3OR2A

Crystal structure of dissimilatory sulfite reductase ii (dsrii)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
435
structure length
435
Chain Sequence
KHPTPMLDELEKGPWPSFVSDIKQECDNRAKNPKGLDYQIPAECPDDLLGILELSFHEGETHWKHGGIVGVFGYGGGVIGRYCDQPEMFPGVAHFHTVRLAQPAAKYYTAEYLEAICDVWDLRGSGLTNMHGSTGDIVLLGTQTPQLEEIFFEMTHNLNTDLGGSGSNLRTPESCLGISRCEFACYDTQLMCYQLTQDYQDELHRPAFPYKFKFKFDGCPNGCVASMARSDFAVIGTWKDDIKIDQEAVKAYVGGEFKPNAGAHAGRDWGKFDIEAEVVGLCPTGCMTYESGTLSIDNKNCTRCMHCINTMPRALKIGDERGASILVGAKAPVLDGAQMGSLLIPFIAAEEPFDEVKEVIENIWEWWMEEGKNRERLGETMKRVGFQKLLEVTGTKAVPQHVSEPRHNPYIFFKEEEVPGGWSRDISDYRKRHMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Sulfite redcutase subunit alpha
publication title Dissimilatory Sulfite Reductase, Sulfate Reduction
rcsb
total genus 122
structure length 435
sequence length 435
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01077 NIR_SIR Nitrite and sulphite reductase 4Fe-4S domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3or2A04
3.30.70.2500 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3or2A02
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 3or2A03
4AOPA 1RGVA 4Y28C 4S3CA 1IR0A 1AXQA 1F5BA 1VJWA 2AOPA 7GEPA 3C8YA 4S3AA 3LW5C 2VPWB 1H7XA 1D3WA 3MMBA 4HTRA 2C3PA 2WB1D 5E7OB 3MM8B 3MM6A 2FJEB 3EGWB 3VKPA 1Q16B 3IR6B 1JNRB 1KQFB 2VPYB 1F2GA 4G39A 1FRMA 1XERA 1CLFA 4S3BA 2VKRA 4XDCA 1C4AA 1GTEA 1BLUA 3B0GA 4G9PA 2Y0SD 4L6V3 1PC5A 1FRHA 3HKZD 3MM5A 4S3DA 1FDBA 3OR2A 2PMZD 1FXRA 2V4JA 1FRKA 2C3OA 1SIWB 3VKTA 2FJDB 3MM7B 3MMCA 1KQGB 5CH7B 3OR1B 4CI0B 1F5CA 4YDDB 1AOPA 5CHCB 2FD2A 3EXYA 5BYSA 3B0JA 2GMJA 1DFDA 1G3OA 7FD1A 3MM9B 2FJAB 5FD1A 1K0TA 2AKJA 1FDDA 1FRLA 2Z8QA 7FDRA 3MMAB 3EUNA 1FDAA 1Y4ZB 6FDRA 4DHVA 4XDDA 1H98A 1DAXA 2GEPA 1GAOA 2XSJB 2IVFB 4ID8A 3B0LA 4OV1A 4G38A 2WSCC 3MM8A 1ZJ8A 3IR5B 1BD6A 3AOPA 4RKUC 4AYBD 2FJBB 5L8RC 1SJ1A 4S38A 6FD1A 1R27B 3VM1A 1B0VA 1PC4A 2ZVSA 1DURA 4OMFG 2UZAA 2Y0FA 1ROFA 3B0MA 2FGOA 2VPZB 5AOPA 3GYXB 2PDAA 1BQXA 3MM7A 5GEPA 1FRIA 1WTFA 2WAQD 2WSFC 3OR1A 3B0HA 3B0NA 3VLXA 4S23A 2C3UA 3VKSA 1GT8A 3MMBB 2C42A 1FCAA 2FDNA 1G6BA 1JB0C 2O01C 2C3MA 1FD2A 3MM6B 3VKQA 1A6LA 3MM9A 1B0TA 1Y5IB 1FRJA 1GTHA 4S3FA 1Y5LB 1C4CA 1H7WA 2V2KA 3MMAA 5BYQA 4XK8C 1ZJ9A 4GEPA 6GEPA 8GEPA 2VPXB 1KEKA 1FERA 1B0PA 3MM5B 3GEOA 4KT0C 1BC6A 2PA8D 2XSJA 1JNZB 1FDNA 3OR2B 2V4JB 3PNIA 3VLYA 1FF2A 4S39A 1SIZA 1BWEA 3MMCB 1HFEL 2WSEC 1H0HB 3IR7B 1FTCA 4S3EA 2C3YA 5BYRA 2GMHA 3VM0A 1FRXA 1FEHA 3NOYA 3VLZA 3VKRA 1Y5NB 1IQZA 1FXDA
chains in the Genus database with same CATH superfamily
1RT6A 3F41A 3DRYA 1RUSA 4Y28C 3NOGA 4Q8FA 3D1QA 3QMQA 1QAXA 1RP5A 3BSAA 3DRRB 4QWCA 1W2IA 2YY3A 5J1EA 3LALA 5U47A 4F7VA 5DRKA 2VFUA 3TJ8A 1CSJA 5CQGA 5LOQA 1TKDA 2GNKA 4MMOA 2FZCB 5EGYA 1VC5A 3HLUA 4HLBA 1HNXF 2P5VA 4O3QA 1WWHA 1EIYB 4JI2J 2YXLA 4FXDA 3BBBA 3ICLA 4LJMA 4B3OB 1YBUA 2KB2A 3NLCA 4FXVA 1N0VC 3BGRB 4RX6A 3MM7A 4F25A 2PEBA 2XBPA 3B0NA 3PHEA 3WIUA 5DG9A 3H5YA 2ZZTA 2EFVA 3TW0A 3MMAA 4CT9A 3GJTB 3OFHA 4QU6A 1YHQS 3Q86A 2MZQA 1UFWA 4U8VA 2PMWA 1IBMF 2RHQB 1T05A 2UVUA 1V3SA 1C1CA 4QJVA 4KKOA 2IM1A 4WU3A 4GKKF 2M0GB 2NXEA 3CSKA 3UDVA 4GVBB 3RBXA 3CNQP 2HHHJ 2QN6B 4ICLB 2YWEA 4ECRA 1FDBA 4RLEA 2HNDA 2W9BA 5ETMA 3SCLE 2MJNA 1UJ5A 1URRA 1Q7LB 4C6AA 3JXOA 1N8RT 1HI8A 3R5DA 5THWA 1VQ5S 3O44A 1KD1T 3BGFA 3HJVA 1RADB 2OPPB 1RB0A 3MM8A 1S57A 4KY3A 5K8OA 1VQLS 3IR5B 4E98A 3H40A 1N33J 3M2VB 3KTQA 2ZVSA 3ENVA 1R8HA 1QSSA 3KJNB 1HBUA 4WE1A 4ZPBA 1V3ZA 1Y5IB 3GE9A 2YKNB 5BJRA 1Y0HA 2J9EA 3KMSA 1O6XA 4MIBA 2NYHA 2MZSA 1HNWF 1BQMB 3VGTA 4TNOA 1ZM9A 3V6DA 2QRRA 4HT7A 2YVSA 1R89A 4RW7A 2HNYB 4CO2A 4DUTA 2AYBA 2YNIA 3UNYA 3L7OA 4DQQA 1S9FA 3PJWA 2VPYB 4PWUA 5HK4A 3G8SA 1VQNS 3AB2B 4H4OA 4H54A 2O66A 4C3MA 3P8BB 4PG5A 4DV1F 3KLIB 