3OR2A

Crystal structure of dissimilatory sulfite reductase ii (dsrii)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
435
structure length
435
Chain Sequence
KHPTPMLDELEKGPWPSFVSDIKQECDNRAKNPKGLDYQIPAECPDDLLGILELSFHEGETHWKHGGIVGVFGYGGGVIGRYCDQPEMFPGVAHFHTVRLAQPAAKYYTAEYLEAICDVWDLRGSGLTNMHGSTGDIVLLGTQTPQLEEIFFEMTHNLNTDLGGSGSNLRTPESCLGISRCEFACYDTQLMCYQLTQDYQDELHRPAFPYKFKFKFDGCPNGCVASMARSDFAVIGTWKDDIKIDQEAVKAYVGGEFKPNAGAHAGRDWGKFDIEAEVVGLCPTGCMTYESGTLSIDNKNCTRCMHCINTMPRALKIGDERGASILVGAKAPVLDGAQMGSLLIPFIAAEEPFDEVKEVIENIWEWWMEEGKNRERLGETMKRVGFQKLLEVTGTKAVPQHVSEPRHNPYIFFKEEEVPGGWSRDISDYRKRHMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfite redcutase subunit alpha
publication title Dissimilatory Sulfite Reductase, Sulfate Reduction
rcsb
molecule tags Oxidoreductase
total genus 122
structure length 435
sequence length 435
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01077 NIR_SIR Nitrite and sulphite reductase 4Fe-4S domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3or2A04
3.30.70.2500 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3or2A02
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 3or2A03
2GMHA 1Y5IB 4Y28C 3B0NA 1F5CA 1K0TA 1CLFA 2AOPA 3VKSA 2VPZB 2FDNA 7GEPA 4S3EA 2C42A 3VM0A 3MMBA 6GEPA 2FGOA 4G38A 1H7XA 2VKRA 2WSCC 1FERA 3MM9A 1AXQA 4XDCA 1A6LA 2PA8D 3MMCA 4S3CA 2FJBB 1FD2A 3VKPA 2Y0SD 5FD1A 3MMBB 1FDAA 1SJ1A 1JB0C 1ROFA 4CI0B 1SIZA 3MMAA 2Y0FA 3VLZA 1FXRA 2FD2A 1GAOA 1PC4A 3MM9B 2WSFC 1IQZA 1Y4ZB 6FDRA 2V4JA 1JNRB 5BYSA 1FRMA 3VKRA 5CHCB 4L6V3 3OR1A 3MM6A 4YDDB 3GEOA 4S38A 1KQFB 1RGVA 3C8YA 3B0HA 2C3MA 1FF2A 1F2GA 4G9PA 1GT8A 2C3UA 1FRJA 2PMZD 1XERA 2V4JB 4OV1A 2WAQD 1Q16B 2V2KA 2PDAA 1FRLA 3OR1B 1FXDA 4XK8C 4S3FA 3VKTA 4S39A 1C4AA 1Y5LB 5AOPA 1H7WA 1G3OA 2C3OA 4AOPA 3VLYA 1FRIA 1VJWA 2O01C 1DURA 7FDRA 3HKZD 2FJAB 5E7OB 5L8RC 1FTCA 1DAXA 1BLUA 3MM5A 3MMCB 1JNZB 2VPWB 3VKQA 2FJEB 3B0GA 3IR6B 2C3YA 3AOPA 3EUNA 4S3BA 3MMAB 2Z8QA 3MM7A 3EGWB 5CH7B 4ID8A 2XSJA 1BC6A 1FDNA 3MM6B 1R27B 1GTHA 8GEPA 1ZJ8A 6FD1A 1FEHA 3MM8A 7FD1A 1SIWB 1WTFA 1KEKA 1BQXA 4AYBD 3VLXA 1H98A 4KT0C 2XSJB 4RKUC 4S3AA 2VPXB 3PNIA 3LW5C 3NOYA 2FJDB 1B0TA 1IR0A 5GEPA 1F5BA 2WB1D 1Y5NB 1DFDA 1PC5A 3MM8B 1G6BA 3B0JA 2IVFB 3GYXB 1D3WA 1FRKA 3IR5B 3OR2A 4GEPA 5BYRA 3B0LA 4G39A 2GMJA 5BYQA 4S23A 2GEPA 1KQGB 1AOPA 1FRHA 1HFEL 1FDDA 4HTRA 2ZVSA 4OMFG 4XDDA 3EXYA 2WSEC 1FCAA 3IR7B 3MM5B 1BWEA 1FDBA 2AKJA 3VM1A 3OR2B 3B0MA 4DHVA 2VPYB 1BD6A 1GTEA 3MM7B 2C3PA 2UZAA 1C4CA 1ZJ9A 1H0HB 1B0VA 1B0PA 1FRXA 4S3DA
chains in the Genus database with same CATH superfamily
2AJ2A 3FFIA 3CCLS 4RBUA 4CM0A 4DR5F 2HIYA 1FJGF 1TV6B 4I7FA 3W9HA 3FZBA 4HR2A 3JYTA 1U0HA 1M5SA 4PQAA 3ICLA 3C6TA 1K47A 2CPJA 2H65B 2L48A 1EQMA 3N6LA 1ZTTA 2O1PA 1QUVA 2QLBB 2DD8S 2PN6A 2HWTA 2AYGA 3LH2S 3UR0A 2RRNA 3AFGA 3GYNA 4PG4A 4J9OA 2WBRA 1UMJA 2IFXA 2JVRA 2OPRB 3ENVA 1XNQJ 3DKDA 2EBGA 4XPEA 1DZ5A 2AW0A 3GYXB 3FKBA 1SC1B 4PG8A 3JQJA 1WSVA 3IC1A 2AEFA 1UZHA 4ECRA 4W98A 3HT3A 4A8XA 2A2DA 2AOPA 2HNYA 1VQ5S 4NYOA 3PJWA 1XEZA 2MXYA 1QVGR 3KK1B 3J81j 3I0SA 2HQGA 2DXEA 2OEMA 1VQ6S 4WTOB 2ZNYA 5FD1A 3MCMA 4DX6A 4MIBA 2M70A 4Q0BB 1RISA 4LF9F 4OZ2A 1V3ZA 1FF2A 4JYAJ 2PC6A 1O51A 2R7OA 5H9EK 4ZP6A 9ATCB 2DR6A 4DPTA 3QJJA 1U1KA 2VG6A 3KLFA 3KNAA 5KFHA 3LANA 3L3CA 4PWDA 1NKEA 4BDPA 3TARA 3PW5A 2ZBCA 3CWJA 3LPEA 3ZZZA 4WP9A 5CD4H 3MZIA 2UUTA 3M8PA 2HNZA 1HARA 3LF0A 2FJXA 5J1EA 1O6XA 4ZIVA 3R5GA 4AD6A 3OFGA 1I1GA 1RA6A 2KH9A 1QJHA 2OO4A 2FVCA 1MLAA 3T5JA 2MJUA 3SEOA 5GMKa 2V8HA 2HHUA 3KDOA 1NH7A 1C0TB 5HROA 3J7AN 3N01A 1T9VA 3VVUA 3TZWA 1PYTA 4ECVA 4KH0B 2DB1A 2E5IA 2KVQE 1XNRJ 3T9NA 2BOAA 3Q86A 3MUVP 1QD1A 6FDRA 4EEYA 5HJXA 3ZZYA 4KRWA 4D3HA 4BWMA 3T1YF 2JC0A 5CABA 3CJ4A 2DHXA 2A6OA 4C6AA 3FFIB 4FPIA 1G3OA 1JIHA 1TKDA 4DR2J 4KHPF 2GJFA 4NCBA 5GAHI 3G6XA 5D15A 1JLFB 3L9ZA 2HK2A 1OPIA 1UWBA 3NCQA 1NSKL 1SUQB 3B78A 1U0HB 4ID8A 2NPIA 5GAEI 6FD1A 1UJ4A 2NLWA 1ZYQA 2OPSB 3PNIA 2RSQA 2DIVA 3AJ2A 2V2QA 4N8OA 1TU0B 1VYAA 3TX0A 4EBCA 3OL6A 5KFUA 2XMTA 1X4AA 1VQ8S 2VOPA 4NXMF 3OLBA 3VR1A 1F5CA 4NX9A 4RW7A 1Q79A 2H4WB 1RE1B 2JL9A 1NCLA 4Y00A 1QDUB 2YX7A 3QFWA 2CPYA 2J0QD 1KONA 3UWTA 4DV6F 1EZZB 1Y0HA 3TRGA 4ED4A 3PJXA 1GEHA 3BGLA 4F4XA 1FJGJ 2ILYA 2HHQA 3I0SB 5D0RA 3HP6A 3VCDA 3A13A 5ADZA 2R7QA 3L7OA 1EHWA 1QE1A 3PX0A 1HQEA 3CSKA 1S1XB 1LXJA 1GTHA 2RVJA 2PT0A 4NLVA 1KQKA 4ED3A 2E66A 3IGNA 3UI3A 4C3MA 1XMBA 2OEJA 3QSIA 1JLBB 2EG2A 1FKOA 4MYUA 4DJBA 1KN6A 5I4MA 4X4NA 3MURP 2XSFA 3ILIA 2UUAF 2DXDA 2B0GA 4U7UK 4K7QA 2N4DA 3H5YA 1RAHB 4N56A 1KD1T 2RQMA 2FGOA 2QMUB 2XGQA 3DLJA 4DV0F 2HNZB 5J1EB 4KBIA 2Y0SD 1JB0C 2F9DA 4P7VA 3MM9B 1MMNA 3Q8QB 4S0MA 1GFWB 4V1Ak 3IS9B 3GSIA 4WTYA 2V9WA 1RWUA 1JLCB 5LOQA 3GPAA 3UCZP 2IRXA 2C3YA 4LF9J 2B9YA 2YPYA 2KJWA 1U47A 1SBRA 3MR2A 1WC5A 3VZIA 4X4VA 2FYXA 1I94F 2GVZA 2ZC3A 1NDKA 5E33A 4DQPA 4KYZA 1HNIB 1KTQA 3NG8A 2J6UA 3HXMA 2ZKUA 3M9MB 1T94A 3NY0A 3FEZA 2NREA 2YH0A 1PILA 2OI2A 6GEPA 5FJ4A 3IAS9 4IFYA 3JS9A 4BHQA 2G2YA 3HZEA 3VKPA 3L4BC 3DNCA 4HI2A 3AQPA 1GAOA 1RU2A 3RR8A 4KTQA 1PJ5A 1OY8A 3BB5A 4C0OC 4LRFA 2QA2A 3RBDA 3D5MA 3PCOB 1IKXB 2CFXA 