A 4J9MA 3ZZRA 3M8RA 5DZ6A 4AXIA 1GT8A 1WDTA 3RB6A 3PKMA 3CCQS 3A3OB 2GVDB 4CO2A 2AYMA 3M05A 4PWWA 4DZ6A 4C7QA 1HBUA 3TR5A 3CCVS 3PW4A 4JP8A 5KFAA 3D0IE 2BXJA 2DHGA 5DQIA 1VLOA 1VR6A 4MMOA 4DPWA 2C2DA 4KJIA 4ZPDA 4Y2MA 4EWTA 2V94A 1X4EA 1NKCA 1HWJA 1JXEA 1EQ0A 1NLKL 2BYCA 5E3QA 3CJQA 2E1MC 4JI8J 5KTQA 2IJFA 1B0PA 2B4UA 2WOMB 3G2XA 4TU8A 1N5TA 4M5DB 3OLAA 2UUCF 2VQEJ 2CG8A 1BD6A 1JB0C 1KTVA 2PEHA 1I94J 3IWNC 2ZKUA 3D4JA 2F3JA 2HG4A 2K2PA 4KGZB 3KJFB 3DU6A 5BYSA 3KK2B 3C66A 1WC1A 4JV2A 2MSSA 3H5YA 4ECUA 3R1LA 2BJ1A 3DOKA 3IBFB 2G0CA 4MFBB 3BR8A 3ENWA 4U9RA 3S1TA 4TU9A 1WC5A 1LK5A 2HURA 1T0TV 2IJNA 1RTIB 2ZH2A 4P2FA 1KQSR 4JI5F 1UVIA 2E7XA 2FJEB 3O2IA 1F9HA 2MGZA 1MN9A 3R5GA 1WI8A 1FKAF 4L76A 3AOPA 2CPXA 3N79A 1QY7A 4JI6F 3ZTOA 4ED7A 1L3TA 1JLQA 4GC7A 2WONB 3JQMA 4LF8F 3KNAA 1FTRA 2Y1RI 1NPKA 4TYBA 2GMJA 1F3FA 1UL3A 5ETMA 1SC4B 1N5QA 1BWVA 1FKOB 3KLGB 3ADAC 1T3OA 1AUSL 3J7YU 1Q8IA 4YR3A 1RHKB 1ZZNA 3J7A1 2EKNA 1RT7A 4YY3F 2VQEF 3GG0A 4UZCA 1BGXT 1FEEA 3QMQA 1FRHA 2CADA 2YX4A 2PN6A 2LA4A 2RUSA 5CABA 1BY9A 3PCOB 4LRDA 1R0BG 1EJ7L 3C14B 4OI2A 3CJKA 4JI4J 1TL7B 4MIAA 3M8PA 4CT9A 3PXGa 3CD6S 2KXHA 4ENOA 2CQ3A 2IVMA 4CO4A 1GEHA 2W9BB 2CNLB 2LQ9A 4H4OB 3EPGA 5A8WB 2EKYA 3CJRA 1U02A 1VQ5S 1KNZA 4USTA 3DLEB 5KT2A 2HFZA 2B6AA 4K5RA 3HPOA 4IH5A 2AGPA 1RA7A 2CRLA 1TK5A 4JI0J 4C48A 1CC7A 4NASA 4H54A 4RUHA 3HSGA 3BV8A 2AJ1A 3CO9A 3MEEB 3CMAS 5IWAJ 3IGNA 2W2OP 3ET6B 4OX6A 4PG8A 2QSWA 4IKAA 4IO1A 2W8KA 1H74A 2YKNB 1K73T 3TUIC 3FK4A 5A8RB 5HP1A 5HL7Q 3QJLA 3VR1A 4A48A 1BQXA 3M6XA 1VQ4S 4RNOA 3TYTA 3NNCA 4ZPCA 1VIOA 1S59A 3CUNA 3EZOA 4WE1A 3H5XA 4NLSA 1HYSB 2R9LA 2OD4A 1QE1A 3PDNA 5B0GA 5FIIA 1ZM2A 2YNIA 4HDHA 8ATCB 3E8OA 1FE4A 1FFWB 5HI7A 3MMBA 2GGPA 2W9CB 1V3ZA 2HMIA 5HP1B 1FI4A 3AJ1A 5E33A 1X4HA 4K4UA 1F9EB 2V2VA 4DR6F 2AEJA 3O6QA 2O67A 2BR0A 4RNMA 3D0HE 2HQDA 4OYOA 4OZ3A 1VRUA 3EZ5A 3GMGA 1W25A 1JK9B 1N88A 1WOSA 2VASA 4ZMMA 3UNGC 1YTYA 2WW4A 2IA6A 1HI1A 1T3NA 1UP1A 3KHLA 1BE4A 2R8IA 4RU2A 2YKMA 2CVEA 1FWKA 1Z4UA 1SL2A 3MMJA 4B9TA 2DGUA 2HW3A 2YNFA 3L95X 2BA9A 4M5MA 3SQGB 4U7CA 3GIJA 4DV6J 5HO4A 4KGVB 1V9OA 2K1RA 1UKUA 3U02A 3WX8A 1QLNA 3V6DB 4RBTA 3SMZA 3IR5B 4DL6A 1HIYA 1PG5B 2NXNA 3VLZA 3B54A 5HVFA 3J7YI 1KLMA 2ZM6J 2X1FA 5JJBA 3CDWA 3CJTA 1G1XA 4DV7F 1X8DA 2MKYA 1JQGA 2HQFA 2H51B 2DH7A 2MSTA 2IM0A 5L1IA 4FYWB 4LF7J 1A9NB 3DRPB 3O44A 4HT7A 3UO0A 2ZBRA 2ZZTA 1RAAB 1SC3B 2NXCA 4QWDA 1Q0NA 4GC6A 5J1EA 3LOUA 3CC2S 5J1EB 3KNGA 4U8YA 1YHQS 3BKTA 3CIMA 3HFKA 4WPAA 4QJVA 1VBXA 1Y11A 4LJMA 2LQJA 3N4WA 4EO6A 1M5SA 3QIDA 5EWFA 1RDRA 3NG8A 1G3OA 3HF5A 4NZ0A 2V68A 3ZFVA 2HYIB 4UOCA 4UOHA 3RAMA 4ID8A 1QD1A 3HHKA 4WZQA 1SIWB 2V2KA 2KH9A 3W2WB 2UU9F 1EZZB 3BN7A 4PWUA 1OYEA 1LWEA 2YWHA 2XZWA 1U47A 2H3EB 3SCLE 4KFBA 1NDPA 5CZVA 3SCIE 3PHTA 4LBHA 3ITHB 2B51A 4KPCA 2ZH7A 2MB0B 5ETNA 2GA7A 3WDOA 1WHXA 3DN9A 4OZ1A 3VF0B 4DS5A 3NMAA 1WC0A 1SKUB 2CQIA 4QIFA 2KT5A 2RE1A 3ZO7A 1F3VA 3ZTPA 3DLGA 3PX4A 1N52B 1S99A 4HHHA 3AB2B 4NYOA 1SQEA 3GR0A 2NLWA 3RU0A 1R8BA 4O3QA 2H5EA 2DNKA 2EC2A 2R2RA 1Q5YA 1CLFA 5LXRA 2HZCA 3TARA 3I4PA 1U1PA 3B78A 2BKOA 5C2CA 2M70A 1UEUA 2HPUA 4ECQA 3BN4A 4RX6A 3KLFB 3M7VA 2LEAA 3W9JA 3R2CJ 3KHGA 4NLRA 5E5NA 5KG2A 2LECA 2LEBA 1BLUA 1FRMA 2GZOA 4CO5A 5KFFA 2R42A 2NUHA 1Q16B 5HVGA 3IR6B 1SQFA 4Q8EA 5BYRA 2LFVA 4O0IA 5HMXA 3BGRB 5D4NA 1N34J 4WK1A 1IJEB 2QE5A 3GV7B 2B8QA 4HVZA 4JB8B 5AE3A 4O3OA 5D0RA 2Y1IA 1XWLA 3DFEA 3MCMA 5DETA 2DGSA 3F41A 4Q2MA 1TR0A 3EVOA 3KLIB 2J7WA 2B9YA 2RU9A 3H8YA 4RW7B 4B08A 4JYAF 3AOAA 2P9GA 3PYDA 4IQXA 4F2SA 1OY9A 1K1SA 5A6PA 1OY6A 4HL9A 1HBOA 4DUZJ 2N82B 4MKVA 2B5JB 5T7LA 5KOXA 2W9BA 3JYTA 1VC6A 4QU6A 2CQDA 2DTJA 2NQPA 3QSIA 1CS4A 1U1OA 1NRKA 3MR2A 2MHEA 4Q0BB 1RAIB 3DOKB 1R31A 1TVRB 1ZZFA 4KBIA 1DLOA 3HVWA 5HMWA 3OUYB 4V19J 1S7HA 3P45B 4EK2A 3X1LB 1HNXF 2VH7A 3H7HB 2OFGX 2LU1A 4A8SA 3P96A 2WSEC 3L4BC 2RS2A 3BH6B 4J37A 1VQ9S 4IG3B 2CJXB 1HBMA 1YZ6A 1LNQA 2CXEA 4NXMF 2EPIA 4CWBA 4I64A 3KXDA 2FHMA 1FCAA 1O51A 1SC6A 2FLOA 3GJQB 1CQMA 4ZIVA 3GJSB 3GEOA 4X4TA 2MGZB 2KTQA 5D3GB 1D9AA 4ECWA 1FRKA 1JLQB 4M1KA 3QGIA 4MH8A 1S7IA 4B3OA 2AKJA 3QRQA 2I8EA 3JTNA 1RT6B 3ZTRA 2RQCA 2YWWA 4DLGA 3KJNB 4X66F 2N3OA 3AH6A 2XEXA 3OVSA 2R8HA 1AT1B 1NEEA 3M8PB 3T1YF 3BF4A 4DL0C 4ES3A 1J5EF 3HJFA 2A10A 2C2OB 1NU4A 1VRQC 5ADZA 3G6YA 3HFVA 3N5FA 3R6GB 2QN6B 4DZDA 5DGBA 1WC6A 1OQ3A 3KYLA 3BO2A 2P6SA 5LMNJ 3TA0A 1WI6A 1HNVB 4CLSA 3KMQA 5CYMA 4UZBA 3OVBA 1H3DA 5CXTA 1Y00A 2E44A 5B0EA 2ZFHA 4JV5J 1FKOA 3KLGA 1VDHA 4J9OA 2DNHA 3I55S 4QPTA 1MN7A 4DI6A 1JXLA 1HNWF 4PEOA 2SXLA 4USIA 2RKIA 4ETZA 1GNKA 4DV2F 3CJ0A 4F4YA 1T05A 4XK8C 1CJUB 2MZTA 2HGLA 1O5JA 2V34A 4DEZA 2DHAA 3GIIA 2WAQD 1N5SA 3DRSA 2KHDA 3FZ2A 4ILLA 1TELA 1U09A 4URSA 1D8YA 2QLWA 1IKYB 2QA4S 1KOHA 3ENQA 3LAKA 3NBPA 4OFZA 4OI1A 2XYPB 3SFUA 2RQKA 