4V19J 1CS4A 1K73T 1UVNA 3A4TA 1HNVA 4A8FA 4V1Ak 3TVYA 4UT4A 1ICEB 3DGPB 4KPYA 4JV5J 4LBPA 3O3LA 2DGWA 2ZOFA 3EGVA 2HRYA 2XS2A 2WHOA 4KC5A 2W2PP 2DO4A 4F4WA 2UUTA 2MGZA 4UZCA 4IFYB 4ZDNA 4Y2CA 1SB6A 2LA4A 2CQDA 3VLYA 2XMJA 2RQKA 2AJFE 4PQUB 4F3MA 1QSYA 4AUKA 4PABA 5KG3A 2JVRA 3CMQA 4C2MA 2IA6A 4DN0A 4ZVRB 2UXDJ 3SXLA 4FDFA 2DRDA 3QLHB 4JI5J 2KYXA 1K44A 4G9PA 1AYEA 4A47A 1RWNB 4F0MA 2DNQA 8RUCA 4KGXB 4XIUA 4Q7AA 2KHCA 3DLJA 3QWUA 4DV0F 2R8JA 4LR9A 3CJRA 4J91A 5A6PA 1FDDA 3NCPA 5EWEA 1N5YB 3OXFA 2NZ4A 3AXMA 2AZ1A 1BE4A 1NSKL 4W90B 1VQ7S 3DRXA 2XS5A 3F44A 2GGPA 2AJQA 2A3JA 1UKUA 3SFGA 3RYLA 4AXJA 5ETSA 4NRUA 2RKIB 1UVIA 3VLXA 4QIEA 2DD8S 2XGQA 1REVA 2YKOA 2B9YA 4TYBA 2DK2A 2EFPA 3AOBA 1TFWA 4LSNB 6GEPA 1N32F 4E2FB 2CUYA 3TEGA 2DVIA 1NK6A 5FLXY 5DGBA 2BW2A 1KFDA 2BDPA 2DR6A 3EXCX 3RTVA 1JQGA 1UCNA 4BWJA 5KOWA 2CQ0A 2K7KA 4QCLA 3QNWB 4JBCA 4L6V3 4R25A 3OR2A 1HNXJ 1WHXA 2XC9A 2M9KA 3W5YA 4IRKA 5BYSA 5HROA 3AJ2A 1HPZA 2HVIA 3BBCA 4ANDA 1Q8IA 1SH3A 1FDAA 4I6AA 4RUHA 1YTYA 2ZH6A 2DRAA 4DQPA 1RTHB 3TAMA 4BWMA 5F0UA 3BJYA 1SJ3P 1F3VA 2XZWA 5C24A 3QRPA 1UEKA 4BC7A 2M7SA 1SBRA 3BH7B 4NA1A 2KN4A 1LW2B 4F0HA 2ASLA 3KNAA 1FJ7A 3ZZOA 1ZJ9A 3CWJA 3QT6A 4ILLA 4JI6F 4UOHA 1IKVB 1WDDA 2VUGA 2HFVA 1D8ZA 3ZZ0A 4C11A 1RAAB 1VBZA 4M5IA 2W4CA 3VGSA 4I69A 4LRBA 5F8IA 2Y3YA 2DEJA 3R1HA 2W25A 5HVHA 5F8NA 4WZQA 3BYRA 1VQPS 4C8MA 1FEEA 2OKQA 1N54B 3KHGA 1M5KC 1HD1A 1EP4B 3V4MA 4DR5J 2HZAA 3DI6A 1V5VA 2V8HA 4EBCA 4LF9F 1T02A 2H5EA 5MLCV 2RH3A 1HQUA 1U0SA 1JB0C 3LP0A 2RJZA 4WU2A 2DY9A 4FYWB 1KOHA 1RABB 3K5LA 2F7VA 1R8AA 1S1WB 3ENQA 2OD6A 2IA0A 3UWTA 2V67A 2YNFA 1ZETA 4KHPF 2CVEA 3M7VA 3GCWP 3AA8A 3DM2A 4W4MA 4MYTA 4DDFA 1AFJA 1U2RA 3M9OB 2YKMB 5KT3A 2QYGA 2YNGA 2J6UA 2KFYA 3N01A 2QFJA 3QATA 4GMKA 1JLBB 1RT4B 4ZVTB 3OTOF 2AYGA 3M2UA 4DV5F 2E9TA 4K8RA 1R0BG 3HFVA 2LEAA 5IT4A 4ID8A 2ZBQA 3DMJA 2DIUA 2E5HA 3CCVS 1NJIT 5KG4A 1V6HA 2HFOA 2MQNA 1CJVA 3DOMA 4WFAQ 1RT2A 3R5GA 4FF3A 3BR8A 2YX7A 3FJ2A 4NLUA 2VJUA 2CPEA 3BO2A 3NCRA 3RU0A 3OR1A 2VASA 4TN2A 2R8HA 1RZMA 2IMOA 3UD4P 1RWKB 1TFYA 2EK6A 3JTPA 3J81Y 4X4NA 2LQBA 5HMYA 1LWCA 3R97A 1XJWB 1SL0A 2DIVA 3V81B 1K0VA 4LFBF 2B0GA 4DG1A 2KFNA 2JH3A 4ZN3A 1VJWA 2GIFA 2MSSA 5IT9Y 3NS5A 3AY0A 4D3GA 1QTMA 1O51A 1U1LA 1WEXA 1J5OB 4KSEB 1HMVB 3BQ2A 1DY3A 4RW9B 2D9OA 5DDOC 2I2YA 4LF6F 1J2VA 2G1DA 3CC7S 1WC5A 3GZ7A 3G8QA 1PG5B 3MEEB 3VKTA 4M5DB 5ITHA 5CD4H 1VYAA 2QMXA 4B9TA 1V3RA 2V9KA 4WP8A 2Y1RI 3H2UB 2IRUA 4MK9A 3HP6A 1RAIB 1RAFB 1G1XA 2X3DA 1YX2A 2DNHA 1N5TA 2ZWPA 2R2SA 2OUGA 2ZH4A 3CJSA 2IC3A 2OTJS 1BHNA 4Y00A 1C0TB 4L74A 3KLVA 4QWBA 3CDBA 4O4GB 2COLA 2EBEA 2BMBA 1RBLA 2RDJA 4M5GA 2YQ0A 2VIHA 3V4IA 1F1BB 4NE9C 2WOMA 1E6YB 3I9ZA 2R7TA 2B4VA 4JI7J 1TL5A 3HZEA 3RBZA 1KVKA 2CQ2A 5C25A 3TX0A 4IQMA 2GAGC 1UP1A 4DX7A 2R42A 3I82A 5B0FA 4IH5A 5HBMB 4URGA 4XDCA 2R8KA 4PXCA 3ETOA 1FK9B 3X3UA 3I0SB 1NM2A 3UDCA 3U27A 1NNDA 4K4SA 4ZCIA 4KFBB 3KG0A 3T1HF 2J76E 2HMIA 2FHOB 1VQ6S 3TUZC 1BQNA 4DFJA 4ZPTR 4DR4J 4LMZA 4C8KA 3KDOA 2Y8WA 2N4CA 5HLFB 3KLFB 3H4BA 4TU7A 1SJQA 2J6TA 5IT0A 4OI0A 4FBTA 1FRIA 1VQ9S 3TYTA 1PCAA 4ZVOB 2BANB 3BN4A 3MM9A 4X2BA 3MR3A 2BRLA 3MEGA 1WC6A 3Q89A 2DB1A 4CLSA 2AX1A 2EW9A 3AQPA 4QPXA 5LSRA 3ZZZA 4ECWA 5IQQA 2Q66A 4OZ2A 1DRZA 4ALZA 3RUBL 3DLGA 5BYRA 3IM9A 4A8YA 3JYTB 2PT0A 3M9NB 1YITS 3N5BA 4A8KA 2OMLA 4WPAA 4JI1F 2DHSA 3SEOA 4X62J 4IH6A 3H5SA 3DOLA 1GTEA 1W25A 2HIQA 1KTVA 4J9QA 1KOOA 3ISNC 5AXLA 2B4UA 2NSBA 1F2HA 3CTRA 4OYXA 1KFSA 3EICA 3KYLA 2A18A 1SC3B 2XWXA 3NNAA 1Y3KA 3RZAA 5I42A 2QA2A 3GP9A 4DI6A 1RDRA 3K59A 1X31C 3S01A 2U2FA 4C3KA 1K8AT 4KHPJ 3M4XA 4WP3A 3Q22A 5L46A 5AE3A 4ID5B 3LGNA 1S6QA 1JLCB 1SH0A 2KVQE 1N6QB 2GHPA 1PAUB 3QT8A 2KVIA 2G2YA 4LBHA 4YR3A 2EC2A 2JC1A 3I5CA 2YWWA 1TMMA 2YX1A 3W60A 3TRGA 4HL9A 4RUAA 3SV3A 3EGWB 1HARA 4DV5J 