4S39A 1UETA 3BJYA 1XMQF 1UPMB 2FZCB 4RW7B 4MFBA 4YY3F 2HEKA 5DLFA 2GIQA 4YR3A 4A8WA 5IT9U 4DV3F 3EJMA 1T9XA 5IQQA 1QUPA 3T1YJ 3IWNC 5KTQA 4Y2AA 2ERRA 3KWMA 1URRA 4KHPJ 2XMWA 1FHTA 1PGZA 5KG2A 3Q22A 2Y1RI 2MY8A 3L09A 2AKJA 3K7RA 2DHGA 6AT1B 3DOLA 3V6JA 1C1CB 3QWPA 2NUUG 2VA3A 3MPYA 3QT6A 4DOZA 4CIOA 3PY8A 2BUNA 1VHIA 4P2FA 2CPIA 2VKRA 5K9FA 4XDCA 3MMCA 2O3DA 4WKYA 2ACMA 4QW8A 3SV4A 4C3KA 1H73A 1GQEA 2HK3A 4DR6J 1XERA 1N0VC 1WI8A 2W2OP 2ZM6F 5SUHA 1U1LA 2JFKA 2QIFA 3L7PA 3J7YU 4KJIA 4NEYA 2NZCA 1QAYA 1Q95G 5LMNF 1TL3B 3EVMA 4RBTA 2ZD1B 2L9WA 2I9SA 1FDNA 3K58A 8GEPA 2K1RB 1TQLA 4ICLA 1RCXB 1O5JA 3AY0A 3G96A 3OQ2A 2OPPA 3I87A 1O0PA 5B0GA 5BYQA 4HACA 5CA5A 3C16B 5C2GA 4WKRA 3TUPA 1JLGB 2HIQA 1IKWB 3EDRB 1BD6A 2Z58B 1WNEA 3DRXA 1S9GB 1NKCA 2IYIA 4YQWA 3T41A 2K06A 2LKZA 3CJTA 3DN9A 1IUJA 4WFZA 2FVPA 1MW7A 3HHEA 3DFEA 2GVZB 4RLEA 2HHPA 3EDQB 2CQIA 3NS7B 2UUAJ 3OHBA 1FXRA 2D69A 4F4YA 1CEZA 1R8PA 4CCHA 5CZVA 4DF8A 3ZTRA 4A8YA 2MMYA 4RO0A 3T1HJ 3CMES 1PG5B 2N3LA 3VWSA 1SJQA 1O8BA 4DV0J 4HLBA 2GMLA 3V4MA 4DFKA 1BHNA 2C2DA 4B9SA 2CPEA 2ZC4A 1EARA 4OYZA 4YEAA 1H74A 1L3KA 1DBDA 2E1RA 1NDLA 1X5OA 3HM9A 5EN1A 2GAGC 5CYMB 5E0OA 2W9AA 3D3CJ 2YKPA 2J0SD 3Q2SC 5CCMA 4C3LA 3MEDB 4FVMA 1S1UA 4USMA 4NWBA 1EKRA 5A0YB 2GA7A 3QO9A 4JBCA 4NLRA 3DXSX 3HVRA 2J7UA 1WTBA 3NMRA 2EW9A 3J81Y 3IG1A 4MKBA 3ISZA 3ZZTA 1FERA 3SSRA 4CLSA 5EHHA 4JP8A 1PJ6A 2HS3A 3D0HE 3M2UA 3OTBA 4KFBA 5K8MA 2AJQA 1LWCA 5RUBA 5D6GA 5KFJA 4JV2A 3P49B 4PYDA 2UUBF 3U02A 7FDRA 2LA6A 3CIMA 2L41A 3MMCB 4ZLPA 3AXKA 5DZ6A 4XIUA 5CD4A 2B9EA 2POKA 2X1AA 4QR0A 2ROGA 4NI2A 4NYZA 3ZNUA 1XMQJ 4I2QA 3RZAA 2W2QP 1R3NA 1DTQA 1XQIA 2BKOA 1SJFA 1KS2A 3CCQS 4DV3J 5T41A 2JEJA 1CQNA 1KLMB 3CD0A 2VBZA 4GMKA 3G4SS 2PD1A 2XMMA 2AYMA 1T03A 3H0PA 4DL2A 2Y1LB 3BBFA 5HVHA 1BQNB 5H1SV 2PA8D 2FJBB 2B51A 1UVJA 2VFTA 2XZDB 4HACB 1AZSB 1TZ0A 4N7TA 3CDBA 2KFZA 4FPRA 3B4MA 3GFHA 5C25A 1X0PA 3R6LB 3S7RA 2L9DA 2J9EA 5A8WA 4A8MP 3NL0A 1FT8A 3VAHA 1LWFA 1EETB 4IH6A 4CLYA 4O44A 2CDQA 2HQDA 5GADU 5KFYA 2DNGA 3OHAA 1YHQS 2YVSA 2E9TA 1F3VA 5GAGI 5KFSA 2HWIA 3X1LB 1K8AT 2AIRB 3BQ1A 3D3BJ 1VGYA 4CO4A 5ETQA 5LMNJ 2L9NA 3ZTQA 1KFDA 3V2UC 4HTRA 4H4OB 4X4RA 4ZKAA 5J2PB 2YBVA 1ITPA 2EPIA 2AJ0A 3V6HA 2EK6A 4P75A 2O66A 1S7IA 3MPUB 1VOMA 1K44A 4PUOB 1S1TA 1REVB 4USIA 4Y2MA 1MWYA 1X60A 4A8SA 1RTHA 1N54B 2RJZA 1S6UA 5AXNA 3KYLA 3P5BP 4W4MA 4UY85 3WIUA 1FFSB 1U6ZA 3T5HA 3RBXA 3H4DA 1X4DA 1HNWF 4ZVTB 1FVQA 4KC5A 3UN3A 2H5JB 1V6HA 4L76A 1R8BA 2RILA 4P71A 1DQ9A 2DCUB 3KXDA 2CG8A 5E3QA 2V0NA 4MYTA 4C98A 3M2UB 3TJ8A 2KI2A 4KFBB 3GMGA 4QWBA 3TAMB 2XS7A 2I1RA 1NSQA 1TUGB 2RB7A 2B5JB 4MT1A 4ZHRA 3LP2A 3TWZA 2OFHX 2AMCB 2A6MA 4K4UA 4NZ6A 3DLBA 1FNMA 2V6AA 4QIVA 3AT1B 1U1RA 1U8WA 2AP6A 2YX1A 2HHTA 4GVBA 2G0CA 1RTZA 4I2QB 1RKIA 1Q53A 2Z30B 4ZN1A 2ZH6A 2YXLA 3ET6B 5T7LA 4FZVA 5EUHA 1VRTA 2W01A 3QJLA 2CJBA 1XWLA 3L7UA 2APOA 4FDFA 2MEWA 3SCIE 1NZ8A 3SFUA 1U2FA 2FLNA 1IXKA 4XK8C 3MXHP 3CCSS 1VJWA 4HHUA 4LSLA 2ZNZA 4EO8A 4IFVB 1N5YA 4F50A 2YKNB 3G6YA 3C66A 5A8KA 3EGZA 4AT1B 3T1AA 5LJ5Y 5HK4A 3FSYA 4MK9A 1LWEA 2BM0A 3EWGA 2G0JA 4KE5A 2UUBJ 3GIJA 1X9SA 2QGFB 4QU6A 2E7WA 1UA1A 1FA0A 2DGXA 1LWFB 3SDEB 5KFEA 1WHVA 4B3MF 2BYCA 1RBAA 4UOGA 3B0MA 5DO2A 4IG3A 2CQGA 4P2SA 4ECSA 2VD3A 2XYHB 3JAMU 3ILOA 4WWSA 1T02A 2NYHA 2SXLA 1HHQA 4KSEB 1KSPA 4X62F 1M5KC 2ZH2A 3D0GE 2AJ1A 5MAOA 1X0FA 5A76A 5KG4A 5L9NA 1FRMA 1RCOB 2IIHA 5E2QA 2GO8A 4NLWA 3MAAB 2D3UA 3IRWP 4IDKA 2ZH7A 2H48B 5J2NA 4N47A 2WVDA 3R8YA 3TEGA 1S1TB 1N5QA 4I4BA 4UT4A 5DM7Q 3ULHA 1OY6A 3RB6A 1N36J 1ZH5A 2HS4A 4TQSA 4ZVOB 4WPAA 3CC7S 2MKHA 2YNHA 3QAUA 3OVSA 4DQRA 5B08A 3GU0A 3NAIA 2XC9A 2GS8A 1YX2A 5J1PA 3MD3A 2CZ4A 2ILZA 4QYZJ 5G4DA 1OYDA 4DSLA 2UXBF 2VG7A 1HMVB 4YDXA 1UPPA 2GGPB 3MHYA 1FDBA 2OHDA 2ZITA 1U48A 5F8JA 5E41A 5B09A 4K5SA 5C24A 1FKAF 4Q43A 4ED7A 4NL5A 4YR2A 2RQ4A 2EEYA 1BY9A 4ZHRB 1TAUA 3V6KA 1WG4A 3LP2B 1N56A 2M8HA 3CO0P 2RIJA 3S1TA 1VC0A 1P9YA 3AH6A 4NLUA 3HCXA 2E7XA 2OFGX 3TVKA 5HAOA 4IH5A 1KVJA 2WOMB 3H20A 1A9NB 5D4OA 4WYLA 4MAKA 1H3DA 2B6AB 3KMQA 4LVOP 4CLKA 2YNIA 2EKNA 3M1VB 5D77A 3VAJA 1W25A 4FF3A 2BACA 3BQ2A 3FDSA 3ENWA 3T6BA 3D1QA 3NRBA 3VAMA 4DXLA 1NJYA 1KWMA 4YHHF 3L95X 2E1AA 2QL9B 3KJVA 3Q8YA 2DNHA 2WRMA 3OFEA 1ULRA 3ISND 2WSEC 1N5YB 3GWCA 4DWIA 1QAIA 4EWTA 3UD4P 4LF7F 3PFEA 1B0PA 2PMWA 2MQNA 3THPA 1ZAVA 2JZ5A 2PE8A 1LWEB 1HNVA 4OQJA 3MMBA 3QAEA 1YRXA 1S49A 4I0WA 5KT6A 3MD1A 1T95A 4PXBA 1TKTA 3US5A 3T6JA 1FFGB 1S6PA 4JI6F 4EBDA 4Q44A 1FXLA 1NH8A 4DLEA 4TYBA 2RAQA 3GCXP 1RYSA 3PHTA 3MR5A 2HHHF 1FTCA 2KXFA 4HYKA 3T19A 3OW2R 1VRUB 1RSCA 4ED8A 5EGYA 3SSSA 1AB8A 1X5TA 2ZZNA 2B4PA 2B7BB 3LPYA 4QWCA 4Z2XA 1KEKA 4O3RA 2P9CA 1FFWB 3HI9A 2QFJA 3FEXB 3Q8VA 1CULA 3OR2A 2WW4A 2UUCF 2GHWA 5AXLA 3CVKA 4TXSA 1IBLJ 2LVWA 3MEEB 3NP5A 3ZZPA 3HT0A 1F60B 2B8PA 2BABA 3W2VB 2KRBA 1EP4A 2RU9A 4OZJA 1FJCA 2R8GA 4B3MJ 4CQ1A 2G9OA 3CXCR 3OTOF 3DLEA 2KZMA 3RG6A 3HSJA 1V3RA 4N41A 3U1LA 3CD7A 1J5EF 1NUEA 1FRJA 3MR6A 5DS7A 2VIHA 4PPZA 4JI3F 3J7Z5 1W2BR 4X66J 1C0UB 2C2NA 1VC6A 2CYYA 2RRBA 2V2ZA 3IR6B 2XO6A 3DDKA 2F63A 3CGIA 4L75A 1HD1A 1NPRA 1UTAA 3RAQA 3Q23A 4UF4A 2IYGA 5J2MA 4RNMA 4OX9F 3G86A 