4DUTA 2LKZA 2JZ5A 2YNIB 4ZCKA 1RHMB 1JLGA 1C0UA 3LW5C 3P8BB 1ZPWX 2EK1A 4O4GB 4H4MB 1KBRA 2BJ7A 5A8KA 4ED1A 1IWGA 3MPUB 4S3EA 2PI5A 1U4BA 2ILYA 2UXBF 3W61A 4K4XA 4ETXA 4ECRA 3A8KA 2D3OR 1J5OA 3J7AN 1FF2A 4EI2A 1KQKA 3J7ZT 3LF0A 2ZBPA 1CJKB 3CCWA 2A6MA 1S57A 2E1PA 2JRSA 2HNDB 3FBFA 1NO8A 3IGVA 4LIWA 4NRUA 4RW8B 1XR6A 2G2ZA 4EU0A 1NUEA 2XQCA 4ER8A 1CS4B 5K8OA 1YIJS 2QG9B 5D4LA 2CPYA 3Q0AA 5ETTA 3PYGA 4U7UK 2V9KA 5HJYA 4DX6A 1S6QA 4KGXB 3RRGA 1PJ5A 3VQSA 3W2VA 1B70B 2P9EA 2ZH4A 1NSQA 5G4DA 2QRRA 1SJQA 2O1PA 4RW7A 4ZA1A 3TZZA 5HLFA 4HACB 4ZP8A 2FHJD 4UOGA 2COLA 4ELUA 1S0VA 2BANB 1F5AA 3G6VA 2UXBJ 1NMEB 4K4WA 4UY85 2BACA 5K20B 4UQTA 1CVJA 1N6QA 1RHQB 1RBLA 2JVOA 1S49A 3IG1A 1S79A 5A0YB 5KFJA 3MAQA 2R7RA 5J2PA 2D9PA 1TL3B 2VDIA 4WU3A 5CYQB 3E2EA 2XTJP 3PRDA 1SB6A 1N8RT 1IKVB 3VTIA 4LFAF 3MFHA 1GFWB 4ILMA 4FXVA 5FD1A 3EX7B 2XMMA 3VLXA 4URGA 2MKKA 4RL1A 4ERDA 3M2UA 2F8HA 5LM7E 2IPOB 4P2MA 2RS8A 3KJVA 2DR9A 4OZNA 5SUHA 1DTQB 1RT3B 1C0UB 2LXUA 4HTIA 2UUCJ 2F4VJ 3KUHA 1REVA 3MM7B 1N36F 2DR8A 3OTEA 2ASYA 3AJ2A 1S1WB 2YNGA 1ZAWA 3M1VA 3BPDA 3C46A 2BEFA 4MT1A 3FFIB 2HNZB 2IBKA 1RTIA 3HT3A 4HH1A 1U0HA 2RH3A 3CJ8A 5THWA 4WFAQ 1W7WA 1TU0B 2KL8A 3GFHA 3MPVA 4JI6J 2J7KA 5KG3A 2FVPA 2E29A 3FGVA 3NCQA 4QW8A 4CH0S 3PM9A 2XGPA 4DSFA 4QPXA 2VBZA 2CG4A 2D1CA 1CULB 2AF6A 2BOAA 2JOQA 2V6AA 2XMKA 3QBCA 2IVYA 2XSJB 4I2QB 4Y2AA 1UPPA 2A3JA 3ETMA 5D4OA 5HBMA 4KHRA 4RU9A 1RTJA 3LP2B 2GAHC 4NLQA 4KE5A 1FJ7A 2W4DA 4KKOA 1RT1A 3CC4S 3OTOF 4DR7F 4ZLPA 3IR7B 2IM1A 1S1VA 1TK0A 2MJUA 4KB7A 2KKHA 2FUG9 1WF1A 2DISA 3D6TB 3NXZA 5FLXY 3KJVB 1JJ2R 4V1Ak 5K14B 2KVIA 1FWPA 4DR5F 2DNNA 2QGFB 3AXMA 2QT7A 4IYQA 1XN9A 4A8XA 1LEOA 3H59A 2ZH8A 3T5KA 3NOCA 4GO5X 2X1GA 3GLJA 1IXKA 4U67Q 1CQNA 2MMYA 4WXWA 1YVFA 1FK9A 4RWWA 3AQPA 2MQQA 4B3RJ 1WEXA 2EXUA 2N3LA 2V69A 3MPWA 1OQ6A 4HDGA 3S01A 1VK8A 4G1QB 1RT5A 4XPCA 2CZVC 4DSLA 2Q6CA 4EGLA 5DDQC 5I3QA 2HLTA 1KQGB 5KFLA 5KFVA 4ECSA 2MEWA 5BJRA 2ABYA 2DO0A 3UWTA 4RWXA 1TZ0A 1DQAA 3NGRA 1QDUB 4J9RA 5KFPA 2WHOA 1HNIA 3GFXA 1ZM9A 3H4BA 3IFEA 1X0FA 2NXJA 1S0NA 2UP1A 3KUEA 2F5GA 3M6WA 4S3AA 1KKHA 3V6HA 4ZPVR 4A8FA 3CWJA 3OR1A 1RT2B 4OHWA 2DT9A 2RF2B 1M1HA 3S8SA 3BO4A 2RF2A 3GIRA 3BSNA 1EB0A 2W2NP 3FEZA 1GXLA 3IAM9 3OTDA 3DRRB 5A8RA 1Q8KA 2E7WA 2HS4A 4M5JA 3T1HJ 1PO6A 3TOQA 2GO8A 2K8GA 2WCXA 1HHTP 4IRDA 3DGVA 1WNEA 2E5JA 4DDFA 2J8AA 3TI0A 2OEKA 4KH1B 4OQJA 4Z2XA 1FNOA 2PT0A 3KUGA 2IHR1 3V81A 1FD8A 3MWBA 3OL8A 2MQMA 4HACA 3GSDA 5DDPC 2QO3A 3C6UB 3IBWA 4ED3A 2ZH1A 4QR0A 4F4WA 3HHNB 1C0TA 3MCOA 2Q66A 2XLKA 3G8SA 3WX4A 1AFJA 1SIZA 3W2VB 2Q79A 1YJTA 3NAIA 3WIVA 4ZJLA 2W24A 3UN5A 3PZPA 2WB1D 4LF8J 4C8YA 4FDFA 2R4FA 2ZUAA 1RB0A 2CVIA 2QJ3A 2HSEB 2K3KA 1UJ4A 1HQEA 2AZ1A 3H0PA 2EFGA 4H4KA 3SBMA 4DG1A 1L3KA 3IBCB 4I69A 2AD9A 3IRXB 2BOPA 2G2YA 3DLHA 5EN1A 5F9LA 1IBKJ 3B4MA 3ELHA 3M2RB 3T1AA 4GKKJ 2YKQA 1JX4A 1U24A 1WOPA 1DQ8A 1YZ7A 3FCVA 1UJ5A 2XMWA 3KG1A 4FN5A 1RTJB 3LP2A 4BLGA 4F0MA 1B0TA 1RAJA 1QSYA 2JEIA 4FPIA 3FMBA 3NCRA 2ZJRQ 3NS7B 3OSPA 2PE8A 4I2PA 4NLXA 3UFCX 3AD9C 5B08A 2FZKB 2A1BA 4B9NA 1AB8A 5B0BA 3QNWB 3V4MA 4I1TA 3NGDA 1IR1A 2C2RA 2VODA 5GAHI 3HI9A 2E66A 2VQFF 5IT4A 2ALYB 4OL8A 4DPOA 1TAUA 3DM2B 4PYAA 4NRTA 4ZPBA 2Y0FA 2WVFA 3QSYB 1RWOB 1SBRA 4P9SA 1LQ9A 2ZH9A 4WTOB 2OHDA 2NCKL 3PV8A 4JI1F 2RDDA 3E3XA 4WP8A 1BWEA 4PR6A 4NI2A 3JS9A 1ZBTA 3GYXB 4N5SA 1N33J 4X2BA 4I67A 4JI8F 4PXDA 2WBRA 2FQQB 2IIHA 4GRSA 4ZKAA 5KT4A 1NKBA 2C3UA 4FBUA 4DX8H 1LWFA 2XY7A 3MOZA 5D8HB 2L48A 2QL5B 5IT9Y 1RI7A 3GWCA 3D1QA 4RBUA 4WK3A 1ZS6A 2B9WA 4CLTA 5HSPA 4X65F 1ZJ8A 3HJVA 2DBBA 3NAHA 3JQJA 2VKRA 1Q78A 4IFVB 5BYQA 3DLBA 5ETKA 2CPZA 3HKZD 4ZJOA 2VICA 3P6YC 1HW8A 2PD1A 4F67A 1KSPA 2GMLA 4XPEA 4ELTA 1YQHA 2AX0A 3POTA 4NCAA 1KN6A 4K4YA 2XYHB 1OJ4A 3CJ3A 1SQGA 2OI2A 4FKXA 4TY9A 4Y65A 3TEHB 4QU7A 3FC9A 3B0MA 2QEXS 3LWLA 3JSYA 3L7UA 2Y9HA 5LJ5Y 4Q5VA 3VKQA 1DRZA 3KLIA 3E51A 1H0HB 1PKUA 4LF5F 1RU2A 5IXUA 3P4UB 3GG1A 2CZ9A 3V5RA 1CJVA 2KJVA 3EGNA 5M2PA 3KWMA 2WOMA 3T1YJ 1VFJA 4XDDA 5T14A 5E3RA 3FVYA 4X4QA 3OV7A 1BQMB 5JVGQ 4DQRA 4N76A 1IQTA 4ZLJA 4CLLA 5C7PA 2IBOA 1T02A 4NX9A 3N6NA 3BKFA 4CLPA 1EETA 4NEYA 2KYXA 2IAJA 4KRWA 3HDSA 1MNEA 5EDWA 4J5OA 3MEDA 2M2BA 4FS1A 3CIZA 3M8ZA 4M5GA 2NSBA 3O3LA 2IDEA 5HLFB 5A76A 1IVZA 2XZTB 3RB4A 4F25A 4ZPAA 1JLCA 3GFYA 2YVSA 3QAUA 3MOJB 3BSCA 1HLWA 3LP0A 2ZH3A 2UVVA 1M5OC 1YRUA 1XNRJ 4DV4F 2HHWA 2VG6B 2XSFA 3FUYA 4ZP6A 3QZ7A 1U6FA 1S76D 3TVZA 3QFHA 5KFGA 5DZ7A 4DV5F 3M6UA 4LQ3A 2B7BB 2XBPA 4Y00A 2FPHX 1T8EA 4WE1B 3D5MA 2B43A 5K8MA 5DGAA 2V63A 4R5PB 3RAQA 1BQNA 4L75A 1NSPA 1YG0A 2VV5A 5CA5A 1YDLA 3D66A 2V4QA 2A18A 3V6JA 1JJ4A 2IVFB 1P6TA 1S48A 3KJQB 2FLLA 5J1NA 2DXFA 4RW9B 2G9OA 1FHTA 2HHPA 1NPPA 4RW4B 1JXVA 4C0BA 4WKYA 4WCEQ 3HK2A 2IY5B 2BZ2A 4ZPWR 3HVAA 2VG6A 3GILA 3CCMS 2ZBIA 2LQ8A 4NXMJ 2DNLA 