4YDXA 1WOPA 5F3ZA 1EKSA 4B3TJ 1ZM3A 4OI2A 3NGDA 2DISA 1CJKA 3PRDA 4M5MA 3TR5A 2M3DA 1YJUA 3IA0A 3IC1A 3LPYA 3PW4A 3V2UC 4I6WA 1U6ZA 3UE2A 4G38A 4DCOB 4C98A 4R8UA 4Y2MA 2HPUA 1N5SA 1X9WA 2VBZA 2W4DA 3VAHA 1RAEB 1MWZA 3AD8C 1ZBTA 4O3PA 4CM0A 2WTFA 2QSFA 1OYEA 1RTIB 3QBCA 4GC7A 1AUSL 1J27A 2VQFF 1TUWA 2UV8A 5D0RA 3G9CA 4ITSA 1OSCA 3RW6A 2Y1IA 3GSDA 1O5JA 3M9MB 1QSLA 3L9ZA 1HQEB 4N5SA 2ZH9A 2RF2A 4PR6A 3DOKB 3RRKA 3N79A 1RWVB 1RU2A 2JSXA 4EU0A 4NZ6A 1JLEA 4J9KA 4LRCA 4NLYA 2VG7A 2KZMA 1QY7A 1D9FA 5J2QB 5IC6B 1HYSA 2QLBB 3NBPA 5CYQA 1S9EB 5AJ3F 4C0BA 4DPUA 2VG6B 4V19X 4CYUA 3QQCD 1C2PA 3PYGA 2VBYA 4TU8A 2GQQA 3W3SA 5AE1A 1X9MA 1TV6A 1U8SA 3KK1A 1DAXA 2IVFB 3RJMB 1JXLA 2MLZA 4RUBA 4UF4A 1EQMA 4Q44A 4OV6A 5H9FK 2OSRA 1P1LA 3ONQA 3MR5A 1MW7A 1Z4UA 3GILA 1WTFA 4S23A 1VBXA 2F63A 1IR1A 1GTHA 2QA4G 3CCWA 3R2CJ 4HHHA 1Q8KA 5T7LA 4DR2F 2CXEA 3LAMA 4PXBA 3CIZA 3DLEA 5H9EJ 1UL3A 3JSMB 1WEZA 4ETXA 3TP2A 1LK7A 4O3RA 3T1HJ 2C2EA 1ZOTA 3HMJG 1RXOB 2AWZA 1YJ7A 3OHAA 5GMEA 4RW8B 3PYFA 4DLGA 4MFBA 1TKTA 1FNOA 4NPOA 2E1AA 3IFEA 3GJRB 2NREA 1MLAA 3GLJA 1FRLA 3W9JA 1XNRJ 1RHUB 2BM1A 2DY1A 1VRTA 1N5VA 1VQYA 1JKHB 4I56A 1SVDA 3K5NA 3CCUS 4K4ZA 4EFAC 1ZJ8A 5DZ7A 2JZ5A 4DR3F 1HBOA 3Q8RB 2EEYA 4NLPA 3RAQA 4OHVA 4X65J 2F9JA 1V5IB 2MPUA 5A76A 3FFIB 3M8PB 1TL1B 2RMLA 4MK8A 1FKOA 3Q8VA 3B4DA 3NS6A 3GTYX 4ZHRA 1IR0A 2HQGA 1SH2A 4QPTA 1U1RA 4DBQA 4PYAA 3Q23A 5E7OB 2FY8A 1X8DA 4OX6A 1B64A 4KO0A 9RUBA 4CZCA 1ZM4A 2J8SA 3AOAA 4LSLB 1FT8A 2MSTA 3FZ2A 3CJKA 4FNIA 3AFGA 1FXLA 3ZXWA 2HVZA 2QT7A 4DL2A 4FVCA 2MDAA 5F8HA 3MPYA 4NEZA 1BD6A 5KFRA 2IMWP 4ZPVR 4ZP7A 3K17A 3PYEA 1F60B 1L3SA 1SC1B 1Q8LA 3BH6B 3OD2A 4U9RA 2OPSA 3NGKA 3FMBA 3CCTA 4KHRA 5LMNJ 1HWLA 3CF5Q 4K4WA 3UQSA 4P2SA 1B0PA 5KFCA 3LO3A 5J2MA 2BABA 4Q45A 1WELA 3UI3A 1FJGJ 1RT7A 1NH7A 2GIQA 1S6PB 2EK1A 2MKJA 3JSYA 4NLOA 1RLDA 2Z2LA 1NK0A 2M5YA 4IG3B 4U7CA 2VFVA 3THPA 3R5AA 4OX7A 3AB4B 1G2EA 4P9SA 2UUCF 2LQ8A 2ASDA 2HHWA 3HFKA 2GQCA 4CI0B 3JTOA 1W2BR 3I4HX 4R0EA 2MB0B 3OVAA 1PKUA 3W2WB 1K0TA 3LTOA 1UPMB 3VGUA 5L9XA 2MHEA 4IUFA 4P2FA 4C7QA 4IDKA 3DXSX 4DSKA 4TY8A 4K50A 1NCLA 2DPIA 1Z2ZA 3AOPA 1VRUA 2QC3A 3PJ9A 1VK8A 1WG1A 3CB4A 4PWDA 3KXDA 1RTZA 3KK2A 4C8LA 1U45A 4YB6A 4YEAA 1TL4A 3FBBA 4F3OA 1S49A 3SDEB 2FJWA 2JFDA 3KJVA 4GEPA 3QGIA 2YKPA 3T1YJ 1DTQB 2Q1LA 1GNKA 1F9FA 2LCWA 4RWWA 1Y3JA 1WG5A 5LMUF 4P71A 1BMQB 2BXJA 1IKXB 4LF5F 3CD7A 3K2YA 1ZZNA 3KUHA 2FZKB 1FRMA 2CG8A 4DMZA 1U1QA 2R2TA 3M8QB 3MCMA 1XC9A 1GXTA 1F5CA 4F2RA 3CMAS 1N52B 4GO5X 3G6XA 4I2QA 2AKJA 4WF9Q 1WI6A 3OTDA 3HSGA 2I9SA 1P9QC 3CC4S 4AL6A 2LXFA 4DFKA 4U96A 1VBYA 3SQGB 3QSIA 3NRBA 4DR2J 5J1PA 1QUPA 4L73A 2HNZA 3D67A 4CH1A 1RE1B 4DS4A 3K0JA 3R3TA 5BYQA 2CNOB 3KLGB 1WSRA 4X4QA 4QYZK 1HQ2A 2DNGA 2HHQA 2CDRB 3PIPQ 3L7PA 3I32A 4NXNJ 5CYMA 3MFIA 4B17A 3SMZA 4A8WA 2IVMA 2M8HA 2BZ2A 4MJKA 2CG4A 5KFXA 4N8OA 2IM2A 2PFFB 1VRQC 3S6EA 4IRCA 1EETA 4YHHF 4RW4A 3W2VB 1TELA 3DYAA 2AEFA 5CCLA 1Y7PA 1KHWA 2AEMA 1R0AA 2Z30B 4DX6A 4HI2A 2DGSA 2AJ2A 3AHPA 3D6TB 2V6AA 5ETQA 3W5ZA 3UD3P 3T19A 2EPIA 1YBTA 5B09A 2X1AA 1DLOB 3A8EA 2GCFA 1KLMA 4M5HA 4QBUA 5E41A 2XMUA 2K1RB 2DNPA 4EMDA 1H72C 3NNHA 4OI6A 2CZ9A 3I31A 3MHYA 1R8PA 2C42A 3G82B 2WVBA 3S7RA 4F67A 1FVSA 2YWKA 3O6QA 4USMA 2MZJA 3HVAA 3LP2B 4WP9A 2D9PA 5LT5A 5B7WA 1YI2S 3BKFA 2ABYA 2E29A 3DCAA 4URQU 1T9VA 3D7SB 4L3NA 2BJ1A 2V4RA 4LVOP 3CVKA 2J0WA 1S7HA 2RHSB 4NZ7A 1JJ4A 3N6NA 4PG6A 2G0JA 3M32B 3OL8A 2GVZB 3NXZA 1LXJA 4HTIA 4HTJA 3GV5B 3LH2S 1I94F 4JI0J 2KXFA 1FFGB 4I6YA 4J9LA 3PDNA 2CNNB 3KDNA 2BJDA 3I0RA 4FS2A 1RT5A 4KV8A 3FBCA 1U1OA 5BR8F 4ZLJA 1U25A 1X4AA 2Z8QA 5KG7A 4PZVA 3FEYB 5IFMA 4JI8F 2DNNA 2D74B 4EGLA 2WSCC 4OX9F 3PXGa 5LSOA 5DQHA 1UWBB 2IRXA 2Y1LB 3RAXA 3GYGA 5F8JA 4N7TA 4WFBQ 4NI2B 2HW3A 2DTJA 3ZO7A 2KG1A 4QIGA 5I3UA 5J2PB 2XHWA 