3CE8A 2LLZA 5ETTA 3VGTA 3I0RA 2IVFB 3CJSA 4ELUA 1VBKA 1RTIA 2ZOMA 4CZCA 2MQ8A 2NS1B 1U1NA 4LT6A 1NK7A 2M4MA 2M5YA 2CQDA 4WFNQ 5HLFA 2UXCF 1U26A 2W7AA 4CT9A 3PW4A 2YH1A 2HAFA 4QYRA 4PQUB 2UXBJ 4NLOA 2LCWA 2MQQA 1HPZA 3DRSB 1C1BA 4DN9A 1I51B 4MH8A 4OJ3A 3GQCA 3QPIA 1RXOB 3MM6A 1JXEA 3HF5A 1R8CA 2MLXA 4HDHA 2VASA 4WYWA 3W61A 3AB2B 1JJ2R 4M5GA 1H7WA 2YWEA 2ZKTA 3I82A 1SL1A 3K0JA 3DHXA 3H5SA 2J76E 3A8IA 1HNZJ 3X3UA 4DZDA 3EVOA 4F3OA 3N9UC 1Q78A 2XS2A 5A8RA 3R3TA 3TUZC 2KTQA 5LSRA 2VB6A 3OLAA 4KGXB 3F0NA 5E5NA 4ENOA 5ETSA 1AOPA 1T9UA 3M8SA 1WUUA 1ACMB 3G87A 5FIIA 4PWWA 2CVEA 3FUYA 1HQUB 4NLDA 2XI2A 1SL0A 1UEVA 3Q0AA 2LEAA 4ECWA 3G2XA 4CWBA 1HWIA 1CG2A 2FJWA 5HBMA 2R4FA 2IAJA 2XI3A 3M2VB 4LF7J 1F5AA 4FXDA 3BREA 3V4IA 3D6TB 1HBOB 2GNKA 4Z7YA 1JLEA 1VRQC 4DSFA 3HSDA 4UOCA 3BEGB 2MZSA 2K2PA 2KDOA 2MLYA 2QO3A 2B8QA 4FYVB 3ETOA 4JI6J 3CJ5A 2DO4A 3VGSA 4C0HA 5I3QA 1WF1A 1K1QA 2IC3A 4DS5A 4EK2A 3VALA 2VBWA 4U8YA 1RJJA 2HHHJ 3GJSB 3B82A 1FNOA 5BYRA 1KQGB 3GR0A 4X4TA 1CC8A 2HS0A 4K0KF 2GO9A 1NU4A 3K59A 2OMLA 4ELVA 3OSNA 5CCLA 1Y3JA 2H5IB 3G82B 4HKQA 2ASYA 2Y3YA 3KJNB 2IJFA 5J2MB 2DY9A 3ZNJ1 5IOLA 2AV5A 4B9LA 3QZ8A 1HWKA 1SKUB 2UUCJ 4G1QA 4DX5A 2ZH5A 5H9FK 1S0VA 1RTIB 2I2YA 1GMWA 3D1OA 4R0EA 1YJVA 2AJ4A 4NPOA 4ZLLA 3HHKA 4ECUA 2Y8YA 1VHFA 4A47A 3EMTA 2AGQA 3VQSA 5E3AA 2YKAA 4DX7A 4CLTA 5E7OB 1HBUA 2QX0A 2IMWP 1HPZB 1NZAA 2DHHA 3PVXA 2OAUA 5K8NA 2DY1A 3VAIA 1HNXF 1J5EJ 2V94A 2RQKA 3MM6B 2FVQA 2PI5A 2V9KA 4RZRA 4FYYB 3CB4A 5EWEA 4JI3J 4ES1A 3M8ZA 2DIUA 2VPXB 2ZE2B 4ED0A 3H2LA 4LIRA 2MQPA 3UN2A 2QZ8A 2DNNA 1PKUA 1WG1A 1UVLA 1W2IA 2XHWA 2P6SA 1C4CA 4GC7A 2R2RA 4OX9J 2OH2A 3DRRB 3HJVA 4LF8F 2VC1A 3PKYA 2BDPA 3B0NA 2BRKA 1LOUA 1IM4A 1B4SA 2BQRA 1UW4A 5LM7E 4UTGA 3J80Y 1LW2A 3EPIA 3LGNA 4G6VB 3M32A 3R5JB 2Z56B 3JSMB 4KO0A 4KV8A 3MEGA 1Q82T 2RDIA 4OYAA 2H5EA 1A7GE 5JJBA 1U2CA 1NAQA 4F25A 4ZVQB 1A0OB 2QSWA 3PRDA 3N4WA 5L8RC 1HR0F 2NSCA 5HATA 1WWHA 2ZH3A 1JNZB 2DNQA 4FNIA 3AD8C 1AT1B 3MM7A 4ZVEA 2XY5A 3DGPB 2V34A 2ZUGA 2EFGA 4USJC 1T05A 1DJ0A 5L1JA 3KFWX 4DR3F 2I5JA 3IBWA 1NKBA 1FRKA 3DLLQ 2GV1A 2HGLA 1ZTWA 5C5JA 4ZK7M 1E6VA 2RT3A 1YVFA 4LF4F 3UFCX 1FWPA 1UEUA 3C2PA 1R6VA 4L3KA 4CLWA 2Q79A 2CXEA 4JI2F 4OZ3A 2Z0GA 5F8LA 3OV7A 3FBBA 2CG4A 1GMWD 3T5KA 4USKA 2R2TA 4RR5A 3RGIA 2CQ0A 3LP1A 4KPCA 4WE1B 1UEKA 5B0AA 1S5ZA 4NASA 2BJ8A 2VHGA 3DOKA 1J5OA 4QIGA 3FC9A 4C7QA 1K0VA 4TVAB 2W2NP 4JUZA 3LO3A 1PBUA 1IVZA 1GX6A 3FGVA 3SQGA 3I6PA 4OI2A 2XYGB 3MM5A 4M5HA 4LF6F 2K3KA 1RBOB 3K5OA 2EK1A 3M30A 2VV5A 3MEKA 1WACA 1WI6A 1CJUA 1R27B 3I4PA 2CPDA 4HVZA 3BH6B 5KT4A 4R5PA 3MAQA 4FS2A 4ZN3A 1FWLA 1HYSA 1JLAA 1B7FA 3UVJA 4NLSA 1S0NA 2DNRA 1RWOB 4LF2A 2Q6BA 3DU5A 4KY3A 4CO1A 3ISNC 1CS4B 4DR1F 3ILJA 5E3CA 3N28A 2LQ5A 1FE0A 1TL7A 3HSGA 3UDEA 2BOPA 4MK7A 4NLPA 1RT5A 4O4GA 4K0KJ 3I32A 3D7SB 2B56A 1S0MA 2CQHA 3HMJG 1NSAA 3HVTB 3SBMA 1PIEA 2VDHA 2EFNA 1YLXA 3AAWB 2C3MA 4JB8B 3KHRA 1F2GA 3CDAA 5F8NA 4AL7A 3BN7A 1CJVB 1NJWA 5F8IA 4M8LA 1N0UA 5DQHA 2DYAA 1LW2B 2DGUA 3M32B 1RAOA 3AOCA 2R7XA 1E6YA 4F4AA 1KBRA 4P2XA 2AD9A 3C14A 2Z4PA 5KT2A 3CJQA 3I9ZA 2OKQA 1IKVA 5HMWA 4CDIA 4O3OA 2IBOA 3NGSA 1RWKB 4XDDA 2RMLA 4PZVA 4BS2A 2A0FB 1RP5A 4Y0FA 1HHSA 2L08A 2VPYB 4IOAQ 3OVAA 3MM7B 3FCWA 2HHVA 1ZJ9A 3Q8UA 3NGRA 1T05B 3BM7A 2RU3A 3D28A 4NCGA 4LREA 2BR0A 2ZH1A 1KOOA 2QEXS 4B3OB 2JH3A 4ER8A 5ETMA 4CO3A 1FKPA 4TLQA 3OR1A 2WVEA 5DLGA 2R42A 4GRSA 1NK4A 1S9EB 1T8EA 2HRUA 1RT1A 3J81U 1Q86T 5F8MA 1VQLS 1Y3KA 3LP1B 3AHPA 2A1BA 2H1YA 3CJ2A 3THTA 2JSXA 4OJHA 2HGNA 2PO4A 1VR6A 1HW9A 2CRLA 3GIKA 3DMJA 2IJNA 3DOKB 1UJ6A 2G2ZA 4A8KA 3GFXA 2B4UA 2GVDB 3KOAA 1UVNA 3GILA 1U0SA 1VISA 4HTJA 1HR0J 4YOEA 4YB5A 1YWXA 3HHLA 2M3DA 1RWNB 3SQGB 2NSBA 3MM5B 2N82B 4IQXA 1RABB 1WHYA 4G3IA 3CF5Q 1HIYA 1MWZA 4DL4A 2FGCA 1VJQA 4ZJOA 4DR3J 1NHUA 4A48A 4LSNA 2QSFA 2KN4A 4F3MA 4QCLA 5T14A 3UVJB 3C6UB 2RUGA 4K4YA 4LF4J 3PEHA 3CJ3A 3A8EA 2WVFA 5MLCV 2W24A 4Z37A 5K14B 2AWZA 5ITHA 2KFYA 3K5MA 4ED1A 1JWWA 4BBYA 2Q3PA 2DBBA 4MKVA 5KOXA 4CNYA 3DM2A 2PDAA 3QNWB 3BKTA 2RHQB 1QVFR 3TYTA 1TL7B 2HWHA 5CAAA 5G0RB 1JXLA 3RAMA 4YB1P 4B3RF 4C8OA 2VG5A 4F8RA 4IO1A 4OL8A 1R43A 3MTJA 2CQ1A 4RNNA 3QIPA 4XAKA 4RW6A 1CJKA 3POTA 4I6YA 5IM0A 1FEHA 4ZVUB 2MTLA 5SZTA 5E3PA 4DL6A 1YSJA 1UP1A 4QPXA 2RF2B 4LF6J 2D9PA 2DXFA 2L3MA 4AUKA 1RWXB 3OTEA 3CC2S 2VJVA 2D41A 1E6YB 3W65A 3BO3A 1GXUA 2HRTA 4UW2A 3R2CJ 2YKOA 4Q8FA 4K4SA 3V6DA 3KLHA 5KG3A 2V8PA 1RQ0A 2XGPA 2LQ8A 2LMIA 2D3OR 4PKDB 2QFIA 1JLQB 4DR1J 3GEOA 5B0BA 1FJEB 1HKAA 4ZP8A 3PKMA 4YN3B 4E8UA 2WAQD 3QT8A 3UW1A 2QYCA 2R7SA 4NCGB 4NRTA 2HVDA 4J5OA 3MPDA 1N48A 1RAAB 2BX6A 4DG1B 1LNQA 3HHLD 1X4BA 2IHR1 3UO0A 1YZ6A 2HMIA 4WBFA 2XSJA 2GQCA 2V68A 3MCSA 3LP0B 2HQCA 3MM8B 2JFDA 1RT1B 4TLRA 1NJZA 1IR2A 5B0DA 2WHOA 5JVGQ 2QA4S 1B70B 4KR0B 3PYGA 3ENAA 1RT4B 3CCJS 3U7JA 2W7PA 2IPOB 4OJGA 1Q5YA 3DMJB 1IBKF 2DNYA 3V81A 3W8PA 2HLTA 1WELA 2JRSA 4J90A 2FQQB 1N5SA 4JI8F 1KNZA 4CO0A 1CJTA 5GMEA 1R0AB 2MKCA 3U27A 1NK8A 4U6PA 4EYHB 3E51A 1XR5A 3NOGA 3ITHA 2BEFA 4LF5F 3PO4A 1SIZA 3P96A 3QLHA 4R8UA 1DTTB 2DHAA 3M8QB 2Z2MA 3CDWA 1Q5VA 4F26A 2YKMA 4NA3A 3BDPA 2UVWA 1OPZA 1SVDA 1YBUA 2ZOFA 3FMBA 1JJHA 3NBPB 