2BVZA 2MY8A 4FNHA 4LSNA 3W5YA 2PMWA 3B6BA 3SV4A 3TUJC 3H42A 3R9LA 3BBCA 4DV4J 2XMAA 2XY6A 4KO0A 2WBMA 3NLCA 4KO0B 3KG4A 1N56A 2VJUA 3MPDA 2OGUA 3AXKA 4D3GA 2M5YA 3D9BA 3BGOP 3FSYA 1YLXA 2BMBA 2PIIA 4I6YA 4OJ3A 3Q8RB 4ED6A 1S77D 2IDLA 2FJVA 3SEOA 1XR5A 3ZNUA 4B3SF 3RBEA 5D3GA 3N6MA 5KFUA 2DKOB 2R7UA 1S10A 1Y5LB 3M8SA 4FXWA 3BO3A 4X62J 3UD5A 2MQ8A 3W62A 3SCJE 2ZUGA 2YH0A 4TY8A 3H4DA 4DV1F 3R6LB 1U1NA 2KT2A 1S72S 4FF3A 5MLCV 2JLGA 2MKHA 4YB1P 2CDRB 4LRBA 2UV8A 2IM3A 4DN0A 4DR3F 3BEGB 4PKDB 5AXNA 3N6LA 5CQGA 2OMOA 2C22A 1NK6A 1ZTWA 3NEKA 4QWAA 4I68A 3TA2A 4DBQA 3PR5B 2M0GB 4OI0A 3C3LA 2EI5A 3CO0P 4JI2F 3W5XA 1PAUB 2EFOA 3HSZA 3UNYA 3IAS9 1RBOB 4ZHRB 5F3ZA 2B5JA 3HD1A 3FMWA 3MPYA 4NL5A 1JLCB 4OJ1A 5T7LB 2ZEJA 2CQHA 3TVKA 4DR1J 3EM1A 1SKSA 4RUBA 2KZMA 2OPPA 2UV8G 3I82A 1AFIA 4LRAA 2IAJB 4O44B 1JIHA 2RT3A 3K5MA 4KHMA 3M9NB 3LGMA 4PZVA 4FPRA 3QIPB 4OHXA 4OX9F 3PKYA 5J2MB 2QLJB 4NA2A 3M8WA 4TYAA 4BC9A 1RWWB 4C98A 2YKAA 5DM6Q 3UR3C 1V5IB 1NK5A 4L3KA 3SZ2A 4GVBB 4OZ5A 5IT0A 2VFSA 1RAFB 4ICLB 1IQZA 1C4AA 1FDAA 1YSJA 4ICLA 2M9KA 5J2QB 5J2QA 1UVMA 4K2JA 5D77A 2XG8A 5D0HA 3OHAA 2HZAA 2RRNA 4M5LA 1FRLA 5DRKA 2ZJPQ 2KG0A 1FXRA 2XY5A 4DR5J 1TUVA 3GCXP 2MJNA 3TJ8A 1XEZA 1OSCA 2CYYA 5GMEA 1FE0A 1S1XA 1S9EB 2X1BA 4KYZA 1RKJA 5J2NB 3EYZA 2R2SA 3RR7A 2HHSA 3KG0A 1XR7A 2EG2A 4DR2F 4DQQA 4DV3J 2RSQA 3TQEA 4C0OC 3PJXA 3UD3P 1S9FA 4JI3F 4B3RF 4PQUA 5G0RA 2VUGA 3W8GA 2HFOA 2RIJA 5CZXA 4CYUA 2O01C 3AA8A 5CAAA 3KK1A 2N7YA 4OX9J 2KU7A 4P2XA 2J0SD 4W90B 2R7VA 1BHNA 1FRJA 1S0OA 3I0SA 3NOGA 4NMLA 1XNRF 2XNRA 4WTYA 4QYZK 2LXFA 1WEZA 1M5VC 2B4OA 4Y34A 3VKTA 1M5HA 3FEXB 5KFOA 2ADBA 2FIUA 4WP3A 1G7CB 2E7VA 5CCLA 3OXGA 3R97A 4I0WA 1C1BB 2D69A 2GIRA 4TKTA 4P2SA 1TUWA 1N0UA 1N48A 3NS5A 5FDLA 4C11B 1AUDA 3LGNA 4M95A 1SL0A 2BKPA 4G3IA 1HQ2A 4PXCA 2ZBCA 2BE7D 2F1FA 4U8VA 4F7VA 4YOEA 2CNOB 2R2TA 3KHHA 3I0RA 4OYAA 2VFUA 4IH6A 1G4CA 2XM3A 2J6SA 3Q24A 5L9NA 3MECB 1W26A 3BQ1A 2W7AA 4DV0J 3UD4P 5C25A 3RBDA 1Q79A 1RLCL 2RRAA 4FF4A 1GMWD 4H4KC 3T1HF 4J7CA 3Q86A 4C4WA 2PC6A 3R27A 2J9EA 1LFWA 2XWXA 3GB0A 1NBEB 1OSDA 2CZ4A 3DKDA 3QZ8A 2DR7A 3D6FB 2C42A 3K89A 5G0RB 3TP2A 4UOFA 2CDQA 4N77A 3DRPA 4C9DA 1KRPA 3T19A 3TO8A 2HEKA 1QAJA 1OIAA 2J0WA 3ZZPA 3RGIA 1PYOB 4S3DA 1FWLA 2D74B 4JOUA 4LIRA 5DO2A 4DR7J 2BW7A 2CAJA 3ZNJ1 2L41A 1ZOTA 3NS6A 2GS8A 1SJRA 2GGPB 3PIPQ 1MWZA 2HKEA 3FCWA 3HFZB 2MZQA 1WC3A 2YNHB 2ZWOA 3DLKA 1VIXA 1YRTA 3ZZYA 1IKXA 3SDEA 4C6AA 4DJBA 4Q8FA 3MUMP 4N8OA 2CKWA 5KAKA 2M52A 2W25A 3H2LA 3DOMB 3KLEB 1DHMA 4N8NA 3AJDA 5H9EJ 3OBIA 4EZ6A 1X5OA 4I4BA 3RYLA 3VLYA 2W4CA 2RVJA 3AQOA 5J2MA 3RR8A 1WTBA 1IM6A 2PSZA 2MZJA 1WG5A 3MR7A 4IQMA 5KFYA 3BBBA 3TAPA 2HQIA 1R43A 2HBZB 1URRA 2DD8S 2DGVA 3I4HX 1RACB 1GXTA 2FTRA 4OYZA 5F8GA 1RTDB 2QMUB 3KTQA 4HTJA 4J9SA 3QO9B 1RHJB 2FB0A 5D0GA 1HBNA 4S0MA 4DOZA 4DQIA 3AOBA 2JC1A 2FD2A 3CD5A 4M5NA 2PDAA 3CPWR 4K59A 4LSNB 4MFBA 2UXCJ 2DNQA 1HD0A 1GTEA 3R5DA 3CXCR 3HO1A 3RTVA 1Q53A 1LW2B 3MMBB 2D3O1 3L9ZA 4L3NA 1E6VA 2CWXA 2C1EB 2XZDB 4EBDA 4QW9A 4QWCA 2JC0A 2LU2A 1EETB 3U1LA 4MK9A 3QQCD 5CYQA 3J7Z5 5A2QY 3TAMA 2FYXA 2MQNA 1L3SA 1HNIB 1IBKF 1N6QB 1BQNB 2A0FB 2I1RA 3SI8A 3VCDA 1KVIA 1RT4B 1Y0HA 3DRXA 2XULA 3Q8YA 4CM0A 4PXEA 4OI6A 4X65J 2DGQA 4PWDA 2W8LA 1HBUB 2I38A 1SUQB 2HWIA 2L3MA 2QMXA 3WZ0A 4CLZA 2FC8A 3R5CA 2J6TA 2BQ3A 2AEMA 4GO7X 5ETRA 2UUBJ 3OL9A 1H7XA 3J81Y 2GO9A 2VFRA 1QSLA 1VHIA 4KPYA 2AEFA 3G6XA 4LSLA 4PABA 3TA1A 4Q44A 3SV3A 5I3UB 2V4JA 3NMRA 1Y10A 3A8JA 2KT3A 5F0WA 2GFFA 4J9PA 3MMCA 1JNRB 4CDIA 4DQSA 2KJWA 5EWGA 4ECTA 2UVWA 3VGTA 4CIOA 3KK2A 1XNQJ 1YJWS 3BJYA 3RW7A 4ALZA 2P2CB 4GKKF 1DFDA 1IBCB 3J80U 3LAMA 4KAIA 4DF4A 4ZVSB 3ILIA 3LA0A 4LR8A 4YQWA 3NGTA 3A8EA 4RW6A 1X4GA 2FZGB 3QT5A 5GMKa 5SZTA 3FCHA 5GAGI 2C3OA 1ZAVA 5B0CA 4IH7A 4FP9A 2D7SA 1KVKA 4B9UA 3K59A 2ZE2A 1PYTA 4EZ9A 4BC7A 3DYAA 2OEMA 2DXEA 5L9XA 3MR3A 2UUWA 3PIOQ 5LSRA 3DMJB 3LPYA 4W98A 4UTGA 4AQYF 4K4ZA 5LT5A 4IOCQ 1T05B 2DR6A 3PYFA 2YH1A 2NXEA 3UDVA 1RAGB 2KRRA 5E7OB 4B3TJ 1T9UA 1NM2A 3QWUA 1RWUA 2WVCA 3EJMA 5BR8J 3L09A 2EFVA 4LFCJ 2HHTA 4TQRA 3IS9A 1PYSB 1HNWJ 4RW9A 4USJC 4ZVOB 1U1KA 4Q2LA 2W2QP 3VVUA 4LRCA 2DGWA 1PC4A 2DK2A 2HWHA 2XSJA 2YXLA 4I2QA 4E8UA 5HBMB 1K9MT 4F3OA 3FBCA 2WONA 3VM0A 3DXSX 2LEPA 1H7WA 4LF4F 1TFWA 5DM7Q 1FRIA 3OXLA 1IKYA 4QZVB 1VI7A 3ZZUA 3FBBA 2X3DA 5AJ3F 2AJ4A 1VHFA 2VOOA 4KHPJ 2HVHA 2MYFA 2IRUA 2HAIA 3T6BA 3PTWA 3JAMY 1DZ5A 4PRFA 2IYGA 2AV5A 3BR9A 4ZCLA 4OZJA 4BDPA 3KLVA 5E3PA 5KT7A 1GK8A 3NGUA 3T9NA 2VZ9A 4E2FB 4IFYA 4M94A 4WF9Q 3PACA 1IM4A 1D8ZA 4P71A 5LXYA 4QR2A 2NYIA 2RQMA 1ZYQA 2V9WA 1TMJA 4ED5A 2DIUA 1GXUA 3JYTB 1DQ9A 4IG0A 2B8PA 4HEA9 3KOAA 3NCPA 1A0OB 4CLUA 1ELOA 2LXIA 2RILA 4RNHA 4ECYA 5KFEA 1SKRA 1K44A 4K0KF 1TUGB 1U1QA 1TKXA 2B9EA 2HIYA 1R27B 1TV6B 4OJGA 1VRTA 2AU0A 4K7QA 1NB2A 2R2UA 4OYIA 