4F26A 2CAJA 3IS9A 3GJQB 2ZHBA 4OJ3A 4OHWA 1FTCA 2B6AA 4B3RF 4UQGA 3IG1A 2HLUA 2CJ9A 1WD6A 2LU1A 3MEKA 2YKAA 2PSZA 1QAIA 1T03A 1JLAA 3OXLA 4AD6A 2DNYA 3MM5A 2BR0A 4I2PB 4OYBA 4FF4A 2CPDA 1XMQJ 3PW5A 1CEZA 4OHYA 4J7CA 2GMJA 3DKDA 2CRLA 2LDIA 2C2DA 3I55S 3IGNA 2VG5B 4WFNQ 2R7WA 2AYEA 3GFXA 1KKHA 2PE8A 2QX0A 4RW6A 4WXOA 3MOJB 4CRJA 5HP1B 2Z0GA 3GFYA 3VM1A 1HIYA 4DPWA 1LW0A 1FKPB 5D0HA 3I5BA 4OMFG 4YMEA 1DQ9A 4QR0A 5KOXA 4FPIA 2CQ3A 1Z1ZA 3M8YA 1SCJB 2F1FA 2HEKA 1JLGA 4W92B 1IVZA 5CZVA 4F3QA 1WDTA 4NMXA 2F5GA 3LAKA 1RT3A 3CO0P 1WORA 5JVGQ 5KFOA 2QEXS 2OPQB 3R6LB 2V94A 5F0WA 4KB7A 2HKEA 2K8GA 5C42B 3TJ9A 2F8MA 4H4MA 1KQGB 2JOQA 4WYLA 4WK1A 2NXJA 2WVDA 1DTTA 3FK4A 2CZ4A 1G3OA 2H4WB 2J9CA 2Z2YB 1N34F 1SV5B 3G86A 3P4UB 5IM0B 3EVWA 2HBRB 2W01A 2PA3A 4HHUA 3CJ5A 3CMES 2HVEA 2PMHA 1T3NA 4CLZA 4YQWA 4KGVB 3X1LB 2BE2A 2XYHB 3KG4A 4DPYA 2ZBPA 4CDIA 3UN5A 3BB5A 2DH9A 4CO5A 3OV7A 4ELUA 2BQ3A 4P10A 3TA0A 1FJCA 4I7FB 5AXKA 1VQKS 3MD1A 4DL0C 3AXKA 3MCNA 2CWKA 1MU2B 4M5KA 4YP3A 3POTA 5CXTA 3BV8A 3V6JA 5F8MA 3I96A 1HHSA 4DR6F 1N88A 3FQKA 4I4BA 5AE2A 2RAQA 4WXWA 2FLOA 2X51A 1OQ3A 1NDLA 1RWPB 2L9WA 1NEEA 3DDKA 3VVTA 3MMCA 1NB2A 3HVWA 1S1VA 3AODA 1T7PA 1IKWB 3MOZA 2P9EA 4NLTA 2EXUA 4ERDA 3SSSA 3VVUA 3OQ2A 5H1SV 1IKYA 3K57A 3DRPA 2DBBA 2MYFA 4BDPA 4F4ZA 4IRDA 2BKPA 5KT5A 2ZOGA 1NMEB 1AT1B 1RT6B 2QZ8A 3K5MA 2MEWA 4N41A 4LF4F 2RQCA 1B3TA 2HHTA 1SXLA 1OWXA 1VIOA 2G1HA 3HSDA 2M70A 5J1EB 4PAAA 1HI1A 3VLZA 5D15A 1UETA 5LJ3Y 3A8IA 2B8PA 2AT1B 2D3ZA 2MY8A 3FGVA 1TU0B 4IO1A 4LFAF 1JJCB 2ZH5A 1HWJA 4C8ZA 4HT5A 3EVMA 4Z2XA 1U2CA 1S0MA 4KH0B 4JI8J 1TKXA 2KJVA 4RWXA 3MM7B 3NL0A 2WBRA 4RNMA 4DX8H 3MD3A 2WW4A 2JL9A 1U24A 2B7BB 2IYIA 3MMAB 2I5JA 4JOUA 2G9OA 2YQ1A 1UVJA 2Y0BB 2OH2A 1M5HA 3P5BP 4P2XA 5A0YA 4JYAF 1T05B 4DL7A 5JUMA 4KQZA 2H54B 1C1CB 4NLQA 5G0RA 3M1VA 1D09B 2V0NA 1M5VC 4KKOB 2JLFA 2Z57B 2B7CB 2H4YB 5KT6A 1GFWB 3M8WA 3UD5A 2CQHA 2O01C 2MQ8A 1N4LA 1EKRA 4RBTA 1HNIA 2DH8A 2HNDB 2W9BB 4S39A 1SIZA 3THVA 1FE0A 5D4LA 2PEHA 1IWAA 3UCGA 2ZFHA 1FXDA 2JVOA 5LM7E 1YJRA 1F6TA 1CC7A 1XK8A 3CW2C 1AUDA 4U67Q 4JUZA 2HYIB 4BHQA 3MM8B 3C6TA 3QJPA 3KUGA 2HRTA 3PW2A 2RS2A 2MKCA 2FVPA 2C2MB 1S6OA 3MI7X 3QIPA 3HT3A 4M5LA 1HBUB 4AQYJ 4WE1B 3W1YC 4UOGA 1TTHB 1OY6A 5CAAA 4QYZJ 2KM8B 4C0OC 2AU0A 2ZDOA 4MTPA 1YKWA 4USHA 3J7YU 4WJBA 1NZAA 3KLHA 2XMVA 5RUBA 3V6DB 3G87A 4ZCKA 4EYIB 1NJWA 2Y0FA 4JI4J 1NO8A 3DNCA 2HWIA 4RW7B 5EWFA 1YRXA 3G8TA 1TK0A 2YNIB 1N36F 3FBEA 1OY8A 4ZA1A 2MQOA 2BACA 3EZ5A 2I6WA 2ZHOA 1FE4A 1KEKA 1SUQA 4H4OB 1B99A 5KFQA 4IG0A 2W2QP 2WSEC 1CS4B 1V9OA 4B9NA 2XI3A 1XR5A 2ZE2A 3OFGA 5SZTA 3IN5A 4DV2J 1QLNA 5FDLA 4NCAA 1HNVB 5A8KA 4J9MA 3BGLA 3FRYA 2V8VA 4DN9A 2DEIA 3RBDA 1YRUA 3K8VA 3P45B 3GIRA 2AP6A 3D9BA 1NSAA 4ZN1A 1PBUA 1AB8A 1FNMA 3ETMA 2IPOB 2MGZB 2R7OA 2Z4PA 2ILYA 4DS5A 3PX6A 2GIRA 2LLZA 2HFSA 3ENWA 3IM8A 1Y00A 4JI2F 4WZMA 2RSQA 4IQXA 1LQ9A 4AL7A 1OY9A 4F2SA 5GADI 4WIIA 2V69A 2H5JB 3W5XA 5CCMA 1NLKL 1U1MA 1YJWS 1XIQA 1HNZJ 4EYHB 5F41A 3T6JA 1P27B 2GO8A 1P8GA 1GMWA 4M5NA 5B0EA 3KHRA 4FZVA 2R7RA 1FRXA 5F8GA 1ZPVA 1ELOA 1RTJA 1MROA 2R7VA 1NXIA 2UUBJ 3HJFA 3CD0A 4DX5A 2MKIA 3BZQA 4PPZA 2HHHF 2IJFA 4C48A 5ETKA 2IVYA 2GGPB 2W9AA 3MXHP 5JMNA 2E1MC 2O1PA 2C2KB 5FIIA 2UU9F 4PCQA 2BQUA 2EKYA 1BUXA 1TKZA 3J7A1 1NHKL 4OJHA 2HGNA 1REVB 2HWHA 4BBYA 2QO3A 3BGOP 1KN6A 4C8YA 1Q8BA 3MZIA 1TMJA 4Q5VA 1NKCA 1U0HA 4TU9A 4LF4J 3FEXB 4P6QA 1N33F 1YVFA 4CTAA 4F02A 3GIIA 1R27B 3HHLA 3W9IA 1JWWA 4DR1J 2EFOA 4OZJA 3H98A 3BBFA 1X4BA 1M1KT 5E3AA 4PG4A 1JLQA 1A9NB 2PIIA 3E01A 3OR2B 5E5NA 1B7YB 1E6VA 3PG9A 1BWEA 3FNNA 1WKLA 2C2OB 2XS7A 2GMHA 2IDLA 5HROB 1TR0A 1HPZB 3C3LA 2L9NA 4ES3A 3L3CA 1AXQA 1X7VA 3PX4A 1XNQJ 2O67A 2RQ4A 2ZKTA 3TAMB 2G0CA 5CYJA 1Z2LA 1EB0A 1RCOB 5A2QU 2ALZA 2JHEA 3H4DA 4I67A 5C24B 5J2NA 5BXIA 