4OYXA 3PZPA 4WXWA 4M5DB 4NEZA 1N52B 3GTYX 4GKJF 2ZUAA 4S3BA 3KHLA 1W7WA 1VMBA 2HURA 3D54A 2IM0A 5H9EJ 1ZAWA 4UY8T 3WBZA 5I42A 2CKWA 3MFHA 1HL6A 4RKUC 2WVCA 3DM2B 4W90B 1HW8A 4LRCA 1TTHB 2WB1D 3BKUA 1B3TA 2VF3A 2FY1A 1UCNA 2HQIA 4CYUA 3B4DA 1SB6A 1Y10A 2X7IA 1QY7A 4DCJB 2RHSB 2C3PA 1J27A 1RT3B 4OYWA 4RW6B 4S3DA 5K8OA 3TI0A 4IG0B 4C2MA 1WC3A 1F0XA 2UVRA 2HBZB 3HHNB 3QRRA 1RLDA 3CDUA 4KHRA 1P6TA 1WC4A 3DC2A 3GV5B 1XC9A 3W1YC 4X4OA 3HFZB 3A4TA 1RBLA 4L73A 1Y00A 3TAQA 4FP9A 3K5PA 1WOSA 2KB2A 2E9RX 5IT0A 1UWAA 3MFIA 1JXVA 3B0GA 1RT7A 4BC9A 2G0IA 4Y2KA 2CWXA 3SCKE 1FJ7A 3LAMA 1BGXT 4E98A 3SCJE 5I3PA 2EG1A 3D0IE 1LKZA 2FUG9 2PFFB 4B3RJ 3F56A 2OGUA 3DCAA 2CZ9A 1J2VA 1MROA 2LXIA 2DJWA 3Q8PB 4ZOSA 2HMIB 1NJXA 4ZPBA 3MF5A 2CQ4A 3DXBA 1QAJA 1N6QB 4KIAA 1IM6A 1UAWA 3EVWA 4RX6A 4E2FB 1RA7A 1L5UA 2IBKA 5KFTA 4Y6IA 1SJ1A 4OHVA 4JV0A 2VBYA 4KAIA 2OJ3A 2V2VA 3LQVA 2RH3A 1NO8A 2XMUA 2C3UA 1KVIA 2ALZA 1TVRA 5DDPC 2MGZB 4DPWA 1CJTB 3VLYA 4NMXA 2WBMA 2HAIA 4H4MA 1PJ7A 2XMVA 2XB2D 2R8HA 2ZZTA 4ID5A 1OS5A 4TY8A 3MECA 2MQMA 4JI4F 5C42B 2ZDOA 2KYXA 3PR4A 5CQGA 5D3GA 3TUIC 4ETXA 4TN2A 4JV5J 1CVJA 3SI8A 1LXNA 2BANA 3OTDA 4IRKA 2CQCA 1HI8A 2GIFA 1EB0A 1SCJB 4IYQA 3LUYA 3TW0A 1KOHA 3KLIB 5L1KA 1UL3A 2HBRB 5GADI 2GHVC 4ANCA 3Q2TC 4CTAB 1U4BA 4CYUB 4FYDA 5B0FA 4C97A 1IQZA 1Y4ZB 3TX8A 2KM8B 2AEMA 4MIWA 3VQTA 5IV4A 1RK8A 1N33F 4JI8J 2VBXA 2VC0A 2FZGB 2V4JB 4ZCLA 2HBYB 3QWUA 5J2QA 2V4QA 2IA0A 1WG5A 4LF5J 3RW7A 4RU2A 4F4KA 2RDDA 4LBPA 3IN5A 4X4PA 2DT9A 3KKFA 2D9OA 3AXMA 2C2RA 5IWAF 1RAGB 4CP5A 1IN0A 3NXZA 1IR1A 1H72C 2E9ZA 3CJKB 4WFBQ 1VLYA 4GKJJ 4RWXA 2DR9A 4I6WA 3KK3B 2IJRA 3C15A 4RW9A 2BM1A 5DQIA 2W9CB 2MYFA 4HTIA 1FRXA 5KFRA 3F44A 3LWMA 3VM1A 1Y5IB 4FKYA 3LALA 1RTDA 5KFCA 4GC6A 2C42A 4J9LA 3TA2A 2OD4A 3N5BA 4O3PA 1N34F 3JSRA 4ATNA 4IOCQ 3DDIA 1VQNS 1S72S 1P27B 2E1CA 1PC4A 4I7FB 2XCAA 3DLHA 2MKSA 1G7CB 2DKOB 2YQ0A 3CD5A 3JYTB 3KLGA 5KFXA 3B54A 3C6TB 1FRIA 2CQBA 1JMTA 1MU2A 2C28A 3RYLA 1OSCA 3H2VE 2OLWA 4ZPDA 3GFYA 1B7YB 2FZKB 2EC2A 4EYIB 4NXNJ 1YBTA 3ZC4A 2PSZA 1GMUA 2P2CB 1SIWB 2AX1A 4O3NA 4U7CA 3IXQA 4NOHA 1MMLA 4TU9A 3W62A 3OTCA 4O3SA 5DETA 3QATA 1X31C 4ED2A 3RW6A 2E5GA 3UCGA 4B9NA 1R8HA 4TY8B 3R5BA 3CCES 3SMZA 3HVAA 2ASLA 3EX7B 3CCUS 3H25A 4DR5J 3OSPA 1XR6A 1AXQA 1RWVB 2HNYB 2MZQA 4CLUA 2QG9B 4NCAA 5HMXA 3PRBA 1U7LA 4WFAQ 2YPZA 2C22A 5IQ6A 3RJMB 4DU7A 3ETMA 3PHEA 3IBCB 4DR4F 1Q4RA 2CAJA 4X4UA 1T7PA 1RYRA 2CVIA 2R7RA 4WP3A 4NYPA 2KU7A 1CSJA 3CTRA 2DGTA 1NPKA 3GJQB 2FJAB 1ZZFA 3IRXA 1X9WA 3PM9A 1MN9A 1MWQA 4LBHA 1I3OB 3RRGA 3H98A 4MJKA 2VG6B 1DLOA 2C2KB 3KLFB 2GHPA 5B0CA 3LWLA 3OL9A 1K73T 2D7SA 4PWDB 1BQXA 3VF0B 3RAXA 2F8MA 3PYDA 1SPBP 5J2QB 3J7ZT 3GIRA 4JI4J 4FNHA 3GG1A 3M8PB 3FSXA 2OTJS 4P2MA 3NGDA 5EDWA 5HP1A 3JTOA 4ZVHA 4JV1A 1IWAA 4ZLNA 4OX7A 2HHWA 1AA1B 2LQJA 1Q8KA 3MDFA 2XEXA 4R0JA 5HO4A 2B9WA 5HROB 4LUBA 1WC6A 4ZPVR 1GMVA 4DCPB 3CD6S 1NPPA 1FI4A 2VH7A 2E1PA 4NLGA 1T0TV 3ELHA 1V3SA 2VA2A 2ZJQQ 3PYFA 3AODA 4B3TF 4WFYA 3TP2A 4RU9A 4AL6A 4ZLJA 2PEBA 2LQ9A 3PDNA 2G1DA 5EWGA 4DV5F 1IJEB 2XZTB 3WX4A 1N33J 1WKKA 3R7NB 2Q1LA 3HHLC 8RUCA 3CJ0A 1UWBB 3W5YA 3SIPB 4QPTA 4QR1A 1TMMA 4K4XA 4DQQA 3KDNA 3KLGB 1U1PA 1G6BA 2J6TA 1MU2B 1FD8A 3IBFB 4OZNA 2HNDA 4OV6A 3PW7A 2HFOA 4G1IA 2JEIA 2QMXA 2FLOA 3D67A 3A3OB 4OLPA 1X7VA 3Q8RB 2VUGA 2GCFA 5B0EA 1YRTA 1TKXA 3BYRA 2OMOA 2I8EA 3C19A 2GX8A 3UPFA 3Q89A 1BMQB 4LVNP 2DRDA 1M5OC 1N5TA 3E2EA 1KP6A 2BZ2A 1RAIB 2KXHA 5D0HA 1UVIA 5D0GA 3BSOA 1RI7A 2GJ2A 2CQ3A 1HBNA 2IDLA 1YKWA 2A10A 1N88A 4PCQA 5DRKA 1WJ9A 1DAXA 4DEZA 1WORA 3NS6A 2F5GA 3THVA 3QIDA 4LR7A 3ADAC 3R5DA 5F8HA 2RNEA 3M2RA 5KT7A 2XG8A 3PYEA 1XK8A 5IT4A 1QE1B 5LMUF 1HQEB 5KFNA 3PW2A 1U6FA 3QGHA 3R1HA 1F5BA 4UZBA 5KFIA 5ETRA 2WW8A 4FYWB 3TA1A 3M6VA 4PG7A 5K5MA 1FKOB 4B17A 1FTRA 1UZDA 2F4FA 2KT5A 2QL7B 4NXMJ 1S6OA 2MPUA 2XO7A 3DGVA 3BGRA 4DV2F 3AA9A 1QTNB 3WC2A 3WIVA 2E5JA 4AQYF 1NSPA 4NA1A 4ZVGA 2LP4A 3R6GB 4ZJLA 1HD0A 4J37A 4U67Q 4LSZB 5HP1B 3AJDA 2G4BA 4X4QA 4DV6J 4OV1A 3D6MB 1VQ4S 3PTWA 1K1SA 4F4ZA 4DV4F 3HLUA 5LSLA 4QZVB 2QA4G 3Q83A 3J80U 2VFVA 2W25A 4I2PA 1RAEB 1TUVA 1AROP 3MR3A 1WDTA 4DR4J 2FLLA 3H40A 2G2OA 1V5VA 3DOMA 3IFEA 1S10A 1CQMA 4CH0S 3VAKA 4H4KA 5F8GA 4XPCA 4RUBA 4ZP7A 3O8WA 2JEGA 1URNA 4B9VA 1NHKL 1BQMA 4KH1B 1FO1A 3H5UA 4KQZA 1K0TA 1JKHA 1SJ3P 3R1LA 3NNAA 4X2BA 1H7XA 2MDAA 2P8IA 4K4ZA 3KUGA 1VC5A 1Z2LA 4IFYB 4YFUA 4DF4A 2HNDB 2Y8WA 1LFPA 3WDOA 2MHNA 5ETNA 3A8KA 3AD9C 5KT3A 3FQLA 4WK1A 4A8OA 4DS4A 2HVEA 2C3OA 4EU0A 2JX2A 3KK2A 4B9UA 1YRUA 1WSRA 2LXFA 4ZPAA 3AJ1A 5JXSA 2MKJA 3DYAA 4MFBB 4K59A 1B99A 1SJRA 4PR6A 2VODA 1DY3A 1BC6A 3C46A 1XR7A 4LR9A 4URSA 2EFOA 3W2WA 4B3TJ 3DLGA 2V50A 1VK8A 1JK9B 3OUYA 4P52A 1I94J 3KLEA 1TK8A 4DUZF 3B0JA 3CJRA 4S23A 1OY9A 1Z1ZA 1QTMA 1RHUB 5DDQC 5D4LA 2NZ4A 3O3LA 1LEOA 1WF0A 1CLFA 4ERDA 1G4CA 3DOLB 2WK4A 2AHOB 1WKJA 2BJ7A 5JVHQ 3PW0A 5KT5A 2XWXA 3G8SA 2BW2A 3OXFA 3NCRA 4L6V3 3CCMS 2DPIA 2CJYB 2PMZD 3DI6A 2HFSA 4LR8A 1D9FA 2FVRA 2UVUA 1M1HA 4OI1A 3MGJA 1MMDA 1D0EA 4YY3J 2M52A 3SV3A 3TANA 2YNFA 1AFJA 4ES2A 2DTJA 2KL8A 2MKIA 3F73A 2AYBA 5HMYA 4BCAA 2CJKA 3H2UB 3FNNA 4OZ1A 4LFBF 1KRPA 5DGBA 1GK8A 1KDNA 3VLXA 