1Q86T 2PA8D 4GMKA 1GQEA 1HL6A 4KIAA 2DXDA 3BGUA 3C8YA 2EBGA 2VU5A 2WRMA 1BXNA 2ZD1A 3QGGA 3QPIA 1S9GA 3GONA 1QJHA 4FYYB 5CH7B 2Z2LA 1EHWA 5KG6A 1LW2A 4ED0A 1UAWA 3LWMA 4K2XA 2QLXA 4IO9Q 2Q1LA 1XBWA 5L38A 4JV1A 1K0VA 3R5JB 1X4BA 3UN2A 3VKRA 4AYBD 2D3UA 1WORA 3DM2A 3IWXA 1KC8T 4PWDB 4OLPA 1S6QB 5DG7A 1HPZA 1R3NA 3B82A 3G87A 4P52A 4DU7A 1KWMA 3RZAA 3CD0A 3VHQA 5LJ3Y 4KQZA 2PO4A 4FYXB 4CTAB 3OFEA 3OW2R 1YKWA 3K5OA 5GMDA 2DEIA 4OI4A 4F02A 4M63A 5E0OA 1WWHA 4FF1A 1YX2A 1LWCA 5IZHA 2JLEA 4JI4F 3W60A 2MZRA 4K8RA 4OZLA 2F4VF 2QLFB 2UZAA 1UWAA 2H5IB 2PEBA 3MMAA 2Z2YB 4ECXA 4B9VA 1V3SA 4LSLB 4W4MA 3Q8VA 3OXFA 4RKUC 5EX0A 3Q23A 2AYGA 4O0NA 1JJHA 2QA4G 5KFWA 1Y5IB 1RWPB 2DCLA 2NZCA 2J6UA 3Q8UA 2HBYB 4KH0B 1T9YA 3G82A 3K58A 2EVZA 2FHKA 3FEYB 4ZDNA 4X4PA 2N4DA 2F8EX 3HP6A 5L1KA 1FEHA 1Q8LA 4I6WA 5LMUJ 1TKDA 4FNIA 1T7PA 4IOBA 4EFAC 5KFMA 2XHCA 4Q43A 4LBPA 4DWIA 2OEJA 2KHCA 3D3BJ 3J81U 1Q5VA 2N7CA 1R8HA 1NHVA 4Y3CA 3ZXWA 2UVRA 5IC4B 1EQMA 5HJXA 4EO8A 1PGZA 1M0SA 2CQCA 4B3SJ 1JLEB 1FXLA 2EFPA 2ROGA 2Z2ZA 2XLJA 3MFIA 1RE1B 1UFKA 4NLUA 4TNOA 4B9LA 3GSIA 2RMLA 1KFSA 1AOPA 2CNKB 2DHHA 1F6TA 2DNOA 5JXSA 3X3UA 1J2VA 2G0JA 1SJ4P 2IRXA 3E01B 3K8VA 4OX7A 1F2HA 1I3OB 4DV5J 2LDIA 2IMOA 3HZEA 1X0PA 3MEKA 1HBNB 5IOLA 3OR1B 3P5TL 1T9XA 4DR3J 3R7NB 3UW1A 1HARA 1MLAA 1UJ6A 3QAEA 4OHYA 1P1LA 1HWUA 1TKZB 3VM1A 7FDRA 1IBMJ 2R3VA 4ZOSA 3UVJA 4YR2A 4DS4A 4A47A 4S3FA 2HQGA 3TW0A 4MYTA 2OAUA 2U2FA 3EZUA 3GYNA 1QM9A 1MROA 3SXLA 3T41A 2MQOA 2W7PA 2VA3A 1RAHB 4CYUB 4JI7J 1HPZB 1HKAA 4ZITA 2UUBF 3ONQA 3K17A 4G1QA 1TL1A 3EDQB 2BJ9A 3FJ2A 4TLRA 1S1XB 1S9EA 4AOPA 3W5ZA 4E0DA 1RWMB 2X7IA 4X4OA 1WSRA 2B3TB 2FY1A 5DLFA 5A6WA 4R0EA 1H98A 3UN3A 3B0JA 4MAKA 2W9AA 2ZZNA 4WFXA 3TUZC 3BBFA 2YX7A 5DDRC 2HS3A 3OUYA 1YJ9S 2E1RA 1NJIT 2MTLA 5HMZA 4EBEA 3HKWA 4OYMA 2VFTA 4DU8A 1VRTB 3AFGA 1MW7A 2MKCA 1TMMA 4URQU 1Q1KA 3QT6A 1CEZA 2XWYA 1YJUA 3ENAA 1SPBP 4LF7F 1U45A 2QC3A 2R8JA 1SI9A 4JBCA 8GEPA 1XK8A 1LW0B 1WF2A 1RBAA 3DOLB 3BREA 3MM9A 2KM8C 2MZ1A 4EEYA 2DGOA 4JI7F 5H9EK 4H4MA 3C15A 1RWVB 1R89A 1U2CA 2AHOB 1YJ7A 1ZA1B 4PCQA 3BSOA 2DYAA 4G65A 1UZDA 4Z7CA 5EUHA 4DV3F 4JI3J 6AT1B 3M32A 1ZJ9A 2V8PA 2QA2A 4CNYA 4DPTA 4N41A 2GW8A 1SJFA 3I9ZA 1R8PA 1DARA 1U7LA 2U1AA 2YQ1A 4CM2A 2E5IA 4L72B 3DRSB 4LUBA 2HVZA 4DL3A 2R8KA 4ED2A 4KSEB 3DLLQ 1HNXJ 2V0NA 2B4VA 1REGX 4QCLA 1FJEB 2WK4A 4R0JA 4MIWA 1SV5B 2BQUA 4PUOA 4O23A 4CO1A 3M6VA 4NLOA 2JX2A 5I3UA 3BGFA 1KDNA 1RUSA 3ET6A 4QIGA 2E5HA 2ZNZA 1RT1B 5ITHA 2J76E 4J9QA 2C2KB 1LXNA 3CT9A 3MEEA 1NSKL 2QFIA 4LMZA 1HWKA 2H54B 5EX3A 5KG4A 1VCTA 2YY3A 1A6LA 1RTHB 4PAAA 4C8NA 4KV8B 1EP4B 3GTYX 4ED8A 3THVA 5AE2A 1DAXA 2PI4A 1WJ9A 2FJAB 4F4XA 5E2QA 3N28A 4YB5A 4UUXA 4LRFA 4YFUA 3BZQA 5A2QU 4C0HA 2W9CA 3GP9A 4DSEA 3IMQJ 2MKJA 4FYDA 4U95A 5LSOA 2KN4A 3IM9A 3KLHA 4YS2A 3SFGA 4C3MA 4JV0A 2AJ0A 2MY7A 1Q95G 3HVTB 4GVBA 3TNVA 1FKPA 2ATLA 5IFMA 4FXDA 2JNJA 1UMJA 2XS5A 4O3RA 3FNNA 3V6DA 4MK8A 4NLGA 5F8MA 1N36J 7GEPA 5H9FJ 1RABB 5C24B 3D3CJ 2VBXA 3LTOA 4HH0A 4F3QA 1RSCA 1MMLA 3IRWP 1X4CA 1TP7A 1FNMA 2ROEA 1JLFA 3TEGA 2HHHF 2AJ2A 1AXQA 5B0AA 1VQPS 2E5LJ 2DGTA 3DNCA 4Q7AA 1JMTA 2AW0A 1FD2A 2IC3B 2FGOA 1SCJB 3CJSA 2BE2A 5RUBA 5D6GA 2ZH5A 2R7OA 3RB3A 4PQUB 1FX4A 1S4FA 3CD7A 1UA1A 1JLGB 2JLFA 1N5YB 5GVQA 5HATA 4A8MP 2KDOA 3HMJG 2ACMA 4F26A 2OPQA 1N4LA 1VQ7S 1FERA 2CPIA 2R7TA 5KFDA 2O66A 3VGUA 3UI3A 4X4RA 2ZITA 2IFXA 2RQ4A 3ZC4A 3FDSA 2Z2MA 4QWEA 2DNYA 2VPXB 2AZ3A 3BYRA 4CI0B 1U1MA 4YB7A 1WDDA 2CPFA 2WVDA 4QYRA 1W2BR 3EVWA 2J0QD 4NOHA 2F7VA 2FDNA 4X64J 3G8QA 3TWZA 3PO5A 4DV1J 4G1PA 1S97A 2A6OA 3SSRA 3MD1A 5DS7A 3MUVP 1U2RA 1X31C 2VFVA 2OLWA 3ETOA 5IC6B 5BR8F 4F4AA 3JB9k 1TK8A 4DL4A 1AROP 1DTTA 1YJVA 4I7FB 2VONA 2Y1LB 1NK8A 1E6VB 1IJFB 1YGYA 3TQ1A 4OZ2A 4X4UA 1ZM3A 4ZVFA 2FJDB 1D9FA 4MYUA 1PAEX 5ETPA 2AGOA 2XS7A 4LSZB 3FSXA 2AT1B 3EGVA 1XC9A 1NJYA 2DGXA 3G86A 2HNYB 2QLBB 4A8KA 1EKSA 3W8PA 2VQFJ 2J0XA 1XMQF 3GIMA 2RNEA 5LMUF 4EYIB 2G1DA 2HRUA 1PSDA 4WFYA 4ZIWA 4XTTA 2DNZA 2DR5A 2GJFA 2J7UA 2O3DA 3D0GE 4RJVA 4ZLNA 3A12A 2FJXA 1NCLA 5AXKA 2FLPA 1NDLA 2ZJQQ 2Z30B 5J1PA 1YK9A 1S1UA 2AQ4A 4AE5A 3K7RA 1IBLF 3BM7A 3TVYA 5HMYA 3UR0A 2GAGC 2VG7A 2DPJA 4P6QA 3NNAA 3W3SA 5F8LA 2AX1A 3KLEA 4UUWA 4K5SA 4A8OA 1S6PA 2DEJA 1TQLA 3B4DA 3O8WA 3TZWA 3QIPA 3PVXA 4ELVA 1XNQF 2AMCB 3UE2A 3HHLB 2JWNA 6GEPA 1LWFB 5C24A 3PRVA 3BDEA 3OFFA 2YNHA 2VDHA 1VLYA 4WIIA 1HA1A 2BRKA 3C16B 5E3CA 1H72C 3GV8B 3CC7S 2MDAA 1ACMB 2C3MA 2GQ2A 2RJZA 4ATNA 1H2UX 3KLFA 3A4TA 2DRBA 4S23A 1X7VA 4ZCIA 2KZZA 5C42A 1T9TA 2ZDOA 2GEPA 3JTOA 3AY0A 3NWGA 1Z2LA 3KK3B 1RT6A 1T11A 4G39A 2W1BA 3THPA 1UTAA 3CCZA 2LQBA 2A2DA 4DPXA 2XGQA 1UVLA 1YBUA 1WG1A 1YBTA 4MJKA 2DITA 3OR2A 5KFIA 2EW9A 4O4RA 1XQIA 1R0AB 4ECZA 4F4KA 1ITPA 3OL7A 2IC3A 4KV8A 1H6KX 4XO0A 2FY8A 2YWEA 4LF5J 3K2YA 1JKHB 4DHVA 3DC2A 