4CLLA 1VK3A 1GX5A 1R7IA 4Y2IA 4USTA 4JYAJ 2MQMA 1H6KX 2MKKA 4O44A 1AA1B 1UTAA 4F8RA 2RQMA 3OFFA 1NBEB 5B0CA 4JV5F 1WTBA 1IBKF 3C46A 3A8JA 2OD4A 1S9GA 4C11B 4MT1A 1YG0A 4QIWD 1T8EA 4NA3A 5ETVA 3AOCA 2FB0A 4NLWA 3VZIA 4XK8C 3ZZUA 4AXIA 2GVDA 4ZOSA 2KTQA 4LR8A 4XPCA 4CWBA 5B0BA 3QJLA 3V6HA 4RU9A 3PJXA 1WC4A 3HZGA 1WKJA 2QJ3A 2KYZA 3DI6B 5HN0A 2UXDF 3A1YG 3MMBA 3G4SS 4FKXA 3CIMA 2NXCA 2QLFB 3NCQA 2BKOA 5GADU 1C4AA 4DPTA 4AT1B 2WB4A 4ZLPA 1ZA1B 2PGCA 1HQUB 3CJ8A 4DUZJ 3TX8A 5KG1A 1R6YA 3LP0B 5HANA 4KGMA 1JJHA 3GYNA 3UO0A 2VBXA 4ELVA 4QIVA 4YFUA 1NH8A 3U1MA 4X64F 2RNEA 2YNFB 2BJEA 3UW1A 4AFFA 4ED2A 3DM2B 1S10A 1APSA 4CH7A 2V63A 5KFTA 2XLJA 2DNLA 2YNGB 2KKHA 3SCJE 1HBNA 5A8WA 1RWXB 4EEYA 1HI0P 5HJXA 4HH0A 1U1KA 2RE1A 2ZH7A 4DF4A 1PJ6A 3M2UB 3W7BA 4PG7A 4WKRA 1F5BA 2A10A 1N0UA 3DMJB 1TUVA 3MM6A 2LECA 4I1TA 1CJVB 3DOMB 1RT2B 4AL5A 3J7ZT 1WC3A 3B0GA 2EG2A 4OL8A 4J90A 1FRKA 3CDUA 3TUIC 3OR1B 1REGX 3WDOA 4MYUA 4DLEA 2P9GA 2WZ1A 2AGQA 4L76A 2HZVA 4J5OA 2DXFA 1I51B 1LWCB 4ZVQB 2CJXB 2BOPA 3CEDA 4DG1B 5ETLA 2E5LF 2LDYA 1W7WA 2XQCA 2GAHC 2FDNA 1QAJA 3R27A 4ZVEA 2UVVA 2FPHX 5EX0A 1NDKA 4GKJJ 3JB9k 3NOCA 3UN3A 4KT0C 3S8SA 1FF2A 3IRXA 2E9ZA 3M30A 2BRKA 2N3LA 3D1HA 2QLWA 1K47A 1TQLA 2XMWA 2YX4A 2UU9J 2VJVA 2V2VA 5C2CA 1UJ4A 1G7CB 3MR2A 3C2PA 3HO1A 3FC9A 4A8QA 1PGZA 2M88A 2IC3B 2HRUA 2VKRA 5K9FA 3A3PB 2E7VA 3DU5A 1U09A 1GQEA 3DHWC 2HQCA 2E9RX 3QO9A 3V4IB 2DPJA 4DR5F 4DQIA 1L3VA 2WOMB 1Y4ZB 2XYPB 3PR4A 3ITHA 4ZVHA 3GR1A 3IBWA 4CH0S 1Y9OA 4Z37A 3HVRA 4EI2A 4R0JA 2V4QA 4ECXA 2C28A 5C25B 5GEPA 1WF0A 5KFBA 2NUHA 2CWXA 3JAMU 1VLOA 1VC6A 2V2QA 5D6GA 2BEFA 3U1LA 4Y3CA 5D4OA 3CPWR 4TQRA 1H0HB 2HMIB 4M95A 1KRPA 1BQNB 4S3CA 4PG8A 1KBRA 1MN7A 5D4NA 1EQ0A 3MGJA 4USUA 1Q95G 4IR9A 4KBIA 3CD6S 2KXNB 3BGUA 4LQ3A 1RKJA 3HCXA 5DZ6A 2F4VF 3NGSA 1IBKJ 3D66A 4CNZA 4A8OA 3T3FA 2B9XA 3MM9B 3PO5A 3MEGB 2J9DE 3R9LA 2HHXA 3VALA 2UVRA 2I8EA 4PUOA 2RIJA 5KG2A 2IYGA 3KK3A 2J5AA 5L1KA 3DLGB 3JSRA 1LV5A 2DCLA 1PC4A 5LXRA 4PEOA 2IBOA 3S1TA 4OHZA 1SKRA 3H8YA 3T9ZA 1C0UA 2ALYB 3DOLB 4DL5A 1B4SA 1SPBP 3TI0A 1T3OA 2ATLA 4C0HA 3DDIA 1T11A 4MIWA 3RR8A 2AV5A 3PRVA 2KRRA 2DNZA 5KFSA 4C8OA 1YK9A 2PI4A 1LK5A 1XR6A 2X1FA 1X60A 2WCXA 4NX9A 4RUCA 2MKYA 1HWKA 3LA0A 2BJ3A 2FJEB 3VKPA 1ZAWA 1HW8A 3VAIA 3HF5A 2R7QA 1KVJA 5I42B 1XEZA 2ZWOA 1ZH5A 3DN9A 4QYRA 4YDDB 2OGUA 4X64J 1UEVA 1LOUA 1VBKA 3BF4A 2CPHA 1VHFA 1NRKA 3RB6A 4E8UA 1CPZA 5HMWA 5DQIA 1S0VA 1S6QB 4ZVFA 1SKWA 1GAOA 1AFIA 2FIUA 3SIPB 3OL7A 3HHLC 1UVMA 1S1TA 3PTWA 3HVTA 4RBVA 3FCWA 4DSFA 4NASA 5B0DA 3HXMA 1WOOA 1QVGR 3N0VA 2W2NP 2VQEF 4JI7F 3GMGA 1S77D 4G6VB 3KHHA 1RKIA 1CJKB 9ATCB 2H48B 3MDFA 3CCES 2RB7A 3NNCA 3GPAA 1DQAA 2Z56B 2C3PA 2ADBA 2HG4A 4R8UB 4OYMA 2J0XA 4OI3A 5HATA 4ZLLA 4WIQA 1NPPA 4UZBA 2DR5A 4BC9A 1YDLA 2VICA 4P75A 4Y2KA 3EGZA 4Y34A 4DR4F 3MF5A 2E5LJ 4XDDA 4DEZA 4DV4J 4OV1A 4N77A 1IBLJ 2IHR1 2RF2B 4DV3J 2RDIA 4ZJQA 2KJWA 3C19A 1X4FA 3NY0A 5HSPA 1FHTA 1HBMA 2F8EX 2J7WA 3E2EA 2F65A 3F0NA 1JLEB 4FVMA 5KFWA 1IBCB 5IQ6A 2H1YA 2VG7B 3VGVA 1PAEX 3J80U 3CCLS 2HFZA 2G4BA 1HYSB 1KS2A 1WF2A 3NBPB 4NL5A 5CYQB 4UW2A 3LP1A 4JI3J 4IH7A 4QW9A 4CYUB 4LIWA 5LL6d 4X62F 4GVLA 3TOQA 3MURP 1TV6B 2VD3A 2DGXA 5EWGA 3R7NB 3KK1B 4PXDA 3R8YA 4G3IA 4X4VA 4MK7A 4LBIA 2HZCA 3Q8SB 1UVLA 4N56A 1U6FA 3ZZRA 1CULA 3KMQA 4ZVGA 2XMTA 2FJAB 3CDWA 5D8HB 4HI1A 2GFFA 1VQ8S 4USIA 2J0QD 4QU7A 5T7LB 1IN0A 4ZP9A 4DR7F 3VWSA 3DLEB 5K8MA 2UXCF 3HFZB 1B7FA 4FKYA 4DUYF 3ILIA 3K5OA 3QZ7A 1B0TA 3PW0A 3FCHA 4GO7X 3R7BB 4MFBB 4DV7J 3CXCR 1TKTB 1S97A 3SYZA 1I3OB 3TA1A 1SQFA 1Y5NB 1S4FA 2XY7A 2KT3A 5D3GA 2F4VJ 2JJ4D 1VRTB 5IC4B 2XHCA 3D0GE 2LYVA 1Q1KA 4FS1A 1RLCL 4O0NA 5EUHA 3MCOA 4B3TF 5GAHI 3KHLA 1HBOB 3DU6A 1VMBA 2GMLA 4CNYA 4WYWA 4B02A 4E0DA 1HR0J 2V34A 3UR3C 4CCHA 2HQDA 4YB7A 2QMUB 4HACA 2BE7D 3FKBA 