4GO5X 3ONQA 3ZTSA 4Y34A 1RWWB 2VL1A 4I56A 2IDEA 4ICLB 3TJ9A 4GEPA 1X9MA 2GEPA 4UQGA 4Q7AA 1AW0A 4OMFG 2OPPB 2D1CA 3BSCA 3RR7A 4P9SA 2A18A 1YK9A 1TR0A 2CPZA 5LMUJ 3KK1A 2BKNA 3NGTA 4DSEA 1PCAA 1HWUA 1EX8A 1YJNS 4Q0BA 2UUWA 1MSWD 4TKTA 2R7UA 3UQSA 4M94A 2HFUA 4DV2J 4DBQA 4WFXA 3O2IA 2ZM6J 1TK0A 1Z2ZA 3CUNA 1D9AA 4DR2F 1M5PC 3EGNA 5BXIA 3CEDA 5D78A 1X4FA 3GCWP 3VKQA 4IRDA 1U1OA 4P74A 4ETZA 5LT5A 4X4SA 2W7OA 4RNOA 3J7A1 3IO1A 1REGX 4DUTA 3R5AA 5B7WA 4V19X 1U8SA 4ED6A 4DV4J 3W64A 2U2FA 3CCWA 1PC5A 2NUHA 1VBXA 2NXUA 1N5VA 5LL6d 1HFEL 4AE5A 5KFVA 1FDDA 2ZVSA 2P9GA 3PIPQ 2ZVIA 3AOBA 2W9BA 3DYAB 1C0TA 4FF4A 1XTZA 1S1UB 3NNCA 3K5LA 1NK9A 3IA0A 2DK2A 2VPZB 3QO9B 2DGQA 4S3EA 4O4RA 3VTIA 3VAFA 4ECXA 4UZCA 3KLEB 2JOQA 2CJXB 3WHIA 3IG1B 1TMJA 2C1EB 3VLZA 5KAKA 3VKRA 5BJRA 2CPHA 1Q1KA 1L3VA 1ZA1B 4CLLA 3R9LA 1LWCB 4IOBA 2I0XA 1JLFA 1RDRA 1SUQA 4TNOA 1YJWS 4J9QA 4NE9C 5ETKA 2LXUA 3RUBL 2ADCA 3SQOP 2R3VA 2OPSA 2ZHOA 4FYXB 5DQGA 4LIWA 4FBUA 3DI6B 4JI7F 3FBFA 2XHCA 3H42A 1QLNA 2F4VF 5AXKA 1S99A 1VQ7S 2H3EB 4NI2B 2Y1IA 3CC4S 4LQ3A 1HHTP 1M1KT 3W9JA 2YY3A 1DTQB 1ZPWX 3EXYA 2X1BA 2YNFB 1SKSA 4J9PA 4RJVA 2RQCA 3P8BB 3BSNA 3EXCX 3ZFVA 2M0GB 4USWA 4F02A 2XLKA 4DUZJ 3VM0A 4DI6A 2VDIA 1T03B 3T3FA 5IC6B 1OWXA 3W3SA 3GJRB 1OQ6A 3IP0A 3PX4A 4F36A 2MSSA 5DDRC 1GT8A 1L3SA 2AGPA 2GFFA 2DCLA 1S7HA 2V4RA 1U1QA 4CLZA 3M8WA 2VICA 2HZVA 5C25B 5A8WB 2AGOA 5IZHA 1S1XA 2V8VA 5AJ3F 3ZXWA 1YJUA 4O44B 5EX0A 3BF4A 1JLBA 2QV6A 2VQEF 4DL7A 4QQBA 1S79A 3VHQA 3RB4A 3CCVS 3OL8A 3K8VA 2H9ZA 3R5CA 4ZCKA 3BDEA 4LQ9A 1WC1A 4LMZA 3BQ0A 4LFBJ 2H4YB 1RT2A 4C8ZA 5F3TA 8AT1B 3P4UB 2F8HA 2XM3A 2M2BA 3MM9A 4KHMA 3R7BB 2FTRA 3IS9A 4DFPA 3E01A 3GV7B 2W9BB 3BSAA 3EGVA 1RTHB 3OT9A 3BYPA 3EPGA 1JLCA 4P73A 3TA0A 3N5FA 1TL1A 2BJ3A 2WVBA 4KKOA 4QJVA 4CNZA 4J9NA 2N4CA 2LEBA 5HQLA 1APSA 4M5KA 3DDNA 4USUA 1X4HA 1IBCB 4RNFA 1SC3B 1R0CB 4GO7X 2G1HA 4NZ7A 1HNIA 3I5AA 1PAEX 4OIXA 1EAYC 2EC0A 1BWEA 2BV3A 4QWDA 3V5RA 2JEFA 1SC4B 4HL9A 4KB7A 1WF2A 3O44A 1FWKA 3G6ES 5ETVA 4TYAA 4WF9Q 3GR1A 2DHSA 4PWUA 3KG1A 4GVBB 1FX2A 1QSSA 3OFFA 5T7LB 4WK3A 2QA1A 2YWKA 1IKXA 4O0IA 4EI2A 4DR6F 1VRTB 1NK0A 1FRLA 1HNWJ 3LOUA 1S9FA 2QLJB 1WOOA 3M6WA 2IY5B 1FEEA 4LSLB 3SFGA 3QZ7A 2AYEA 1SH0A 3LGHA 3W9IA 4C9DA 2ZJRQ 2LDYA 4ZVRB 5A8KB 1TFYA 1LFWA 2YWHA 4R25A 3HZGA 2KFNA 4URGA 2QMWA 4KGVB 1NLKL 1S59A 2DGSA 1SKWA 3TUJC 5D4PA 4G39A 5J1NA 5FDLA 4P7TA 2EBEA 2ATLA 1C1CA 2VFUA 3CCRS 3EZOA 1GTEA 5HVGA 2J5AA 2R2UA 4JI7J 4IG3B 2OSRA 2F4VJ 4I69A 7GEPA 3K5NA 2HQ3A 4JI5F 5KFDA 3PRVA 5BR8F 3BZQA 2XMKA 2CWKA 3IM9A 4ED5A 2MSTA 4OYPA 4MK8A 2KG1A 4DL5A 2DRBA 4FKXA 3T1HF 1RT2B 4HH1A 3BR8A 2QTWA 1TL3A 3MI7X 3ENQA 2ZD1A 2RRAA 4IDKB 2ACYA 2HBQB 3H8YA 4TQRA 4P10A 2QE5A 5J2NB 2K1RA 1PBAA 2IM3A 2GZOA 4MTPA 2WTFA 3E01B 1SV5A 3QGIA 2ZJPQ 3N6MA 3D66A 1KHVA 2Q43A 4KT0C 2RDJA 4S3AA 2VQFF 2EFVA 1TL1B 3C16A 4KKOB 4JOUA 1SQFA 2YNHB 1JLGA 1IKWA 1F9HA 3E3XA 5AJ3J 1DARA 4KGKA 4CLPA 1S9GA 4RL1A 1CC7A 4FXWA 4N76A 3K57A 2VG7B 3PEJA 3R27A 2BMBA 2VQEJ 3OVBA 1G1XA 2J8SA 2XWYA 1V9OA 5ETPA 3M9NB 3CO9A 3HHDA 3PX6A 5C24B 2VJUA 4F3QA 4X62J 5KG7A 4OI4A 5KFMA 1Q8BA 2X1FA 2JLFA 1YITS 5HL7Q 1PSDA 3KHHA 2CQ2A 3BPDA 5C2CA 1PAUB 1SC6A 4Y3CA 1SH2A 2X51A 3M8RA 1GXLA 4WP8A 4AOPA 5H9FJ 2OSQA 4MIAA 3G71S 4NLTA 3CT9A 4J7CA 4OI6A 3TJAA 1RHRB 2ZBIA 4H4KC 1VQKS 2YNIB 5CYMA 4Y2IA 2N3OA 1YG0A 4RWWA 4NZ0A 4RUHA 3HFKA 5DJBA 3MEDA 2XMAA 5A0YA 2OIHA 2NQPA 4K5RA 3KJVB 1WEYA 4O0NA 2D74B 3M8YA 2FHKA 4OZ0A 1Q81T 2O5DA 1RKJA 2GQQA 8ATCB 4L74A 2ZDPA 2UV8A 4OYMA 2KZZA 2IM1A 5HQMA 2HG4A 4PAAA 3QJPA 1HNVB 3MMBB 5FDLB 2ALYB 4EUVA 2Y0FA 1YDLA 2X1GA 5KFOA 4FXVA 5CHCB 2YX4A 3LA0A 1T9WA 1Q8LA 1TKTB 1S6PB 3G8TA 4ANDA 3KJQB 2V8GA 4N8NA 2DGVA 1X5PA 1C4AA 4ZA1A 1TELA 1NRKA 2AT1B 1BLUA 5FLXU 1YJ7A 2DH8A 2P9EA 2Z8QA 4TY9A 4DN0A 1MG7A 2LA4A 3R97A 3ZZUA 4DUYF 4AYBD 2JJ4D 1TL5A 1KR4A 2DISA 3P5TL 3U1NA 4YHHJ 1JX4A 1KLMA 1NDPA 1SI9A 2DH7A 3E8OA 1RHJB 2KHDA 3FBEA 1CULB 5CYJA 1QSYA 3H5XA 3OR2B 2FHOB 3JSBA 1P1TA 2HQFA 1SV5B 3H59A 1OQ3A 2NXCA 4P72A 1BQNA 4K2XA 4K4VA 2XZWA 5LXYA 1RHMB 3M6UA 2FJVA 1AZSA 4PPDA 1A6LA 3BBBA 2DR7A 3QFHA 1EP4B 1RAFB 2R8JA 4ZDNA 1JNRB 2K8GA 4OJ1A 4K8RA 3C3LA 3DLEB 4OLOA 4GKKF 3R7SB 2JC1A 4QIWD 1KKHA 2VZ9A 1EETA 1SKRA 4JI5J 2BW7A 2IVMA 5BR8J 4MMOA 2XY7A 4DLGA 4L72B 2QL5B 4ANEA 3HK2A 1FVSA 1D9DA 3QBCA 2ZH4A 2OTLS 2CADA 2JWNA 5L39A 2KRRA 2M9KA 2M8DB 2Q66A 4UUWA 4H4OA 2F40A 2QRRA 5J2PA 4GVLA 1LV5A 2AQ4A 3NGUA 1D09B 3CDEA 1F3FA 3I0RB 4USVA 3IR7B 2RS2A 2Z2LA 4DHVA 5E3RA 4ECZA 1S76D 2G13A 3GV8B 2UZAA 4PUOA 5F9NA 2NYIA 4F2RA 4HHJA 2PEHA 2GMHA 2VQFJ 1REVA 3GG0A 5EWFA 4J9UE 1D1UA 5HLFB 1VCTA 4TU8A 2DITA 1XIQA 5F3ZA 2M88A 5KFPA 3KTQA 1FNXH 4KPYA 3OTOJ 2WSFC 5KG0A 1C1BB 2KM8C 4X65F 2HGMA 2UV8G 3TVZA 1S1VA 4CLFA 2DO0A 2X3DA 4WXOA 4EZ9A 4WJBA 5K8PA 3QRQA 2YKQA 2KG0A 4UQTA 2LFVA 1WKLA 1ZPVA 3AOPA 1XBWA 3TAMA 5CH7B 3ZZRA 1HQ2A 2R9LA 1V5IB 1H6KX 2B5JA 2Y0BB 1H98A 2AKWB 5A8RB 2VU5A 4LFCF 5M2UA 2DRAA 1F9FA 5DG7A 3OD2A 3I5BA 1KC8T 2IA6A 2IRUA 2CJQA 3QRPA 3FQKA 1B0VA 3GLJA 4CRJA 2UXCJ 3T5LA 3ET6A 2MKKA 4OHXA 3S8SA 1EKSA 4L3NA 3OL7A 2YQ1A 2DNMA 2W4DA 2RKIA 5A2QY 4WIIA 4YS2A 2F65A 2XLIA 4DQIA 2R7VA 