1RA6A 2XCAA 3CE8A 4OV1A 1Z1ZA 3NY0A 4CRJA 2NSCA 3DOMA 2VBWA 4GKJF 3A1YG 3FBEA 5LOQA 2DJWA 2MQLA 3MEGA 4Y2KA 5DLGA 3G96A 2OH2A 5KFTA 3ITHA 3BGRA 3CMQA 5AXLA 3LH2S 2CA9A 3MMCB 2MXYA 1UVJA 1RCXB 2P9CA 2YQ3A 2YKPA 2Y0SD 4RPFA 2V2ZA 3KLHB 4F0KA 1HI0P 1DLOB 1H2VZ 1T03B 5IT9U 1FKPB 2IA0A 4TVAB 3RRHA 4NCBA 4CNZA 4LF4J 1HW9A 1K1QA 3EE3A 2B4PA 4XAKA 4LF6F 2LYVA 4DMZA 1B4SA 5AJ3J 1NZ8A 1FTCA 3AAWB 1VQOS 4MIBA 1ZA2B 4ZVRB 2MQPA 1ZTTA 4MKYA 3QFWA 4I56A 1B99A 2BJ3A 1APSA 2YPYA 2E5GA 2EEYA 2Z56B 4Z7YA 3ISZA 1N33F 3DGPA 5DG9A 1RTHA 2KFZA 1KS2A 1CJTB 1AA1B 1LW0A 1SVDA 2Y8WA 5KT3A 3QT8A 3T5LA 3WHIA 1SV5A 1QSSA 1XMBA 2L9DA 1R8AA 3DRRA 5ETLA 4PG5A 5T41A 2BM0A 4O3SA 1HFEL 3VGSA 2ZOMA 3W66A 3ZTSA 2J9CA 2F9DA 1TFYA 5IQ6A 5KFRA 1J27A 1NSAA 1SH0A 2QV6A 3I6PA 2VKZG 4OYXA 3VQTA 9ATCB 1VQYA 3B0LA 2RRBA 2HRYA 4ZP9A 1JWWA 4ZP7A 4DR2J 3T3FA 1X9WA 2R7WA 4K4VA 4GEPA 3C19A 5HQ8A 2GVZB 4OHVA 2I6WA 4MTPA 4CTAA 3LQVA 4Q45A 3CCJS 4DUZF 1NDCA 4U7UD 2K06A 3M32B 1RZMA 1RGVA 4NZ7A 3P3DA 3VV2B 2P6TA 1O0PA 2H48B 1F0XA 3OT9A 1QTNB 3CVKA 3WC2A 4G38A 3IC1A 5J2NA 4J9NA 3R5AA 1VJQA 2Q6BA 3C15B 2UUTA 4OMFG 2XCPA 3VAGA 1YRXA 3RJMB 2NUUG 3Q2SC 4BHQA 3PG9A 1RKIA 5IWAF 1TKTA 4ID5A 3H25A 1Y3KA 1UCNA 1V5VA 2UXCF 1VISA 3H5UA 3HHDA 4USMA 2XO7A 2AOPA 4DR4F 3CJ2A 3KFWX 5B09A 2HLUA 1U8SA 3CJKB 4FF2A 3Q2TC 3C14A 4P7VA 5K14A 2HK3A 4OLOA 4ES1A 3RAXA 1UWBA 2XHWA 1UZHA 4FVMA 2W2PP 4KFBB 4U6PA 3C6TB 1NH8A 3GZ7A 4IRKA 4LVOP 4LREA 4YHHJ 2VC1A 4GVLA 4DL5A 1Q7LB 4M5IA 1VC5A 3GE9A 3PFOA 3VWSA 1I94F 1HNZJ 4K4SA 5DJBA 2MZSA 5EGYA 5C5JA 4WFNQ 3MAAB 2DNPA 1FO1A 3PEJA 1U25A 5KT6A 2BJ8A 4OYBA 3CCLS 1J5EJ 3U7JA 3OVAA 1Y4ZB 4DPUA 3L7OA 4G6VB 2BRLA 4ILRA 1EIYB 3JSMB 2CPHA 3EICA 1WKKA 3M8QA 1X4DA 2B6AB 1X5TA 3QRPA 2GQQA 4M5KA 3UVJB 2JSXA 3K57A 4B9SA 1TL4A 1C4CA 2H1YA 1FFGB 2M88A 3Q83A 2XI2A 2HQCA 4C3LA 5A8WA 2XC9A 2YNGB 4ED4A 1EAYC 2JVRA 1RT2A 2CJYB 2FJBB 3BKUA 5B0DA 3H98A 1KP6A 3H90A 4USHA 3BQ2A 1GX6A 3Q8SB 3P5BP 1CG2A 2VOPA 1OO0B 3EMTA 4USVA 4B9MA 3M2UB 3CCTA 5KFXA 1UA0A 2HHVA 1RTZA 2MLYA 1UVKA 5KG0A 3TAQA 3MM6A 3AOCA 1IUJA 2C2ZB 2LVWA 3DGPB 3IO1A 3KDNA 3LALA 1CULA 3NKYA 5DDOC 4C8ZA 2HHQA 3S7RA 4C8LA 1RK8A 1ICEB 5DQHA 2LMIA 2ASLA 1LKZA 3DMJA 3RRKA 2FC9A 3VZIA 5HN0A 4DFPA 2BKNA 2HHUA 3S6EA 2GJIA 2NS1B 2BANA 2ZHOA 3W64A 4UT4A 5KFQA 1NB7A 3NRBA 3HLUA 1KQFB 1F1BB 3TRGA 4HKQA 1X4AA 2CQ4A 4Y6IA 5K8NA 3ZZOA 1M5PC 1VQKS 2VG5B 4OYWA 2L9NA 6FDRA 3DHWC 3HT0A 1DTQA 1OWXA 1RT3A 3SSSA 1N32F 1OPZA 2JHEA 4J9UE 2MHNA 5JVHQ 1HMVA 4MK7A 1QAYA 1BMQB 2B56A 1HQEB 2PFDA 3L7PA 4RW6B 5AT1B 5B0FA 2DIVA 4A46A 1MMDA 2F40A 2ASJA 2H4YB 2E1CA 3ILOA 1C1BA 2QYCA 2DHXA 1U0SA 5K8PA 2FVSA 1C1CB 2LQ5A 2HNDA 4RW8A 1IWAA 4A8QA 3D6MB 3UCZP 3IG1B 2CUYA 2XO6A 1T03A 1R0AA 4BS2A 2I5JA 2LA6A 3RBZA 2OFHX 3PW2A 4DV0F 5F8JA 2YX1A 4P10A 4WYLA 1S1UB 2NXUA 2X51A 2H4WB 4DL2A 1KONA 3KK3A 1WEYA 2NYHA 5H9FK 1F5BA 2J5AA 5GAGU 5L1LA 4QIEA 3EGWB 1HWIA 2CQ2A 4ZVUB 3VAHA 4DF8A 3HHLC 5IV4A 3H20A 1Q8BA 2KFNA 5I4MA 1FDDA 2A2CA 5CD4H 1M5KC 4QQBA 1VQ6S 3AD7C 5EHHA 3MURP 4RUCA 2RUGA 1S6UA 1R6YA 2IMWP 3DLEA 4G1IA 1P9YA 2C3YA 1NK7A 1RWXB 1T95A 1X60A 2KRBA 1B64A 2X3GA 1I51B 4IUFA 2V2QA 3MEDB 3N01A 2XMJA 4J91A 1UVNA 1S6PB 1IKVA 3PHEA 1S1VB 4F04B 3H2UB 5HQMA 4YY3J 1S0MA 3VAFA 1PBAA 2ZKTA 3I32A 4TY8B 1I6JA 2HVIA 2QTWA 4WKRA 1GAOA 5D0EA 1L5UA 3A3NB 4OIXA 3ZZTA 2JH3A 3IS9B 2VPWB 3O1LA 3LP1B 4QBUA 4DCJB 2BABA 2CQPA 2CFXA 2GHWA 4PPDA 3VZHA 4AT1B 2OPPB 2WSCC 4DQPA 1Z2ZA 4NEZA 1P27B 2HWTA 4L73A 2BDPA 1U0HB 1L3UA 1CC8A 2VC0A 1Y9OA 2ZBQA 3CJ5A 4JI0F 4ZHRA 3MTKA 1VBZA 2ZHAA 4NLYA 3PW0A 4F0HA 3KKFA 4RZRA 2VPYB 2H5JB 2GMHA 2YBVA 4DSJA 4DX7A 3D54A 1GMUA 2EK6A 3OL6A 2ASDA 2DNMA 4CZCA 1R0CB 4X62F 3E01A 2GHPA 3HULA 3OTBA 4ZPTR 4B3MJ 1CJKA 1Q4RA 2HFNA 1KOOA 4UY8T 8RUCA 3UDLA 1SL1A 2HK2A 3A3PB 3MEGB 2G13A 4AUKA 3K5PA 5I42B 3MF5A 1JLAB 2N4CA 3MM6B 1WKJA 2CPDA 2OMLA 1U49A 3BSAA 5D78A 3KMSA 3FRYA 1AZSB 3MM8A 1GX5A 2HFSA 5A8KB 5CHCB 1NAQA 3V6KA 1V3RA 4NLWA 4EYHB 3EPIA 2HHHJ 3PRBA 3OR2B 4AXJA 2QZ8A 2Z58B 3GU0A 3I87A 4LBIA 4UW2A 3OD2A 3ZTQA 5KOWA 3N5BA 2XLIA 2KG1A 2RDIA 2M8DB 2FGCA 2FVCA 1ZAXA 3NWRA 3QJJA 4OZ0A 3NP5A 1WD6A 4NLDA 5KFKA 5EWEA 4K50A 3QLHA 2QYGA 1UFLA 4NYZA 3I5AA 4DG1B 2R7XA 4C2MA 3N0VA 4J9VA 1FNXH 4QWBA 1N0VC 1WG4A 4WP9A 1FA0A 1REVB 3MM7A 3U1MA 3CMES 3M2VB 4DX5A 1VYAA 4WFBQ 4CCHA 3MM8B 1F5CA 2JFKA 4ZVTB 1FVQA 2CJKA 1HQUA 1CSJA 2VJVA 1WACA 2GV1A 1VS3A 2WW8A 4YDXA 3UCUP 3A8IA 4EUVA 2R7SA 2FHJA 1N32J 1E6YB 3BGLA 2HGMA 1FDNA 4DCOB 2G1HA 4X84A 1JLBA 2KXNB 1ZH5A 3OTCA 5LMNF 3C6TA 2BX6A 5KG7A 3UDEA 2HBRB 2OELA 1G6BA 1PIEA 4CH1A 3OSNA 4GKJJ 4Q0BA 2KYZA 2HGNA 3MI7X 5DG8A 4N7TA 2G2OA 4IR1A 4DPYA 2HQ3A 3DCAA 3R7BB 1U1LA 2GNKA 4OJHA 4OX8A 5K9FA 4AL5A 1F9FA 3CJ4A 5CCMA 5AXMA 1LFPA 3IN5A 1TKTB 4ID5B 3TJAA 2H65B 4O3NA 2M3DA 4C3KA 4YN3B 2HZVA 3RUBL 