1VJQA 2IY5B 4J9PA 3PO4A 1RJJA 4RNFA 1FKOB 3VQTA 3NP5A 5EDWA 6FD1A 4OZ5A 1EJ7L 1SQEA 4ZHRB 2IAJA 2VA3A 3QRRA 1WHWA 1URNA 2E7XA 3EPGA 3B78A 1VQ4S 1IJFB 4KO0B 4OJGA 1LFPA 5CA5A 2MKSA 4ETZA 1X4HA 4OLOA 3CJKB 2OEKA 1Q86T 3FZBA 4ZVSB 1DQ8A 3LOUA 4HYKA 3CJQA 1UFLA 5KFUA 3GV8B 4BLGA 1RT1A 1UWAA 3WHIA 2YNHA 2A2CA 4N47A 3HULA 4WFYA 1W26A 3UVJA 1YJTA 1X0FA 1KONA 3A3NB 2VB6A 1TVRA 2Z58B 2N4DA 2MZRA 1D9AA 1R8CA 2LFVA 4FNHA 2OPSB 2DXDA 4G1QA 1GH8A 2ZUGA 3WX4A 3M2RA 4K4YA 2DH7A 3B0LA 2BOAA 5J2MB 2ZC3A 4TQSA 3BR9A 1M5PC 4MH8A 3MWBA 3L09A 1UW9A 4EUVA 1RT7B 4Q2MA 2VQEJ 2CQPA 2KM8C 1TL7A 4FF2A 3CO9A 1WHVA 5DM6Q 1LWFA 2G0IA 3B54A 2QL7B 2RUSA 1VS3A 2NYIA 3B6BA 3DXBA 2JC0A 4OLPA 3TAQA 2AGOA 4CM2A 4NCGA 3D2WA 2E7WA 3HT0A 4QWDA 4QIFA 2VPWB 3H42A 4IDKB 4A8XA 1GK8A 4NRTA 4TY8B 5CD4A 1VR6A 4P74A 3M6UA 1VRUB 1LWEA 3KUEA 1S99A 4BS2A 3OJUA 1S0OA 4PWDB 1OJ4A 2ZEJA 3NGTA 3Q8QB 3KK2B 1S1XA 4FPRA 2OTLS 1XNRF 1XWLA 3OTBA 3NMRA 3KJVB 2G2ZA 4CLKA 2ERRA 1C1BA 5KFGA 4EO8A 3EDRB 2FQQB 2HAFA 4DZ6A 5AT1B 2FGCA 2SXLA 4DSLA 4NLRA 2JEGA 5GVQA 2HK3A 2UZAA 1RQ0A 4W98A 4DV6J 2FLPA 4X65F 2FY1A 1RTDA 3C15A 1MNEA 4NOHA 2DJWA 2R4FA 1P1TA 2VFTA 5ETTA 5GAHU 5K8PA 2A0FB 4Z7CA 3PEHA 2WVFA 3R5JB 3MFHA 3MUMP 3ZTOA 4KIAA 4ED1A 2D3UA 3FVYA 2MQLA 4WWSA 3PCOB 4D3HA 3HHNB 2RRNA 1WHYA 5L1IA 4DSJA 1N5QA 2B5JA 2K06A 4I2QB 5GAEI 3QZ8A 3KWMA 2ZM6J 2H65B 2OAUA 4L72B 3SFUA 2A1BA 4NLDA 1RHJB 2OPRA 2DKOB 1RYSA 3CCMS 3R7SB 4RZRA 1IXKA 1PYTA 3PKMA 5I3QA 2HNZB 4DR7J 1N48A 4NLVA 4RNHA 3RR7A 2ZBRA 2UXCJ 4BCAA 4DUYJ 4M8LA 4RL1A 5CYMB 3MTJA 3T9NA 4USJC 4ED8A 1FWKA 2JNJA 2D41A 2WONA 1MMLA 2ZH8A 4ER8A 2MQPA 1EETB 4RW4B 1GT8A 1S0NA 3GFHA 1J5EJ 3DYAB 4X66J 5LMNF 3I9V9 3DRSA 1RISA 2XY6A 4K4UA 4CLWA 1R0AB 2BX6A 5K14A 1FFWB 1NKEA 2KG0A 1QE1B 1JJ2R 3JQKA 1FJGF 1OQ6A 2BYCA 2HSEB 1S1UA 1NK9A 4DCPB 2HBYB 1XMOJ 3L95X 1FA0A 2FZGB 3B8HA 1KLMB 3C6UA 3DHXA 4B9SA 4ZKAA 1KLNA 3IGVA 1PJ7A 1K1QA 1ZM2A 2JX2A 3TANA 1S76D 4CO1A 4ZPCA 1DFDA 2QGFB 3KLEA 1KVIA 4WTOB 3NKYA 2J0SD 1NU4A 2HS3A 1JLFA 3CCQS 2ZD1A 3BPSP 5KFNA 2FVRA 1CJUA 1TL3A 1I6JA 3K7RA 3MR6A 5AOPA 2HVHA 5KG6A 3CCJS 2W7AA 2VONA 5K5MA 3W64A 2L3MA 3SSQA 3HKWA 1VFJA 5B0GA 3MEDA 4ZIWA 2CQ4A 1UZHA 3H25A 3T1YF 1WC0A 4KRWA 3SZ2A 3I0RB 2CKWA 1FX4A 1RT5B 2B9WA 4KV8B 5T14A 5ETNA 1NPRA 2O5DA 4OZLA 4K5SA 4MKYA 2L08A 2X1BA 2CVIA 3QGPA 4XAKA 5KFVA 4ILRA 4S3BA 1QJHA 1PILA 3QIDA 4F04B 2CQ1A 1FNXH 2ZZNA 3D68A 2XWYA 3UN2A 2FD2A 5I3UB 3HK2A 4TXSA 4M63A 1TP7A 2QLJB 4Q0BA 4TLQA 2GS8A 5IS2A 2A6MA 7FDRA 5F9NA 1YJ9S 3IS9B 3LGMA 2K2PA 3HD2A 3AD9C 2ROPA 2B6AB 3OUYA 5GAEU 5IV4A 3GR0A 1DURA 3IG1B 4QOTA 4J9RA 4RJVA 4TLRA 2B51A 5K20B 1RHMB 4F50A 2ZH2A 2HWTA 5C2GA 1HHQA 4JV0A 3W66A 5A2QY 1T03B 4ZITA 1JLAB 4G65A 2C2ZB 2FLLA 2EFQA 3ZZPA 1YJVA 2LU2A 3MM5B 5HMXA 4NXNF 1KHVA 2P2CB 3VV2B 3CJTA 1GMWD 4KGKA 2CPJA 4F4XA 1D1UA 2VOOA 4CLYA 2LXIA 3IP0A 2ZNYA 1SKSA 2KO1A 4IO9Q 4RW6B 4Y6IA 5E3CA 4DQRA 3A12A 3ET6A 2EI5A 4B9VA 4USKA 1S12A 1HLWA 3ISZA 2JEIA 3EMTA 1Y10A 3C14A 1LW0B 2NR0A 3EX7B 2BQRA 1RWMB 5L1LA 1O8BA 2XO6A 2C1EB 4CO0A 2OELA 3BREA 1T0TV 3CDAA 2OIHA 2VFSA 2POKA 5HQLA 3OFEA 4OYPA 2W9CA 2FVCA 2JFKA 1JLGB 1Q53A 4CIOA 3TNVA 3OVBA 4YR0A 2V8PA 1RT3B 1AZSA 3UDEA 3WC2A 1WSVA 5A6WA 1GMVA 2PDAA 3HHLD 3LUYA 3PW7A 4U8YA 3VKSA 3RG6A 3OVSA 3ILLA 5T41A 2KRBA 1R6VA 1KWMA 1ITPA 1AW0A 4CLFA 2P6TA 4K2JA 1WJ9A 3G6ES 4FN5A 4K4TA 2XSJA 4O0IA 3TA2A 4NA2A 4YOEA 4H4MB 4N8NA 2DGOA 3P49B 1OYDA 4KHMA 2BKNA 2CPFA 5KFZA 4IKAA 1DTTB 3DLHA 1NHVA 4OZNA 2NQPA 1RAOA 4WTYA 3HD1A 2ZJPQ 3DLKA 3D5MA 3M8SA 3QWPA 4JI0F 2YTCA 3PZPA 2EWHA 5IOLA 5LXYA 3BPDA 3KJQB 2BE2B 2J8AA 5CH7B 4IOAQ 3HM9A 1UZDA 4B3SJ 4NLSA 3MAQA 1RBAA 1FWLA 5A8RA 2RDDA 5B08A 5I3PA 4J9SA 2Q79A 1RWOB 1IJEB 2JRSA 5IZHA 4EZ6A 4MKAA 2KDOA 1ACMB 1QM9A 3POTB 1R31A 4X4UA 1Q79A 2YBVA 1M5OC 2OHDA 4YB1P 