5HBMB 4N5SA 2IAJB 4OHWA 1SH3A 3O5TB 2HVIA 2O67A 4IFVA 1QAXA 3V4IB 2YKNA 1VK3A 2DGWA 2DR8A 2XTJP 3GONA 2QT7A 3UD5A 1RLCL 1JLEB 4RUAA 4V19J 1N36F 1RWMB 3D1HA 4FF1A 3CMAS 1EJ7L 2B4OA 3RB0A 1HI0P 3SDEA 1WDDA 2IC3B 1VQPS 3IWXA 2BJ1A 1F1BB 5CYQA 3A1YG 1VQMS 4DUYJ 1WD6A 4WZQA 2B4VA 2B43A 5L1LA 4CH1A 3I9V9 3BPSP 3BGFA 4HT7A 1GH8A 2HZAA 3NEKA 4U7UD 4C8MA 4S3CA 4F0KA 4Q5VA 5DDOC 2F7VA 3MAAA 4G1QB 2PIIA 3K17A 2A3JA 2UU9F 4K4WA 4YR0A 3N0VA 4G9PA 4EMDA 2QLWA 1AFIA 1FX4A 4DZ6A 5KFGA 2Y1JA 3HD1A 3EZUA 2JVOA 3OJSA 4DFJA 2FPHX 2DNLA 2ABYA 4ZMMA 4EGLA 1HBUB 1RWPB 4GKKJ 2DEJA 4IR1A 2QLXA 4W92B 1PO6A 1S1VB 3W5XA 1D8ZA 1HMVA 5GEPA 3OXGA 3UDVA 1DFDA 2GGPA 1ZM2A 1ZS6A 1R6YA 1IWGA 4J9MA 3IR5B 1NBEB 2OEKA 1Q7LB 2JNJA 1VIOA 2ZHBA 4C48A 4DQSA 2RS8A 4PABA 2P5VA 3DLKA 1R7IA 5GAHU 1VQSA 4FBTA 1LWXA 3GB0A 2CNKB 3DU6A 4A8FA 2DR5A 4HH0A 4ILRA 3SSQA 5GAEU 2CNNB 1UFLA 2NCKL 5GVQA 3P3DA 1NB7A 1Z4UA 3QSYB 3CJ8A 5L46A 3NOCA 3NNHA 2U1AA 4YDDB 4KO0B 2DNZA 4KV8B 3TZXA 3MEGB 2WOMA 4ITSA 4DX8H 2B6AA 2Q6CA 3Q24A 5HANA 3LTOA 3VZHA 2WONA 3M1VA 1OSDA 1TP7A 4B08A 4WU3A 1VLOA 5A6PA 4E0DA 2RKIB 3R2DJ 4X65J 2W4PA 4P6QA 1HNXJ 1X4CA 2AZ3A 2F9JA 2QYGA 5KFFA 7FD1A 5LJ3Y 4ZPWR 4QWAA 3GFZA 1TFWA 2PGCA 5HMZA 3KUHA 5C7PA 1FRHA 2I5JB 2HKEA 2LDIA 1LK5A 2Z57B 1IBLF 2B9XA 1I6JA 1WC0A 2ZBRA 1FESA 3QQCD 3JSYA 3TQEA 1E6VB 2HVZA 4LF8J 2C2ZB 2MHEA 2YQ3A 4LFCJ 3O1LA 4U8VA 3GJTB 4LF1A 3K89A 2ZBQA 3U1MA 3I56S 1UKUA 5F0WA 5KFQA 1F2HA 5F41A 5CYQB 3CMQA 2CNOB 1S6QA 1VBYA 1S4FA 3B0HA 3FVYA 2X3GA 3BV8A 2XNQA 4WZMA 1IBMF 3B8HA 2V2KA 4F67A 4X66F 1SXLA 1X4GA 1J5OB 4NMLA 1VRUA 3VGVA 1U25A 3CCTA 1RAJA 5K20B 3VAGA 3G6VA 1Q0NA 3M30B 2UVVA 4ILLA 1CJUB 1H2VZ 1M5VC 4JI1F 2UXDF 4R5PB 4DL0C 3ZTPA 3FEYB 3MEEA 2BXJA 1HYSB 1FCAA 1JLAB 3I31A 4OFZA 2BBEA 3S6EA 1S1WA 3W2VA 4JI2J 4DMZA 4YB6A 3FCHA 1CPZA 3IM8A 3WQPA 4G38A 1Y11A 4IUFA 1I5OB 2NXNA 1ZM9A 2XLJA 3UNGC 1ROFA 1RT5B 1KQSR 4O4GB 4EBEA 1OO0B 3DLKB 3C8YA 1GXTA 1P9QC 3WC0A 4KGMA 3GSDA 3EM1A 2NXEA 1C0UA 2F3JA 1ZOTA 2FVSA 3MPWA 5AOPA 4ECTA 2DGOA 2OELA 3OPKA 1HNZF 3UNYA 2UU9J 2N7CA 3OJUA 2W8LA 1DQ8A 1W26A 2XYPB 3KMSA 3H90A 1T3NA 1RZMA 1FE4A 1U45A 2DH9A 4DDFA 1VQYA 5ETOA 4HT5A 3C14B 4ZVPB 2QN6B 2AJFE 2WONB 1PYOB 1YBAA 1IKVB 5JUMA 3MOZA 1GX5A 3G9CA 4NLYA 1WOPA 3IAM9 2ZFHA 1JJ4A 4PQUA 1L3UA 2MB0B 2GQ2A 2FDNA 3DRSA 2HVHA 2XY6A 4CO2A 5KG6A 3VVTA 3QT7A 1WHWA 4RNHA 3P6YC 5AE3A 4YUDA 1RADB 3H7HB 3M6XA 2DEIA 1SL2A 1FKPB 3OR1B 2VONA 2E44A 1HA1A 2CA9A 3HKZD 4F2SA 4FVCA 4PXDA 4PEOA 2NPFA 2BQUA 2QJ3A 3F41A 3AA8A 1S6QB 2FB0A 4PG5A 1B0TA 3A3NB 2FIUA 1AYEA 1YI2S 2MQOA 4A46A 5U47A 4HDGA 2GMJA 1RACB 4Z7CA 4IKAA 4DV7F 3HHLB 4QOTA 1HQUA 1M90T 3M05A 1SJ4P 4C4WA 3DRPA 2PFDA 5KFBA 3KHGA 1K9MT 1M0SA 4Y28C 4ELTA 4IH7A 2J0WA 3MCNA 1UFKA 3D68A 4QR2A 3M2VA 3MR7A 1YGYA 4LSNB 2UP1A 3MMAA 1GNKA 4XTTA 3FJ2A 4C8YA 1HBOA 1PYSB 4ECYA 1S1WB 3HD2A 1RUSA 4YP3A 3HO1A 1S12A 3NLCA 1LQ9A 3TOQA 3IMQJ 4USTA 4M63A 3NCPA 2HPUA 2IVYA 4DR7F 3W7BA 1QM9A 4QYZK 2BQ3A 3UE2A 2WB4A 4DL3A 2VG5B 1IBMJ 2YTCA 3ZTOA 2K3IA 2V5HG 2E5LF 4XO0A 3QIPB 3PIOQ 1NK6A 2NR0A 2QLFB 3LW5C 3W66A 1IR0A 1CJKB 3RBEA 1JJCB 1RB0A 3POTB 4F04B 1Y5NB 5IM0B 1Y9OA 5L9XA 2C2OB 5L1IA 5AE2A 3RTVA 3G82A 1DHMA 1NXIA 2R2SA 1EQ0A 3W8GA 2GC8A 3M9OB 1H0HB 3CCZA 4QIEA 4CT8A 1P1LA 4JI1J 1H2UX 2UXDJ 3QMQA 3FMWA 3D2WA 2XS5A 4BLGA 1R0BG 2VFRA 4C8NA 3V6DB 3KLHB 3I4HX 4DPUA 4F4WA 1ZBTA 4I64A 3MOJB 5BYSA 3ZZOA 1XMOF 4G65A 1IKYA 1WEXA 3MUMP 2RD5C 4OZLA 4OZ5A 2PI4A 4C11A 4DSJA 1FXDA 1UJ5A 3Q8SB 3ZO7A 4DPXA 2J7WA 1DURA 2LU2A 1S57A 3RU0A 3AOAA 1S4EA 1VIXA 4OX8A 2HRYA 1OJ4A 2ZE2A 2ZZMA 3PO5A 3TO8A 4G1PA 1JQGA 1S97A 1EIYB 2D3ZA 2XSJB 2ZBPA 1Y7PA 4BC7A 2M7SA 2YNGA 2ASDA 2FHMA 3SXLA 1KFSA 4A4JA 3DRRA 4HHHA 1S0OA 3A12A 1IJFB 2DVIA 1CBKA 4EZ6A 3MPVA 3VKSA 4CO5A 4UUXA 3JSMA 2V69A 3V81B 1T9YA 4M5LA 4RW8A 2KHCA 3HDSA 4LFAF 1KTVA 4ILMA 3QGPA 4USHA 1WEZA 1ZETA 4YB7A 4RPFA 3ITHB 3DRPB 3JB9k 3QLHB 4R8UB 1KVKA 2CQPA 3RRKA 2LECA 2K7KA 2YKMB 1R31A 3QYYA 3PXGa 2MY7A 3GZ7A 3NWGA 1IQTA 3DGPA 1TKZA 2FJEB 1YQHA 2V63A 3UR3C 1TL4A 3MMAB 2Y9HA 2Z2YB 2FLPA 3CIZA 3T9ZA 1U24A 2D3O1 1NK5A 4WIQA 4U96A 1AUSL 5I42B 2ROEA 1M1GA 2OD6A 3RBZA 4OHYA 2R7TA 4DV1F 2KO1A 1IBKJ 2AX0A 4WE1A 3N6NA 1YJ9S 2HW3A 2J6SA 5GAGU 2BE7D 1VQOS 4ZVFA 2WSCC 5KG1A 4DV7J 3WZ0A 3CW2C 3TR5A 5IT9Y 2FD2A 2GAHC 1NHVA 2W4CA 4BWJA 3UD3P 3TEHB 3FK4A 1RHQB 4MKYA 2KYZA 4DSIA 1VQ9S 2HFVA 4B02A 4FS1A 1IKYB 3EZ5A 1NDCA 3M7VA 1OYEA 1YTYA 1Q8IA 1RT7B 2XMJA 4JI0F 3FSIA 4C11B 3NOYA 3IWLA 3JTPA 5DM6Q 4DR7J 3MMJA 5IFMA 3A3PB 1CS4A 3BGUA 5KFZA 5FLXY 3PFOA 1NJIT 5KOWA 3D4JA 1MROB 2E5LJ 2AU0A 3MUTP 4TU7A 2CZVC 4DPOA 4ZIWA 4LBIA 4LRAA 4H54A 1LW0A 2COLA 2EI5A 3HVTA 2YNGB 2F8EX 4J9RA 4EO6A 2W1BA 3CULA 3AQOA 2ATCB 1CJVA 4S38A 4PG6A 3OFHA 1BWVA 2EFPA 5A6WA 4K50A 1ZA2B 2XQCA 3GP9A 1TVRB 2BJDA 4RW8B 2V67A 2VPWB 4OYOA 1XMOJ 4QBUA 2MZTA 1N4LA 4H4MB 4J91A 5M2RA 2ASJA 1FK9A 4ID5B 1N32F 1ELOA 3MECB 3W63A 4PXCA 5DZ7A 2KT2A 2ZWPA 5L38A 1UA0A 2HHXA 4X84A 1U09A 2WCXA 5D3GB 2HSEB 4D3GA 1TKZB 2BJ9A 2FC9A 2BANB 2J0XA 4RUCA 4M5IA 2J9DE 2CJ9A 1N8RT 1Q7YT 4ZPCA 4U9RA 2BRLA 3JQKA 4Q45A 2H54B 2OP5A 3BKFA 4B3OA 3GIMA 5HSPA 4ECQA 3HVWA 2R8KA 3BBCA 1NM2A 