2HNYA 1HNZF 3IP0A 3H2VE 4F36A 3QT7A 4IDKB 4AL6A 4HTRA 3MR6A 5ETSA 3RG6A 1XMOJ 2JEJA 1QTMA 2HRTA 2M7SA 1NK9A 3TANA 2UUAF 1B7FA 5DQGA 2L9WA 3PO4A 1LOUA 3HHLA 1IBLJ 1JNZB 1NJXA 4O3PA 1MU2B 4DXLA 5FJ4A 1D1UA 4J9LA 4ZK7M 4F50A 3T6JA 4LFCF 1FXDA 1M1KT 2GCFA 3DDKA 3Q8QB 3HX9A 4WU2A 3UQSA 3OTOJ 1IKXB 4HHUA 2D9OA 3AA9A 4LT6A 3SDEB 2AGQA 1LK7A 1D3WA 1WELA 2QIFA 4QYZJ 1K0TA 2KXFA 1VOMA 4LF1A 1HHQA 3QO9A 1VQMS 2RU3A 4DR1F 3B0GA 2YWFA 2DVIA 2M4MA 4B3OB 2OPSB 3UCGA 3G4SS 1AW0A 3VAKA 1O8BA 1OMSA 4ANEA 1U6BA 3U27A 4FS2A 3I96A 3JSMA 1X5SA 2LDYA 1XERA 3AT1B 3JQKA 3MM9B 3JSRA 3BB5A 1FESA 4TXSA 2I5JB 2G4BA 1U1RA 2OIHA 2CIMA 3MAAA 4NPOA 2FVQA 1NK4A 4UF4A 4V19X 3TAMB 1Y3JA 1RJJA 5CYMB 4EMDA 2BE9B 4NCGB 4LVNP 1N54B 4C97A 2RDJA 2DY9A 1QVFR 4RR5A 3HVRA 4LFBJ 4L6V3 1H38A 2JFDA 3OQ2A 3IWLA 3OJUA 4S38A 3DLKB 1S12A 4ZN3A 4EBCA 2OTLS 3NOYA 2GHVC 4KGKA 3FRZA 1RQ0A 1OY8A 4JUZA 1NDKA 3QATA 3VVTA 4ZLLA 2WTFA 1PJ6A 2ZZMA 2C2EA 5J2PB 2VBYA 3D68A 3T9ZA 1RCOB 1HI8A 3KHRA 3VAMA 3RB0A 4Y0FA 4LF6J 2B0GA 2AJQA 3HSDA 3C6UA 2YKMB 3VKSA 3LUYA 2NR0A 1PJ7A 2ACYA 2BE2B 4YR0A 2GIFA 2WVBA 4LR9A 5E41A 2DNRA 1TKZA 2ZH6A 1U48A 2F4FA 3F56A 3GJTB 4F3MA 3MM5A 2E9TA 3H5SA 2VIHA 3AD8C 2OD6A 4G9PA 1S6OA 2WSFC 3M4XA 3PW7A 1Y7PA 4CT8A 2GVZA 4LFBF 1S1WA 5F8NA 1VJWA 2CPEA 5IS2A 4B3TF 3BPSP 3CCSS 3B0HA 2JDJA 2PGCA 1FDBA 5IV3A 1NKEA 3H40A 1UWBB 1SJ3P 3HVTA 4YEAA 4QIWD 2XNQA 4ZVEA 5HROA 4NE9C 4P75A 4QIVA 2DH8A 3DLJA 3SSQA 5L39A 1U6ZA 4F4ZA 3EUNA 4LR7A 5HANA 1NJZA 3M8YA 4MKBA 3P49B 1L3VA 3MR5A 2Q3PA 4R5PA 4Y2CA 4R25A 5KG5A 2Z8QA 5KFHA 4ITSA 4JI5J 1WSVA 2HS0A 3F0NA 2YWKA 4YMEA 1SXLA 4YP3A 5GADU 1H73A 1NHUA 1FJGJ 3ISNC 1WHWA 2J9DE 4KGMA 5C25B 3M9MB 3KK1B 2AJFE 4X66J 2J8SA 5FLXU 2K7KA 2KFYA 2OPRA 2ADCA 1ZPVA 2CNNB 3N9UC 2HHXA 2IRYA 2VB6A 3OFHA 3QJPA 1AYEA 2OSRA 4YDDB 4CO3A 4PUOB 2I0XA 1R7IA 2ZD1B 5CYJA 5IQQA 5F0UA 4USUA 1CJUA 2BQRA 1Y5NB 1LWCB 1R6VA 1LV5A 1TL7A 1I5OB 2MLXA 2CJQA 2YNFB 2ZVIA 3BDPA 3GJRB 1TKXB 1URNA 2ZM6F 3EDRB 4A8YA 5MAOA 4DV7J 1PCAA 4DSIA 4DUYF 2NZ4A 3MUTP 3OPKA 3R5BA 1DJ0A 2BUNA 1IBMF 4X4VA 3MCNA 3C2PA 2YQ0A 3B8HA 1KD1T 3MHYA 1RT5B 3ZZ0A 3CDAA 3MTJA 2CJBA 2OPSA 3IM8A 3UPFA 1NPRA 4RNFA 3DLGB 4Y2IA 3CCES 1DURA 5F8IA 2DPIA 4MKAA 2AP6A 4B02A 1UW9A 3O5TB 1X9SA 1T94A 3EXYA 4WBFA 5GADI 4NZ6A 3OJSA 4DFJA 1P9QC 2ROPA 1N5YA 3FFIA 1JJCB 1QE1B 2EFQA 2WB4A 5F41A 3T5HA 1KFDA 2DRAA 5E3AA 2CPJA 2HBQB 3AB4B 1FJCA 1X4FA 5GAEU 2AYEA 4USKA 2KM8B 4N47A 1SH2A 3PEHA 3GPAA 2OSQA 3C16A 1JLFB 4N56A 2FVRA 4L74A 4WXOA 4OHZA 4LF2A 1U2FA 2RD5C 4HHJA 4UQGA 5U47A 1QVGR 3M2VA 4KY3A 2O5DA 4USWA 1JKHA 1YJRA 4P7TA 3HD2A 3HSJA 4NI2B 4AL7A 2ZWPA 4KHPF 3EXCX 1GTHA 1A7GE 1ZM4A 2HIQA 2LCWA 3DXBA 5ETVA 2K7JA 1XIQA 3G82B 1V6HA 4BCAA 3G9CA 3I56S 1Q82T 1NXIA 1MWQA 5KFBA 1UFWA 3OFGA 3US5A 5C42B 1YI2S 1S5ZA 3RBXA 1K8AT 2HFVA 2EFNA 2JJ4D 3D6HB 2FZCB 3LPEA 2P8IA 1SC1B 5IM0B 2XB2D 2DRDA 1ZETA 2H9ZA 1JLBB 3JAMU 5KFNA 1MWYA 3FQLA 3PX6A 4KR0B 2GJ2A 1W2IA 3SIPB 4AD6A 4ECVA 1RT7B 4ES2A 2XYGB 1WF0A 3GCWP 3VAJA 4B3MF 2QSFA 1DTTB 4I7FA 1SH3A 3SQGA 3M2RA 1CBKA 3PJWA 2Y1JA 1HQUB 2W4PA 3QRRA 2BJDA 4NA3A 3I0SB 1T9WA 5A0YA 4A8WA 3B0NA 5JMNA 1PILA 1TL5A 1BUXA 2HVEA 2DY1A 2V8DA 2FLNA 2FJWA 3TUPA 4DCPB 4DSKA 1IKWB 1TTHB 2AIRB 1TVRA 9RUBA 3CDBA 2RHQB 3OHBA 4ANDA 3PW5A 5I3PA 1EARA 3QLHB 1XMQJ 4IDKA 3ILLA 1M1GA 4PG4A 1H2TZ 3FZBA 3TJ9A 1U8WA 2HFUA 3ULHA 1KHVA 5AOPA 2V5HG 1SKWA 2Y3YA 2XI3A 3HM9A 2GQCA 2V50A 2DO4A 3JXOA 3GIKA 1WC4A 1S4EA 2J9DA 2ZHBA 3HHEA 4WZMA 3A13A 4M5DA 2IM2A 2UU9J 1HYSA 1I1GA 1RT4A 3WIUA 1HD1A 1IKWA 4WYWA 3RW6A 1JLAA 5B7WA 1KR4A 2RKIB 3OLBA 2NREA 5KFCA 1HR0F 1FT8A 3BH7B 4ZN1A 3BQ0A 2OTJS 1GH8A 1PC5A 1J5OB 1FVSA 1LWXA 2F63A 5F8HA 4S39A 5D15A 1ROFA 3SCKE 1VBKA 3MZIA 4CLYA 1HNVA 1B7YB 2EWHA 4O44A 4FZVA 5LL6d 1WTFA 1LWEB 3TX0A 4RLEA 4TU7A 3J80Y 3NGKA 3L3CA 2E9RX 5LSLA 3G71S 5IM0A 2E5LF 2GVDA 4XDCA 1VC0A 2CJ9A 1RHRB 5ETOA 2BJEA 3M9OB 2VHGA 3POTB 3ZZZA 2NPFA 4CQ1A 3CB4A 3FKBA 4DUYJ 2C28A 1SUQA 2R7QA 4ZVGA 4DFMA 4ZVHA 2LP4A 3MM5B 1RTDA 2OPQB 1KTQA 3IA0A 2RB7A 4NMXA 2QL7B 1OPIA 3PFEA 4WIQA 4I2PB 2AWZA 4WFZA 4J9KA 3CDEA 4P73A 3LANA 2QX0A 1XMOF 1AZSA 1YBAA 1VQNS 7AT1B 2C2MB 1K47A 1BQMA 1GMWA 1WKLA 3LGHA 4DV6F 3LO3A 1E6YA 4DR4J 3QGPA 4K0KJ 2CJAA 3G8TA 1N34F 3ICLA 4IG3A 3KDOA 4J90A 4JV5F 5HROB 2V8HA 1D9DA 3CTRA 4HI2A 3W7BA 1P1TA 2P5VA 3ENVA 4NLVA 4DL7A 3R8YA 3HHLD 2VL1A 3BS9A 4R8UB 2QFJA 2L08A 4IFYB 2POKA 3PY8A 1Q7YT 2QMWA 3I9V9 4YHHF 1C2PA 1M90T 2QA1A 1HHSA 3AODA 2MLZA 3V2UC 3VAIA 2RHSB 2JL9A 1SJ1A 2ZC3A 3DI6A 1TL1B 1WHYA 2ILZA 3CGIA 1HBOB 1RYRA 5KT5A 4NXNJ 4M8LA 3I5CA 1VBYA 3GR1A 2KI2A 2Y8YA 2ZNYA 3EVMA 2GIQA 1QAXA 3U1NA 1MROB 1OS5A 3MDFA 1MG7A 3DDNA 4OV6A 1RWKB 4RW4A 3VGVA 2PMZD 2Z0GA 1RAOA 2VA2A 3NL0A 1VQ8S 1X5PA 1HBMB 2MKSA 2MPUA 2VD3A 2HNZA 3BYPA 4CO0A 5M2UA 2XS2A 2E1AA 3DOLA 3CSKA 4WWSA 