2NUUG 1YRTA 4ED4A 1RYRA 2CADA 1RU1A 1FD8A 1CQMA 3ZTQA 2N82B 1G4CA 1S7IA 2BJ7A 1NB7A 3MMCB 1S1VB 2QE5A 5GMKa 5KFFA 3GIJA 4OZ0A 3BS9A 4R5PA 3QGGA 2XCPA 1XTZA 1IQZA 2HVDA 1Q82T 2ROGA 2HS0A 5LJ5Y 3T6BA 3EYZA 1JK9B 2R8GA 3IXQA 2DGQA 1S48A 3NAIA 1JNRB 5KTQA 1IKYB 2R2RA 3DRPB 3WZ0A 2LVWA 3VCDA 3TARA 2XNQA 1XMQF 1FXRA 1Q7YT 2W8KA 2GV1A 4YS2A 1HHTP 5KFEA 2H3EB 3TQ1A 1JX4A 4LRFA 4G1PA 2LEPA 3FSXA 3ZNJ1 2R7UA 3JS9A 4ENOA 3VQSA 3DC2A 2HFNA 1KSPA 1VHIA 2GQ2A 2QYCA 5JJBA 1KTQA 2L41A 3ZZYA 3PM9A 1R43A 1F9HA 2A2DA 4ZMMA 5HMZA 2C2RA 5F8LA 1G6BA 3CUNA 3EJMA 4RPFA 4IFVA 1U1PA 2HURA 4K0KF 3RBEA 2V50A 4S0MA 2RUGA 2WBMA 1TKXB 4DL4A 2X1GA 3T41A 2MXYA 1IQTA 1IBMJ 4O3NA 3VKRA 2EKNA 3U1NA 1WG4A 4ES2A 2I5JB 1D3WA 1NK5A 2E66A 4GKKJ 3IR6B 3QAUA 5A0YB 1OIAA 2VC1A 1RK8A 4ED0A 4ZVUB 2VZ9A 4HDGA 1FESA 4Q2LA 3GWCA 2A6OA 5G0RB 1VOMA 2V4JA 3MECA 3M1VB 2DR7A 3EM1A 2YPZA 2NXUA 3EZOA 2JEFA 3JAMY 4LF8F 3NWRA 4ZS6A 3W65A 4ILMA 1T9WA 2HK2A 2XTJP 2VKZG 4OYWA 3EUNA 1UPPA 1I5OB 1HNIB 3D0IE 1S4EA 3BEGB 4OI4A 5KFAA 2VFRA 2IBKA 2RILA 2JLGA 2KU7A 2V8DA 3GB0A 5H9EK 1VIXA 3VAJA 2W4PA 1R8BA 3GSIA 3C6TB 1A6LA 2WVCA 3M8ZA 2M52A 4B9MA 3QIPB 2AMCB 2U1AA 4F0KA 2D7SA 1HNWJ 4ECZA 3EZUA 3VAKA 1EHWA 1MSWD 5KT4A 4GC6A 1CVJA 2F8HA 3GV7B 1HKAA 3MUTP 4EBDA 3MAAA 2MKHA 3KLHB 3PFOA 4OI1A 4ZLNA 4OQJA 1ZTTA 1FX2A 1CJTA 5HL7Q 1Y11A 1HL6A 4DV1J 3C16A 2AX0A 3RAMA 4I68A 2ATCB 1IUJA 3KG1A 1SUQB 2OP5A 3N6MA 2DGUA 4IG0B 3N28A 5FJ4A 3K8WA 3DRRA 3M05A 2BUNA 3DGVA 2ZE2B 4O23A 2VH7A 5HVFA 5FDLB 5KFKA 2F3JA 5A8KB 5EN1A 4TKTA 2ZJQQ 2X3GA 2V2KA 4PKDB 4PRFA 1FWPA 3QPIA 3CT9A 2DCUB 4CP5A 3F73A 2Q6CA 4PPDA 4FYDA 2PN6A 5CZXA 5KAKA 1OS5A 3MAHA 3BO4A 1KR4A 2FYXA 5IWAF 4B3OA 4QW8A 3BGRA 3UFCX 3C8YA 4K4XA 4ECQA 3VAMA 3CJ2A 1Q5VA 3GCXP 2FVQA 4GRSA 2BA9A 1EX8A 3FBFA 1RI7A 1U4BA 2B4OA 2DR8A 4X84A 2E1RA 3MPUB 4J9UE 3EXYA 3B0JA 1WF1A 1TAQA 2OFGX 3HI9A 4DV0J 5D0EA 4C8NA 5DETA 1MMNA 2OEJA 2XULA 4LT6A 4A8MP 2XB2D 4LRAA 4GVBA 4LREA 2FJBB 2FUG9 2IM0A 1L3TA 2PFDA 4ICLA 1RTJB 1MROB 5KG5A 3P3DA 2CNLB 3TWZA 2HQIA 1LEOA 1BGXT 2ASJA 4NYZA 5F9LA 2VA2A 4DPXA 1CQNA 1WC1A 4IOBA 1YIJS 1ZTWA 4OIXA 3F56A 2LXUA 3SSRA 5AXNA 3WX8A 2OPPA 1RACB 4PQAA 2AIRB 1N32J 1H73A 1TKZB 3PVXA 3NEKA 1NAQA 5IV3A 3M2VA 2C3YA 4NCBA 5H9FJ 1FFSB 3H7HB 2ROEA 4AE5A 1S5ZA 1XR7A 3BDEA 1CBKA 4L3KA 2CJQA 1MWQA 1U0HB 1NSPA 4HTRA 3SCKE 4CTAB 5HI7A 2ZH1A 3HHLB 2Q6BA 4HH1A 2B56A 2Y0SD 2YKNA 2Q43A 1QAYA 1ZAVA 4AQYF 2KT5A 5AXMA 1BQMA 4UOCA 8ATCB 3J80Y 1JLQB 2HNYA 2J7UA 3VAGA 5KFYA 2FHJA 3E01B 2RU9A 1E6VB 4EZ9A 2V68A 2DNOA 4OJ1A 3BSNA 5C5JA 1XQIA 4K0KJ 4JI4F 2DNKA 2XZDB 1O0PA 2LQJA 1K9MT 3KLIA 2YH0A 2XO7A 2VODA 1XMBA 3IAM9 4ZPDA 4TY9A 3OL6A 5J2NB 2XLIA 2PA8D 2XYGB 4HHJA 4U6PA 2BM0A 3I4PA 5D78A 4JI6J 3DGPA 2BJ8A 1ZYQA 4DV2F 4NLGA 2BJ9A 4ZCMA 3QFWA 4O44B 2K3IA 7GEPA 3CCSS 4OFZA 3GIKA 4LF8J 3RGIA 1KQFB 4URSA 2AJ1A 2FHKA 4IFYA 2RRAA 3E3XA 2D1CA 4NXMF 1S9GB 2HLTA 4PQUA 4MAKA 2OFHX 3MCSA 4K7QA 4FYVB 2JEJA 1QD1A 2GJIA 2GVDB 1T95A 1VQOS 4Q43A 2OI2A 1VLYA 2NLWA 3WIVA 3OSNA 3OLAA 2R8IA 1SJ1A 1T9TA 2ZVIA 3QLHA 5DDPC 4LF9J 4QQBA 2HHPA 4LQ9A 4C3LA 1U49A 3V5RA 4USVA 1X0PA 3AD7C 2Y1JA 4RNOA 3MMBB 4DU8A 2JLEA 1FD2A 3J7YI 3AJDA 2XY5A 1HNZF 3TZWA 3UNGC 2LQ5A 1N5YA 2H9ZA 2XLKA 3UCUP 2CJAA 3FSIA 1VGYA 5E3QA 3R1LA 1UMJA 2UUBF 3O5TB 1GEHA 2VBWA 1MWYA 2RKIA 5HO4A 2JDJA 1VQMS 4JP8A 3P5TL 2NPFA 3J81j 1Q16B 1YSJA 3BQ0A 3EGNA 1CLFA 3PHTA 4LSNA 1BLUA 3G6YA 2IJNA 2AYMA 1TAUA 1H74A 2F4FA 4FP9A 2FVSA 3OTOJ 1HBNB 1M5SA 5A8WB 3R5BA 2KT2A 3Q83A 5E33A 3A13A 3GU0A 2YWGA 2UV8G 2FTRA 4YY3F 1RHRB 4DR1F 4NLXA 5DO2A 3QT5A 4I0WA 2VL1A 1U48A 4XO0A 3E51A 2DHXA 3MM6B 4OYIA 5IWAJ 1H38A 3R6GB 1NPKA 3IWXA 2VPXB 3D4JA 3ILOA 1BC6A 2R2UA 3NGRA 1RTHA 1LNQA 1A0OB 4LFBJ 1ZPWX 1SL2A 2ILZA 2PC6A 3I87A 1XNQF 3A8KA 2N7CA 4CO4A 3FMWA 1LXNA 3ZTRA 1LW2A 