2YWFA 1S9EA 4ZJQA 3FBCA 3I55S 4B9TA 4J9SA 4M95A 2MQLA 1HLWA 4KGZB 1HBMA 3SCLE 3KLVA 2EWHA 4LFAJ 3W60A 3KUEA 5CXTA 4HEA9 2E7VA 2BE2A 2GVDA 3KNGA 4EFAC 2JLGA 1C2PA 4LJMA 1F6TA 5D0EA 1OIAA 2FJDB 3BS9A 3LAKA 4URQU 5CZXA 3HPOA 3DRYA 1KLNA 4I1TA 2EFQA 2ZWOA 2FC8A 5GMDA 2GJIA 3LGMA 3G8QA 4RBVA 2C2EA 5HI7A 1HI1A 2VFSA 3UDLA 2Z2ZA 3TAPA 3QGGA 1MN7A 2AF6A 4K4TA 2ADBA 3C15B 4LRBA 3VV2B 4AXJA 4MKAA 3FZ2A 1VFJA 4RW9B 2KXNB 4DU8A 2LYVA 2XULA 4IRCA 4N77A 3C6UA 4CH7A 1HWJA 4WCEQ 1RTDB 5K14A 3UN5A 3NKYA 4CI0B 4AL5A 2MZJA 2VOOA 3I5CA 4DV1J 4I6AA 2W8KA 2FHJA 3PR5B 5G0RA 1U49A 1T9TA 3BR9A 3JTNA 4QU7A 4HI1A 1LW0B 5DG9A 4RW4A 3FRYA 3BH7B 1ZM4A 2ZH9A 5AE1A 4OHZA 1H38A 3EUNA 1M5HA 3GIIA 4PXEA 1X8DA 2GW8A 2LU1A 2RF2A 1BXNA 1WTFA 2A2CA 2QC3A 2E1MC 4ZP9A 5IWAJ 4ALZA 4OI0A 3M4XA 4NA2A 1RHKB 3O6QA 2JHEA 3ZZ0A 1NEEA 3JQMA 3JXOA 4C0BA 2OUGA 3GE9A 4JI0J 1QSLA 2EXUA 1FK9B 5LSOA 4FF2A 4DSKA 2DPJA 4QW9A 4I67A 1DQAA 1JLQA 1NNDA 2HHSA 1FDAA 1N34J 2P6TA 4ES3A 4OX6A 2C2MB 4Q2MA 2R7WA 1TUWA 2KT3A 3KG0A 2XCPA 5KG5A 2J9CA 2HFNA 1YIJS 1P8GA 5AT1B 5I3UA 4M5JA 4DG1A 5KFKA 3FRZA 3NGKA 1L3TA 4ZCMA 1UW9A 5LXRA 2J7KA 4J9KA 2AEJA 3EGWB 3IRXB 1H2TZ 3LP0A 1XN9A 4AXIA 5KFWA 3N79A 3MM8A 4X64F 2I6WA 5M2PA 1RTJA 4YMEA 1DLOB 1HBMB 4NRUA 5KFLA 3OBIA 1X5SA 1RT4A 1SQGA 1NB2A 1TAQA 3S01A 3EICA 4PYAA 2JLEA 2BE2B 3WX8A 4IO9Q 1ICEB 1OMSA 1N32J 3KG4A 1R0AA 4NLXA 1R89A 5F9LA 3IGVA 2FHJD 1LK7A 2E29A 4B3SF 4FN5A 9RUBA 1DTTA 4LRDA 3M8QA 4C8KA 2H51B 4Y2CA 2B3TB 2BVZA 4Y65A 2ZH8A 1F9EB 2CDRB 2LEPA 4ZCIA 4QWEA 1KQFB 3TZZA 5IXUA 3MCOA 2N7YA 3NBPA 3CNQP 1AUDA 1T11A 4M5DA 1Y5LB 1VS3A 2ZEJA 5DGAA 2CUYA 1ZZNA 3B6BA 3VGUA 2MZRA 2E5HA 2CIMA 5A2QU 1U1MA 3BN4A 3NWRA 3D9BA 2VKZG 4U95A 4Q2LA 2XBPA 3PG9A 3D6FB 3PJ9A 2B7CB 3TZYA 1B64A 1D3WA 3B0LA 4RW4B 3SZ2A 3EE3A 1RT3A 3TQ1A 4B9MA 2ROPA 1VBZA 4IG0A 2KKHA 2HLUA 2IM2A 1YJTA 4Q8EA 2GIRA 1TKXB 5D8HB 1D8YA 3PACA 2W2MP 4F7VA 4OI3A 3TVYA 2XNRA 4K2JA 7AT1B 3SYZA 5HN0A 3OXLA 4F0MA 2ZOGA 1TK5A 3W5ZA 2OPQA 2HYIB 3RB3A 2V8DA 1S48A 4F0HA 3HX9A 3VKTA 1YJRA 1MNEA 2RE1A 1XNQF 2O01C 1HBNB 4OYIA 3NS5A 3TNVA 2BKPA 1RT6A 2ZHAA 2K7JA 2MKYA 4DV5J 1DRZA 3JAMY 3HFVA 1UVKA 1HWLA 2R8IA 1ZJ8A 5IC4B 3I96A 4I68A 5HJYA 3M2RB 4JV5F 1TV6A 3MTKA 4WU2A 5I3UB 2EKYA 2EVZA 1S77D 1UVMA 2YWGA 3KJFB 4OYBA 2PMHA 1N6QA 4DPYA 2DNKA 2BJEA 2BA9A 5EX3A 5IS2A 2WZ1A 1NMEB 4JYAF 3UDCA 1RTJB 4M5NA 5DG8A 1YZ7A 4ZITA 3BGRB 1FD2A 4ZVSB 3J7YI 3BO2A 5JMNA 1VI7A 3AD7C 1X4EA 3AB4B 2NXJA 1RGVA 3HJFA 2MGZA 3DHWC 3P45B 2KVIA 2OPRA 2CJAA 4CM2A 1Q16B 3QT5A 1SQEA 5HQ8A 4S3FA 2MLZA 4O3QA 1ZM3A 4J9VA 5C42A 4PRFA 2JDJA 4NLQA 4DCOB 3GYGA 3HSZA 3A8JA 3MWBA 4IQMA 4I2PB 4A8QA 5F0UA 2YWWA 2BE9B 3UCUP 3DOMB 2IRYA 3ILLA 3HKWA 2F1FA 3K2YA 4IR9A 1XNRF 2LQBA 2FY8A 1T3OA 2RUSA 2CNLB 3K8WA 3KLIA 4X64J 3NAHA 2W2PP 4QIFA 1BUXA 2HZCA 4CTAA 4DFMA 1BQMB 1ZAXA 2J8AA 3EYZA 3HULA 1JKHB 5THWA 2MJNA 4UOFA 4AQYJ 2MZ1A 3NMAA 2V4JA 4O23A 5HVFA 5AXMA 1XJWB 1BE4A 2AZ1A 2PA3A 4ZPTR 5IV3A 4B3SJ 3CPWR 2I38A 4M5MA 1G2EA 1UFWA 2DNOA 2CPFA 3KK2B 5D4NA 3BGOP 3FCVA 4NXNF 2CPXA 1U6BA 2KJVA 2OPQB 4ZS6A 2HFZA 3BO4A 1U02A 1U2RA 3D6HB 4C8LA 3CJKA 2J9DA 1RU1A 2DNPA 3PV8A 1KHWA 3W2WB 2IMOA 4UOHA 3KK3A 1WHXA 3DLGB 5ETLA 3H4BA 3RRHA 5KFAA 2W9CA 3MAHA 3OUYB 1RT6B 1R8AA 4M1KA 1VDHA 4AFFA
chains in the Genus database with same CATH topology
2UXCF 2OMOA 1U26A 3FFIA 2I8EA 2GX8A 3CCLS 2W7AA 3DU6A 4A8FA 4RBUA 4CT9A 4HH0A 2DR5A 3UPFA 4ILRA 3SSQA 4DR5F 3PW4A 2YH1A 5GAEU 4PQUB 4QYRA 1FJGF 4NLOA 1UFLA 1TV6B 2LCWA 2MQQA 1HPZA 4I7FA 5GVQA 4LVNP 3DRSB 1C1BA 3P3DA 1NB7A 1Z4UA 1M5OC 4DN9A 3FZBA 1N5TA 3E2EA 4MH8A 2BZ2A 4OJ3A 3JYTA 2KXHA 1M5SA 4PQAA 3GQCA 3QPIA 3NNHA 3MM6A 2U1AA 4YDDB 1JXEA 3HF5A 1UVIA 4KO0B 2DNZA 1R8CA 4KV8B 3ICLA 4HDHA 3MEGB 2VASA 3C6TA 2CPJA 4WYWA 3BSOA 1RI7A 2L48A 2WOMA 3AB2B 4ITSA 2GJ2A 2CQ3A 1HBNA 4DX8H 1JJ2R 2B6AA 2Q6CA 3N6LA 3Q24A 1ZTTA 1H7WA 2A10A 2YWEA 1N88A 3VZHA 4PCQA 2ZKTA 2O1PA 2WONA 3I82A 1QUVA 3M1VA 5DRKA 1SL1A 2DD8S 1OSDA 3DHXA 3K0JA 1TP7A 1DAXA 2PN6A 2HWTA 4B08A 3H5SA 4WU3A 4DEZA 2J76E 3NS6A 4E0DA 3X3UA 5A6PA 3THVA 3QIDA 2AYGA 3LH2S 4F3OA 2RKIB 3UR0A 3N9UC 2RRNA 2W4PA 4P6QA 3R5DA 1Q78A 3GYNA 4PG4A 2XS2A 5F8HA 4J9OA 5A8RA 2RNEA 2WBRA 3M2RA 5KT7A 2XG8A 3R3TA 3TUZC 1UMJA 1XK8A 2KTQA 5IT4A 5LSRA 1X4CA 2IFXA 2VB6A 2F9JA 5KFFA 2JVRA 7FD1A 3OLAA 1QE1B 2OPRB 5LMUF 5LJ3Y 1HQEB 3ENVA 5KFNA 4ZPWR 5E5NA 3PW2A 4QWAA 2EBGA 1U6FA 3QGHA 3R1HA 1F5BA 4XPEA 5KFIA 3GFZA 1TFWA 2PGCA 1DZ5A 2WW8A 2AW0A 5HMZA 3TA1A 3GYXB 3M6VA 1AOPA 1FRHA 2I5JB 4PG7A 3M8SA 2LDIA 1FKOB 5K5MA 4B17A 1LK5A 4PG8A 1FTRA 1IBLF 2B9XA 1I6JA 2KT5A 3IC1A 5FIIA 1FESA 4ECRA 1S6OA 3JSYA 2CVEA 1HQUB 1E6VB 2HVZA 2MPUA 2XI2A 4NLDA 3HT3A 4A8XA 1SL0A 1UEVA 2XO7A 2A2DA 2MHEA 2YQ3A 2HNYA 2AOPA 1VQ5S 4NYOA 3BGRA 4DV2F 3Q0AA 3AA9A 3PJWA 2LEAA 3O1LA 1XEZA 4ECWA 2MXYA 1QVGR 3WC2A 3KK1B 1HWIA 3I0SA 1CG2A 2FJWA 2E5JA 3U1MA 3I56S 1UKUA 1VQ6S 5F0WA 5KFQA 2ZNYA 4AQYF 5FD1A 4NA1A 5F41A 5HBMA 4ZVGA 2R4FA 2IAJA 2XI3A 4MIBA 2M70A 4Q0BB 1HD0A 4J37A 5CYQB 1RISA 4U67Q 3M2VB 4LF9F 1F5AA 1S6QA 4FXDA 3BREA 1VBYA 1V3ZA 1S4FA 5HP1B 3B0HA 3FVYA 3V4IA 1FF2A 2X3GA 2G4BA 2PC6A 2XNQA 4WZMA 4X4QA 1HBOB 1O51A 2GNKA 2R7OA 