5D4PA 8AT1B 2PFFB 2KO1A 4HR2A 4X4NA 4AQYJ 3J81j 2XMUA 3UDCA 4B17A 4C8KA 5L8RC 1HMVB 1PBUA 2PMHA 2CQBA 1WOOA 3PYEA 5M2RA 3FSIA 4F2RA 1WUUA 3SYZA 1NNDA 2G0IA 1LXJA 1NZAA 3AHPA 2VG5A 1R8CA 2V4JB 3QGHA 2X1AA 3CCUS 3W65A 3NNHA 5C2GA 1IR2A 3DYAB 3M8QB 4RUAA 1DBDA 4NXNF 5F3TA 2ZDPA 1JLEA 2MKIA 4FVCA 3LP0B 1F2GA 3CCRS 5GAHU 1S1TB 4DFKA 3CDUA 2R8GA 4ZJQA 1NH7A 2NPIA 1GMVA 1EP4A 3W63A 2OPRB 2UXDJ 1O6XA 2BV3A 1P8GA 2CQGA 3ISND 3M30A 3GV5B 2ERRA 5L46A 4DLEA 2M8HA 1DY3A 3LP1A 4NYPA 3K0JA 4JI1J 2DCUB 4X64F 2BBEA 3HCXA 4S3BA 4W92B 1FK9B 3W9HA 4WJBA 3PNIA 3MXHP 1C1CA 2OUGA 2APOA 3R3TA 1F60B 1EKRA 5BXIA 3GQCA 4LFAJ 4CLKA 3FQKA 2I9SA 3EWGA 2YTCA 1D09B 3JSBA 3EGZA 4DV2J 2KB2A 4LQ9A 4PYDA 2XMTA 3DDIA 4PQAA 4BWMA 1U26A 5CD4A 4YB6A 1IR0A 5K5MA 3DRYA 3CULA 4E98A 4ZS6A 1YITS 1MU2A 3R2DJ 2F9JA 5GAEI 3I31A 2C2NA 1VMBA 2AKWB 6FD1A 4KKOB 2OO4A 4IOAQ 1N5VA 2OKQA 4FYVB 3CF5Q 1VK3A 1UETA 2ATCB 5HK4A 2D41A 3V4IA 4DN9A 4S3CA 2V8VA 2ZOGA 4A4JA 3WC0A 4KT0C 4BWJA 2CQ0A 3IXQA 4JYAJ 4C8MA 1QUPA 2ZOFA 4IFVA 2DH9A 1NJWA 1FJGF 3THTA 4X4SA 3JTPA 1B3TA 1QUVA 5HVHA 4HI1A 4TLQA 1VQSA 3DU5A 2XMVA 2RAQA 4QR1A 2JEGA 4KTQA 1BC6A 1UW4A 4H4OA 3R7SB 1S9GB 1X9MA 4RO0A 4PG6A 1KLMB 4QOTA 4D3HA 2VPZB 4RBVA 2F65A 4R8UA 5GEPA 2GX8A 2K3IA 3W2WA 1HR0J 3PR4A 4OYPA 4FKYA 1UPMB 3MMAB 4I6AA 4BBYA 1CJTA 1FRXA 1RWNB 1KHWA 5KFSA 2PA3A 3T5JA 3D7SB 2YWGA 7FD1A 4NCGA 4Y28C 2VF3A 4NA1A 4IRCA 1CPZA 5HQLA 1T9VA 3D1HA 2V67A 3CW2C 3ILJA 4CP5A 2JEFA 1ULRA 3DHXA 4C8OA 2Z4PA 4ZVQB 5AE1A 2FHOB 1NHKL 1VGYA 1S1TA 1YWXA 4M5HA 1RU1A 1RXOB 3DI6B 4PG7A 2B7CB 2E9ZA 2F8MA 2OP5A 2LLZA 4AFFA 2W7OA 4XIUA 1VRUB 3WQPA 2WZ1A 2ZE2B 3Q22A 2W2MP 3GYGA 2IYIA 3D2WA 4ZVPB 2B9XA 4NWBA 1QAIA 3R1HA 4LF9F 5KFZA 2Z57B 1KLNA 4OI3A 2Y0BB 3D28A 4CLWA 4HYKA 1WHVA 2C3PA 3Q89A 3MGJA 2HAFA 3IRXA 1EX8A 4PXBA 4ANCA 4HT5A 4Z37A 3G6ES 2HMIB 2UUAJ 5FDLB 4C11A 3Q8PB 1OYDA 1IN0A 1RYSA 4PPZA 2ZVSA 2K1RB 3MAHA 3TX8A 1YJNS 2W01A 1TL3A 3MCSA 2V4RA 1C0TB 1XJWB 5H1SV 2EC0A 5I42A 3QYYA 3PX0A 3VKPA 3CNQP 4P72A 3WBZA 1RHUB 3HZGA 3TZYA 2BW2A 4TN2A 5ETQA 4ZCMA 4IG0B 2HVDA 4NLPA 4CLFA 3V81B 1NK0A 1FFSB 1RISA 1UEKA 2IJRA 3M30B 1XTZA 3VALA 2Q43A 3V4IB 4LF9J 2EG1A 2ZC4A 3M1VB 3MECA 3F44A 3QWPA 4P74A 4YUDA 3NBPB 2OJ3A 4FBTA 1HWLA 3D1OA 1KVJA 1VQLS 4CH7A 1G2EA 2UXDF 5F9NA 3I0RB 4U96A 1RLDA 2YPZA 4KC5A 5KG1A 1KEKA 2I2YA 1D0EA 3HXMA 4NLTA 2UVUA 3K5LA 4TQSA 3PJ9A 2ALZA 1RAEB 3CEDA 1B0VA 3TZXA 2QL9B 2WVEA 3D67A 4F8RA 3NGSA 3W1YC 1MSWD 2DNGA 3K8WA 2VG7B 4HLBA 2YKNA 5HAOA 3K5NA 5JUMA 2CQ1A 1TV6A 4K4TA 2AYBA 2DHSA 1RP5A 1TAQA 1Q81T
chains in the Genus database with same CATH topology
2EBEA 2V8GA 5L1JA 4IR9A 2DB1A 1UEVA 2D3ZA 3GFZA 3I5BA 3F73A 1MMNA 3MD3A 4O4GA 2GC8A 2YKOA 4RNNA 2BM1A 4J9MA 3ZZRA 3M8RA 4AXIA 1GT8A 3RB6A 3PKMA 3CCQS 4CO2A 2AYMA 3M05A 4C7QA 1HBUA 3TR5A 3CCVS 3PW4A 5KFAA 3D0IE 2BXJA 2DHGA 5DQIA 2C2DA 4MMOA 4KJIA 4ZPDA 4Y2MA 4EWTA 2V94A 1X4EA 1NKCA 1HWJA 1JXEA 2BYCA 5E3QA 2E1MC 5KTQA 2IJFA 1B0PA 2B4UA 2WOMB 4TU8A 1N5TA 4M5DB 3OLAA 2UUCF 1JB0C 1BD6A 3IWNC 2PEHA 1KTVA 2OTJS 2ZKUA 3KK2B 2F3JA 2HG4A 2K2PA 5BYSA 4JV2A 3DU6A 3C66A 2MSSA 3H5YA 4ECUA 3R1LA 4MFBB 3DOKA 4TU9A 2G0CA 4U9RA 3BR8A 3ENWA 3S1TA 1LK5A 2IJNA 1UVIA 1RTIB 2ZH2A 1KQSR 4JI5F 2E7XA 2FJEB 3O2IA 2MGZA 1WI8A 1FKAF 3AOPA 2CPXA 3N79A 1QY7A 4JI6F 4ED7A 1L3TA 1JLQA 4GC7A 2WONB 4LF8F 3KNAA 1FTRA 2Y1RI 4TYBA 2GMJA 1UL3A 1N5QA 1FKOB 3KLGB 1T3OA 3J7YU 1Q8IA 4YR3A 1ZZNA 3J7A1 1RT7A 4YY3F 2VQEF 3GG0A 1BGXT 1FEEA 3QMQA 1FRHA 2YX4A 2PN6A 2LA4A 1BY9A 4OI2A 3CJKA 4MIAA 3M8PA 4CT9A 3PXGa 3CD6S 2KXHA 2CQ3A 2IVMA 4CO4A 2W9BB 2LQ9A 4H4OB 3EPGA 5A8WB 2EKYA 1VQ5S 1KNZA 3DLEB 5KT2A 2HFZA 2B6AA 4K5RA 3HPOA 4IH5A 2AGPA 1RA7A 2CRLA 1TK5A 1CC7A 4RUHA 4H54A 3CO9A 2AJ1A 3MEEB 3CMAS 3IGNA 4OX6A 2QSWA 4IKAA 4IO1A 2W8KA 2YKNB 1K73T 3TUIC 5A8RB 5HP1A 3QJLA 5HL7Q 3VR1A 4A48A 1BQXA 3M6XA 1VQ4S 4RNOA 3TYTA 3NNCA 4ZPCA 1VIOA 3CUNA 4WE1A 3H5XA 4NLSA 1HYSB 2R9LA 2OD4A 1QE1A 3PDNA 5B0GA 5FIIA 1ZM2A 2YNIA 4HDHA 3E8OA 1FE4A 5HI7A 3MMBA 2GGPA 2W9CB 1V3ZA 2HMIA 5HP1B 3AJ1A 5E33A 1X4HA 4K4UA 4DR6F 3O6QA 2O67A 2BR0A 4RNMA 3D0HE 1VRUA 3EZ5A 3GMGA 1W25A 1JK9B 1N88A 2VASA 4ZMMA 3UNGC 1YTYA 2IA6A 1HI1A 1T3NA 1UP1A 3KHLA 2R8IA 4RU2A 2YKMA 2CVEA 1Z4UA 1SL2A 3MMJA 4B9TA 2DGUA 2HW3A 2YNFA 3L95X 2BA9A 3SQGB 3GIJA 4U7CA 5HO4A 1V9OA 2K1RA 1UKUA 3U02A 1QLNA 3V6DB 4RBTA 3SMZA 3IR5B 4DL6A 3VLZA 3J7YI 1KLMA 2X1FA 5JJBA 3CDWA 1G1XA 4DV7F 1X8DA 2MSTA 2DH7A 2IM0A 5L1IA 1A9NB 3DRPB 3O44A 4HT7A 4QWDA 4GC6A 5J1EA 3LOUA 3CC2S 5J1EB 3KNGA 1YHQS 3CIMA 3HFKA 4QJVA 1VBXA 4LJMA 2LQJA 3N4WA 4EO6A 1M5SA 3QIDA 5EWFA 1RDRA 3NG8A 1G3OA 3HF5A 4NZ0A 3ZFVA 2HYIB 4UOCA 3RAMA 4ID8A 3HHKA 4WZQA 1SIWB 2V2KA 2KH9A 3W2WB 2UU9F 3BN7A 4PWUA 1U47A 1LWEA 2YWHA 2XZWA 3SCLE 4KFBA 5CZVA 2ZH7A 3SCIE 2MB0B 3ITHB 2B51A 2GA7A 3WDOA 1WHXA 3DN9A 