3B8HA 4OV1A 1IBMF 2V2KA 1VQ4S 4F67A 4ZP6A 1K1SA 1JLEA 4DSFA 4F4ZA 4X66F 4UOCA 4DV4F 3HLUA 3BEGB 1SXLA 1X4GA 1J5OB 2MZSA 5LSLA 4QZVB 4NMLA 1VRUA 2K2PA 2QA4G 2KDOA 3QJJA 2QO3A 1U1KA 2VFVA 2W25A 4I2PA 2VG6A 1TUVA 3KLFA 3KNAA 1AROP 1U25A 3ETOA 3CCTA 3CJ5A 5KFHA 2DO4A 3MR3A 1RAJA 3LANA 2FLLA 3H40A 4C0HA 3L3CA 4PWDA 5I3QA 1WF1A 1NKEA 3VAGA 4BDPA 1K1QA 3G6VA 3TARA 3DOMA 2IC3A 2ZBCA 4DS5A 3PW5A 3CWJA 3IFEA 1S10A 1CQMA 4CH0S 3VALA 2VBWA 3ZZZA 3VAKA 3M30B 2UVVA 5CD4H 4ILLA 1RJJA 3MZIA 3B82A 1H2VZ 2UUTA 4H4KA 1M5VC 4JI1F 2UXDF 1FNOA 2HNZA 3M8PA 1HARA 3LF0A 2FJXA 5J1EA 3OFGA 5BYRA 1I1GA 5F8GA 1RA6A 1KQGB 4DL0C 4R5PB 3FEYB 3MEEA 2KH9A 3GR0A 1QJHA 1CC8A 4X4TA 2BXJA 2HS0A 4XPCA 1HYSB 1FCAA 1JLAB 2GO9A 2FVCA 2OO4A 4K0KF 3I31A 4OFZA 1NU4A 3K59A 4ZP7A 3O8WA 2OMLA 2MJUA 3T5JA 2BBEA 3SEOA 5GMKa 3S6EA 1S1WA 4ELVA 3OSNA 3W2VA 1Y3JA 5CCLA 2JEGA 1URNA 4B9VA 4HKQA 2ASYA 1BQMA 2V8HA 2HHUA 2IJFA 5J2MB 1FO1A 1NH7A 1C0TB 4DMZA 3H5UA 4KQZA 5HROA 1K0TA 3N01A 4YB6A 1JKHA 1SJ3P 3FCHA 1CPZA 3R1LA 3NNAA 4ECVA 2AV5A 4B9LA 3QZ8A 4G38A 1HWKA 4X2BA 2DB1A 1H7XA 2E5IA 2MDAA 4IUFA 4G1QA 2ZH5A 1ZM9A 4K4ZA 3T9NA 2XLJA 3UNGC 3MUVP 1VC5A 1ROFA 1Z2LA 4IFYB 4YFUA 4DF4A 1S0VA 2HNDB 6FDRA 1RTIB 2I2YA 1RT5B 1KQSR 4O4GB 4EEYA 4EBEA 1OO0B 3ZZYA 4KRWA 4D3HA 1LFPA 3D1OA 4R0EA 1YJVA 3DLKB 3C8YA 1GXTA 3WDOA 1P9QC 2MHNA 2AJ4A 3WC0A 4KGMA 4NPOA 3GSDA 3HHKA 4BWMA 3T1YF 1C0UA 2JC0A 4ECUA 5KT3A 3CJ4A 2DHXA 2F3JA 3FQLA 1VHFA 1ZOTA 3FFIB 3MPWA 4WK1A 4A47A 4A8OA 4DS4A 2FVSA 5AOPA 2AGQA 4ECTA 2C3OA 1G3OA 4EU0A 1JIHA 2JX2A 3KK2A 3VQSA 1TKDA 5E3AA 4B9UA 1YRUA 2YKAA 2DGOA 4KHPF 4NCBA 3OPKA 5E7OB 1HBUA 5GAHI 1HNZF 3G6XA 2IMWP 2LXFA 1HPZB 4ZPAA 1NZAA 3PVXA 3AJ1A 5JXSA 2OAUA 2MKJA 5K8NA 1JLFB 1OPIA 3DYAA 1UWBA 4MFBB 2N7CA 3OJUA 2W8LA 3NCQA 3VAIA 1SUQB 4K59A 1HNXF 3B78A 1DQ8A 1SJRA 4PR6A 2VODA 4ID8A 2NPIA 2V94A 1BC6A 3C46A 5GAEI 2RQKA 1XR7A 3MM6B 4URSA 2EFOA 3KMSA 2FVQA 2PI5A 2V9KA 4RZRA 6FD1A 3W2WA 3CB4A 1UJ4A 5EWEA 1T3NA 3DLGA 4ES1A 2NLWA 1ZYQA 2DIUA 2OPSB 2VPXB 1FE4A 1VK8A 2DIVA 1JK9B 2RSQA 2ZE2B 3AJ2A 3PNIA 2DH9A 4DDFA 4ED0A 3H2LA 1U45A 1VQYA 4LIRA 4HT5A 3OUYA 4N8OA 2MQPA 3KLEA 1TK8A 4DUZF 3B0JA 4S23A 2AJFE 2WONB 1YBAA 1Z1ZA 2QZ8A 1IKVB 1QTMA 2DNNA 4EBCA 3OL6A 5JUMA 1WG1A 3MOZA 1UVLA 5KFUA 1W2IA 2XMTA 1X4AA 1GX5A 2XHWA 2P6SA 4NLYA 1VQ8S 3IAM9 3G9CA 5DDQC 2VOPA 4NXMF 5D4LA 2ZFHA 2NZ4A 1C4CA 3O3LA 1JJ4A 4GC7A 2R2RA 3OLBA 2OH2A 3DRRB 4LF8F 2VC1A 3PKYA 1WF0A 2BDPA 4PQUA 1L3UA 3VR1A 3B0NA 1F5CA 1CLFA 4ERDA 2BRKA 4NX9A 2MB0B 1LOUA 3DOLB 2GQ2A 2FDNA 2WK4A 3DRSA 1IM4A 4RW7A 2BQRA 1Q79A 2HVHA 2XY6A 1UW4A 3J80Y 2JL9A 1LW2A 4CO2A 5KG6A 3EPIA 3LGNA 5JVHQ 4G6VB 4Y00A 2YX7A 3M32A 3PW0A 5KT5A 3JSMB 1WHWA 4RNHA 4KO0A 4KV8A 2XWXA 3P6YC 5AE3A 3MEGA 1Q82T 3G8SA 2RDIA 2H5EA 2CPYA 4YUDA 2BW2A 2J0QD 3OXFA 3NCRA 4L6V3 3M6XA 3CCMS 1SL2A 2DPIA 1KONA 3UWTA 1A7GE 4DV6F 1Y0HA 2PMZD 3DI6A 3TRGA 5JJBA 3PJXA 1NAQA 3BGLA 1FKPB 4F25A 4F4XA 3OR1B 1D9FA 2FVRA 2UVUA 2VONA 2E44A 1HA1A 2ILYA 4OI1A 2QSWA 3PRDA 3N4WA 3MGJA 1MMDA 2HHQA 1D0EA 3HKZD 5L8RC 1HR0F 3I0SB 2NSCA 2M52A 1WWHA 3SV3A 3TANA 2ZH3A 4F2SA 1JNZB 2YNFA 4FVCA 3HP6A 1AFJA 4ES2A 4PXDA 2NPFA 2DNQA 2DTJA 3VCDA 4FNIA 5ADZA 2R7QA 2BQUA 3L7OA 2MKIA 3F73A 2AYBA 3F41A 5HMYA 3MM7A 4ZVEA 4BCAA 1QE1A 3H2UB 2CJKA 3PX0A 2XY5A 1HQEA 3CSKA 1S1XB 3FNNA 2ZUGA 3AA8A 1LXJA 2EFGA 1GTHA 1S6QB 2RVJA 4USJC 1T05A 4OZ1A 2PT0A 4NLVA 1KQKA 4LFBF 4ED3A 5DGBA 1DJ0A 1KRPA 2E66A 3IGNA 5L1JA 3UI3A 3VLXA 2FB0A 4GO5X 3KFWX 3ONQA 4C3MA 4PG5A 1XMBA 4DR3F 1B0TA 2I5JA 4Y34A 2VL1A 3IBWA 1JLBB 2FIUA 1NKBA 2EG2A 4I56A 1FKOA 2MQOA 1YI2S 4A46A 5U47A 4ICLB 1FRKA 4MYUA 4DJBA 4GEPA 1KN6A 4HDGA 2GMJA 3DLLQ 2GV1A 1X9MA 2HGLA 4UQGA 2GEPA 5I4MA 4X4NA 4Q7AA 1AW0A 1ZTWA 4OMFG 5C5JA 4IKAA 3MURP 2XSFA 2OPPB 2D1CA 3BSCA 4DV7F 2UUAF 3RR7A 3HHLB 4QOTA 4ZK7M 2A18A 1HQUA 1E6VA 2RT3A 2B0GA 1YVFA 3M05A 1SJ4P 1M90T 4LF4F 3UFCX 3C2PA 1UEUA 4C4WA 3DRPA 2Q79A 4U7UK 1TR0A 4JI2F 5F8LA 2Z0GA 2CPZA 5KFBA 3KHGA 1K9MT 3KK1A 1M0SA 4Y28C 4ELTA 3OV7A 2N4DA 3H5YA 2CG4A 4IH7A 3T5KA 2J0WA 4DSEA 4N56A 1KD1T 2R2TA 2RQMA 2FGOA 1HWUA 2CQ0A 3LP1A 2XGQA 1YJNS 3DLJA 4Q0BA 4WE1B 4DV0F 2UUWA 2HNZB 1MSWD 5B0AA 4QR2A 5J1EB 3M2VA 4KBIA 1YGYA 2Y0SD 4LSNB 1JB0C 2F9DA 4TKTA 2UP1A 2R7UA 3MMAA 4P7VA 1GNKA 3MM9B 1MMNA 3UQSA 3FJ2A 4C8YA 1HBOA 3DOKA 3Q8QB 4ECYA 3IS9B 1S1WB 4M94A 1J5OA 4YP3A 3HO1A 4WTYA 3NLCA 4QIGA 4C7QA 2V9WA 1K0VA 1RWUA 1LQ9A 4WFXA 3TOQA 4DBQA 1JLCB 3O2IA 1TK0A 1Z2ZA 3CUNA 1D9AA 4DR2F 4JUZA 1M5PC 3LO3A 3EGNA 1GX6A 3FGVA 3CEDA 4M63A 3SQGA 3I6PA 5D78A 4OI2A 3NCPA 1X4FA 2HPUA 3MM5A 3UCZP 4LF6F 2IVYA 4DR7F 3W7BA 1QM9A 3VKQA 2IRXA 2K3KA 4IRDA 1U1OA 2BQ3A 2C3YA 3K5OA 2B9YA 2EK1A 4ETZA 2KJWA 3M30A 3UE2A 5LT5A 2WB4A 4X4SA 2VV5A 2W7OA 3MEKA 4RNOA 4DL3A 3J7A1 3IO1A 1WACA 1WI6A 2VG5B 1R27B 2YTCA 2K3IA 3R5AA 1U47A 5B7WA 1SBRA 3I4PA 2CPDA 2V5HG 3MR2A 4HVZA 4V19X 2E5LF 1U8SA 4XO0A 4ED6A 2U2FA 3QIPB 3PIOQ 1NK6A 2NR0A 3LW5C 3VZIA 5KT4A 4R5PA 3MAQA 4FS2A 1IR0A 3CCWA 3RBEA 4X4VA 3POTB 1I94F 2ZC3A 1Y5NB 5IM0B 1Y9OA 1PC5A 1HYSA 1JLAA 2NUHA 5L9XA 1B7FA 1VBXA 2NXUA 4NLSA 5E33A 5L1IA 4DQPA 5AE2A 1N5VA 5LL6d 3RTVA 1HFEL 4AE5A 5KFVA 1FDDA 1HNIB 2ZVSA