4OZ1A 3VF0B 4DS5A 3NMAA 2CQIA 4QIFA 2KT5A 2RE1A 3DLGA 3PX4A 1N52B 1S99A 3AB2B 4NYOA 1SQEA 3GR0A 2NLWA 3RU0A 1R8BA 4O3QA 2H5EA 2DNKA 2R2RA 1CLFA 5LXRA 2HZCA 3TARA 3I4PA 1U1PA 3B78A 2M70A 1UEUA 2HPUA 4ECQA 3BN4A 4RX6A 3KLFB 2LEAA 3KHGA 4NLRA 5E5NA 5KG2A 2LECA 2LEBA 1BLUA 1FRMA 4CO5A 5KFFA 2NUHA 1Q16B 3IR6B 5BYRA 4O0IA 5HMXA 3BGRB 5D4NA 4WK1A 1IJEB 2QE5A 3GV7B 4HVZA 5AE3A 4O3OA 2Y1IA 1XWLA 3DFEA 5DETA 2DGSA 3F41A 4Q2MA 1TR0A 3KLIB 2J7WA 2B9YA 2RU9A 3H8YA 4RW7B 4B08A 4JYAF 2P9GA 4IQXA 4F2SA 1K1SA 5A6PA 4HL9A 1HBOA 2N82B 2B5JB 5T7LA 5KOXA 2W9BA 3JYTA 1VC6A 4QU6A 2CQDA 2DTJA 2NQPA 1U1OA 1NRKA 3MR2A 2MHEA 4Q0BB 3DOKB 1R31A 1TVRB 1ZZFA 4KBIA 1DLOA 3HVWA 5HMWA 3OUYB 4V19J 1S7HA 3X1LB 1HNXF 2VH7A 2OFGX 2LU1A 4A8SA 3P96A 2WSEC 2RS2A 4J37A 1VQ9S 4IG3B 1HBMA 4NXMF 2EPIA 4I64A 2FHMA 1FCAA 1O51A 1SC6A 2FLOA 1CQMA 3GEOA 4X4TA 2MGZB 2KTQA 5D3GB 1D9AA 4ECWA 1FRKA 1JLQB 4M1KA 3QGIA 4MH8A 4B3OA 2AKJA 2I8EA 3JTNA 1RT6B 2RQCA 4DLGA 4X66F 2R8HA 2N3OA 3AH6A 2XEXA 3OVSA 1NEEA 3M8PB 3T1YF 3BF4A 4DL0C 4ES3A 1J5EF 3HJFA 2A10A 1NU4A 5ADZA 3G6YA 3N5FA 5DGBA 1OQ3A 3KYLA 3BO2A 2P6SA 3TA0A 1WI6A 1HNVB 3KMQA 5CYMA 3OVBA 1H3DA 5CXTA 1Y00A 2E44A 5B0EA 2ZFHA 1FKOA 3KLGA 4J9OA 2DNHA 3I55S 4QPTA 1JXLA 1HNWF 4ETZA 2SXLA 4USIA 2RKIA 4DV2F 1GNKA 4F4YA 3CJ0A 1T05A 4XK8C 2MZTA 4DEZA 2HGLA 1O5JA 3GIIA 2DHAA 2WAQD 1N5SA 3DRSA 2KHDA 3FZ2A 4ILLA 1U09A 4URSA 1D8YA 2QLWA 1IKYB 2QA4S 1KOHA 3ENQA 3LAKA 3NBPA 4OFZA 4OI1A 3SFUA 2RQKA 2LKZA 2JZ5A 2YNIB 4ZCKA 1JLGA 1C0UA 3LW5C 5A8KA 1ZPWX 2EK1A 4O4GB 4H4MB 4ED1A 4S3EA 2PI5A 1U4BA 2ILYA 2UXBF 4K4XA 4ETXA 4ECRA 2D3OR 1J5OA 1FF2A 1KQKA 3J7ZT 3LF0A 3CCWA 4DV5F 2JRSA 2HNDB 4LIWA 1NO8A 3IGVA 4NRUA 4RW8B 1XR6A 4EU0A 1YIJS 5K8OA 5D4LA 2CPYA 3Q0AA 4U7UK 2V9KA 1S6QA 3RRGA 3W2VA 3VQSA 2P9EA 2ZH4A 5G4DA 2QRRA 1SJQA 2O1PA 4RW7A 4ZA1A 5HLFA 4ZP8A 2FHJD 2COLA 4ELUA 1S0VA 2BANB 1F5AA 3G6VA 4K4WA 4UY85 2BACA 4UQTA 1CVJA 1N6QA 1S49A 3IG1A 2JVOA 5KFJA 3MAQA 1S79A 5A0YB 2R7RA 3V6JA 5J2PA 2D9PA 1TL3B 4WU3A 3E2EA 5CYQB 3PRDA 1SB6A 1N8RT 1IKVB 3VTIA 4LFAF 3MFHA 4ILMA 4FXVA 5FD1A 3EX7B 2XMMA 3VLXA 4URGA 2MKKA 4ERDA 3M2UA 2F8HA 3KJVA 2DR9A 2RS8A 4OZNA 5SUHA 1DTQB 1RT3B 1C0UB 2LXUA 4HTIA 5EN1A 1REVA 3MM7B 1N36F 2DR8A 3OTEA 2ASYA 3AJ2A 1S1WB 2YNGA 1ZAWA 3M1VA 3C46A 3FFIB 2HNZB 2IBKA 1RTIA 3HT3A 4HH1A 2RH3A 4WFAQ 5THWA 3GFHA 3MPVA 2J7KA 5KG3A 2FVPA 2E29A 3FGVA 3NCQA 4QW8A 4CH0S 3PM9A 2XGPA 4DSFA 4QPXA 2VBZA 2CG4A 2D1CA 2AF6A 2JOQA 4Y2AA 4PG8A 4C8ZA 2XMKA 2XSJB 2IVYA 4I2QB 5D4OA 2A3JA 5HBMA 4KHRA 4RU9A 1RTJA 3LP2B 4NLQA 1FJ7A 4KE5A 2W4DA 4KKOA 1RT1A 3CC4S 3OTOF 4DR7F 4ZLPA 3IR7B 2IM1A 1S1VA 1TK0A 2MJUA 4KB7A 2KKHA 2FUG9 1WF1A 2DISA 3KJVB 1JJ2R 5FLXY 5K14B 2KVIA 4DR5F 2DNNA 2QT7A 4IYQA 1XN9A 4A8XA 3H59A 2ZH8A 2UVVA 3T5KA 4GO5X 2X1GA 4U67Q 1IXKA 1CQNA 2MMYA 4WXWA 1YVFA 1FK9A 4RWWA 3AQPA 2MQQA 1WEXA 2N3LA 3MPWA 4HDGA 3S01A 1OQ6A 1VK8A 4G1QB 1RT5A 4XPCA 2CZVC 4DSLA 2Q6CA 4EGLA 5DDQC 5I3QA 2HLTA 1KQGB 5KFLA 5KFVA 4ECSA 5BJRA 2ABYA 2DO0A 3UWTA 4RWXA 1TZ0A 1DQAA 4J9RA 5KFPA 2WHOA 1HNIA 3GFXA 1ZM9A 3H4BA 3IFEA 1X0FA 1S0NA 2UP1A 3M6WA 4S3AA 3V6HA 4ZPVR 4A8FA 3CWJA 3OR1A 1RT2B 4OHWA 2DT9A 2RF2B 3S8SA 3BO4A 2RF2A 3BSNA 3FEZA 1GXLA 3IAM9 3OTDA 3DRRB 5A8RA 2HS4A 2E7WA 1PO6A 3TOQA 2GO8A 2K8GA 2WCXA 1HHTP 4IRDA 1WNEA 2E5JA 4DDFA 2J8AA 3TI0A 4OQJA 4Z2XA 1FNOA 2PT0A 2IHR1 3V81A 1FD8A 3MWBA 3OL8A 2MQMA 3GSDA 5DDPC 2QO3A 3C6UB 3IBWA 4ED3A 2ZH1A 4QR0A 4F4WA 3HHNB 1C0TA 2Q66A 2XLKA 3G8SA 3WX4A 1AFJA 1SIZA 3W2VB 2Q79A 1YJTA 3NAIA 3PZPA 2W24A 4C8YA 2WB1D 2R4FA 2CVIA 5HMZA 1B64A 1UJ4A 2K3KA 1HQEA 4H4KA 4DG1A 2EFGA 1L3KA 4I69A 2AD9A 3IRXB 2BOPA 3DLHA 5F9LA 3B4MA 3M2RB 3T1AA 2YKQA 1JX4A 1U24A 1DQ8A 1UJ5A 2XMWA 3KG1A 4FN5A 1RTJB 3LP2A 1B0TA 1RAJA 1QSYA 2JEIA 3FMBA 3NCRA 2ZJRQ 3OSPA 2PE8A 4I2PA 4NLXA 3UFCX 5B08A 2A1BA 4B9NA 5B0BA 3NGDA 3V4MA 4I1TA 2HHVA 2C2RA 2VODA 5GAHI 3HI9A 2E66A 2VQFF 5IT4A 4OL8A 4DPOA 1TAUA 3DM2B 4NRTA 4ZPBA 2Y0FA 1SBRA 2ZH9A 4JI1F 1LQ9A 3PV8A 3E3XA 1BWEA 4PR6A 1ZBTA 3GYXB 4N5SA 4X2BA 4I67A 4JI8F 4PXDA 2WBRA 4ZKAA 5KT4A 1NKBA 2C3UA 4FBUA 4DX8H 1LWFA 2XY7A 3MOZA 5D8HB 2L48A 5IT9Y 1RI7A 3GWCA 3D1QA 4RBUA 4WK3A 1ZJ8A 2B9WA 4X65F 2DBBA 3NAHA 5BYQA 2VKRA 1Q78A 4IFVB 3DLBA 2CPZA 3HKZD 3P6YC 1HW8A 2PD1A 4F67A 1KSPA 2GMLA 4XPEA 4ELTA 1YQHA 2AX0A 3POTA 4NCAA 1KN6A 4K4YA 3CJ3A 4QU7A 4TY9A 4Y65A 3B0MA 2QEXS 3LWLA 3JSYA 5LJ5Y 4Q5VA 3VKQA 1DRZA 3KLIA 3E51A 1H0HB 4LF5F 5IXUA 3GG1A 3V5RA 2KJVA 3EGNA 5M2PA 3KWMA 2WOMA 1VFJA 4XDDA 5T14A 5E3RA 3FVYA 4X4QA 3OV7A 1BQMB 5JVGQ 4DQRA 4N76A 1IQTA 2IBOA 1T02A 4NX9A 3N6NA 1EETA 2KYXA 2IAJA 4KRWA 3HDSA 1MNEA 5EDWA 4J5OA 3MEDA 2M2BA 4FS1A 3CIZA 2NSBA 5HLFB 3RB4A 4F25A 4ZPAA 1JLCA 3GFYA 2YVSA 3QAUA 3MOJB 3BSCA 3LP0A 1M5OC 1YRUA 4DV4F 2HHWA 2VG6B 2XSFA 3QZ7A 4ZP6A 1S76D 1U6FA 3TVZA 5KFGA 4LQ3A 3M6UA