1U7LA 2D3O1 4DQSA 2RVJA 3EE3A 4LF6J 2EBGA 4RR5A 1IKVA 1SIWB 4OYAA 5KFPA 2V2ZA 2I1RA 1DHMA 1YWXA 2VF3A 5DM7Q 1U6BA 3CCRS 3IRXB 3TQEA 4QZVB 4NMLA 3LF0A 3M30B 4FBUA 3LANA 1F0XA 2KXHA 1SQGA 2CZVC 4FYYB 1HW9A 4ECTA 5HVGA 3NG8A 4LUBA 2YKQA 4X4SA 4JV2A 1AROP 1IM4A 1OMSA 4C4WA 4NYPA 1EP4A 3D0HE 2ZBIA 1A7GE 3OW2R 4WKYA 2NPIA 3QO9B 1PIEA 1EAYC 1NUEA 2UUAF 4WCEQ 2R9LA 4ED5A 3ITHB 2K7JA 1M1GA 4HDHA 4CQ1A 3PIOQ 4K5RA 4H4KA 4M94A 2W7OA 2AHOB 3ZNUA 1RWUA 2FHMA 3D28A 1S1WA 4IOCQ 4DUZF 4P7VA 1FJEB 2MLXA 3PV8A 2CPZA 1BWVA 2MJUA 1D9DA 1Q81T 4RU2A 3RRGA 1X4GA 3Q24A 2YKMA 3AT1B 4ECUA 3OT9A 3W63A 3CC2S 2DNRA 4ATNA 2EVZA 3BKUA 2I38A 1NDCA 2ACMA 2N7YA 2EC0A 1ZAXA 2LP4A 4ZCLA 1JLBA 1RT4A 1VQSA 2XG8A 3EPIA 1C4CA 4ZPAA 2QSWA 4ZJOA 1NJZA 1HFEL 4ECYA 2VV5A 2B4PA 4LF2A 2AF6A 4NXMJ 1RAJA 3TEHB 4QWEA 4PUOB 2K3KA 3W8GA 4JI1J 1NDPA 4LFCF 1U1NA 3KK3B 3IWNC 4G39A 3O8WA 2Y8YA 5ETPA 2CNKB 3V6KA 3AJ1A 2GJFA 3V81A 5K8NA 2VOPA 4B3MF 1C0UB 3FEZA 2ADCA 4ZP6A 1H2VZ 2QL9B 1VISA 2XMMA 2CFXA 2AKWB 1J5OA 1HMVA 4RW9A 1YZ7A 1JMTA 4WBFA 1ZA2B 3QSYB 3UPFA 3TZYA 3MEEA 4ED7A 4M5DA 2BV3A 3RB0A 2UXBF 5L39A 1D8YA 4GKJF 2Z2ZA 1FRJA 3Q8PB 2HAIA 3US5A 1NJXA 4UUWA 3GEOA 4WK3A 2FLNA 3WC0A 3RB4A 2E1CA 2P9CA 4USWA 4DJBA 1RWWB 1C0TA 4CT8A 3CULA 1FKAF 4O4GA 1EZZB 3Q8UA 2XSFA 3ZZTA 2QV6A 2MQQA 3DFEA 1DARA 3AA9A 1T9UA 4B9LA 5DLGA 1HA1A 2EG1A 1IWGA 1E6YA 3GONA 2F40A 3WQPA 1PC5A 5LSLA 2AGPA 3HHDA 1S1TB 5D77A 3J7AN 3BSOA 5DDQC 5CHCB 2HBQB 3HVTB 4YY3J 5E3RA 7FD1A 2AEJA 3IRWP 4DOZA 1CG2A 5KFHA 3EVOA 4DHVA 3N6LA 4TYAA 5KFDA 2Q3PA 5HBMA 1KP6A 5G4DA 4IYQA 5KT2A 3KFWX 1FK9A 3I0SA 2XNRA 3GG1A 4KFBA 2C3UA 2CJKA 2YQ3A 2OSQA 1H7WA 3ZTPA 2VQFJ 3I5AA 4O3SA 3N9UC 3MR7A 4X4RA 2AJ0A 3QFHA 1VCTA 3PYDA 1FI4A 5HLFA 3KLFA 2L9DA 1VC0A 4MKVA 2DT9A 5D4PA 2OMOA 1QUVA 1RA6A 4OZ3A 4ZVPB 2E1PA 2CQIA 2CPXA 4LF7F 2BANA 3BM7A 4DPOA 5HQ8A 1NKBA 3T5LA 3B82A 1P6TA 4PWWA 4U7UD 3G2XA 2PD1A 3VZHA 1WUUA 1HBMB 2MMYA 4XTTA 3PRBA 1PYOB 3JYTA 2HGMA 2P6SA 4ED6A 5AJ3J 4DL6A 4M5JA 4I64A 4HKQA 1K1SA 3JQJA 2DITA 1X5SA 2MZTA 2DHGA 2ASYA 1GX6A 3LP1B 3HDSA 4KYZA 1HWIA 4ZK7M 2HQFA 3PACA 5D0GA 2QA1A 2LKZA 3P6YC 1X4CA 1M0SA 8AT1B 4ELTA 2BVZA 1YBAA 4CLPA 1I1GA 3ELHA 3QYYA 3IO1A 2UUAJ 2MZ1A 5EHHA 1CULB 3VM0A 4AOPA 2GHVC 5DQGA 2KHDA 3TZZA 5DG8A 4N76A 1OPIA 4ECVA 1NK7A 4CLTA 2Z2MA 2LMIA 4OZ1A 1UJ6A 3TUJC 1Q0NA 4ES1A 2PI5A 2YH1A 2IRYA 4ID5A 2FJXA 1JLCA 1X4DA 1N6QA 1WOSA 1H2UX 3T5JA 3H2LA 2XMKA 4EWTA 5DGAA 1WKKA 3R2DJ 2HQ3A 1QTNB 2E5JA 4DSEA 3Q0AA 1JXEA 4U95A 1QE1A 3KKFA 4AYBD 3MMJA 3O1LA 4S38A 1KQSR 3RRHA 2IFXA 1XBWA 4DR3J 5D3GB 3FUYA 3GQCA 3D3CJ 1VI7A 1FTRA 3I56S 4MKBA 1KQKA 8GEPA 2GZOA 5E0OA 3TJAA 4LFCJ 5KT7A 2W24A 3BDPA 1R0CB 1FEHA 3EWGA 3G6VA 5HAOA 4HACB 2CJBA 1R3NA 4DSIA 1H7XA 1RTIA 4B3MJ 1RCXB 1XERA 3HPOA 2HBZB 3HKZD 2B43A 2MHNA 1NSQA 1IM6A 3MTKA 2IAJB 1HQEA 2RT3A 3D1OA 2DGVA 3DOKA 4LVNP 2XMAA 5FLXU 3LWLA 1UVKA 3VAFA 3RB3A 5B0AA 4DV4F 2UXBJ 1L3UA 3KNGA 1IBLF 1WI8A 4YR2A 3T5HA 4DV3F 1NK8A 2R7SA 5KFLA 3I6PA 1SC6A 3CJ4A 5J2QA 4NWBA 3HSZA 1D0EA 1NZ8A 2AZ3A 2N3OA 4FF1A 1H3DA 3TZXA 3MPVA 1S9EA 1FCAA 1RT1B 2WK4A 4UY85 2YNHB 2VG6A 2GC8A 5SUHA 2W1BA 1PJ5A 4XPEA 2NS1B 2V8GA 2DHHA 3CCZA 1FDNA 3UVJB 3CE8A 4JI3F 2VHGA 1TVRB 4FYXB 3IBFB 2D69A 3B0HA 4UUXA 3SBMA 5L38A 4S3AA 1U8WA 2O3DA 5KFMA 4G1QB 3KJFB 4Y65A 4J9NA 4OYZA 3M2RB 3B4MA 4P73A 3ENAA 2IDEA 4F36A 3OJSA 3HHKA 4H4KC 3KOAA 3OXGA 1UEUA 4KJIA 1M1HA 4IR1A 2UUCJ 4KPCA 1TL7B 2QTWA 2HHSA 1IR2A 3AAWB 3JSMA 1LWFB 3OHBA 4DXLA 2GX8A 2KZZA 3H5UA 3C66A 1TUGB 1RHQB 4FXWA 4RW8A 3LGHA 3UCZP 4NCGB 3ISND 2FGOA 2W7PA 1N56A 3NWGA 2LQ9A 1SJ4P 1LKZA 1BXNA 2I0XA 1LWEB 4O4RA 4DV7F 6AT1B 3QAEA 1RHKB 1JKHA 4ZP8A 4LF7J 3BO3A 1UFKA 2ZJRQ 1S1XB 3HX9A 1ULRA 2KL8A 2YPYA 4RNNA 1M90T 4K2XA 2AOPA 1C1BB 5LMUJ 3PY8A 7AT1B 4LF5J 5CABA 2HGLA 2JWNA 4YB5A 3H2VE 2CA9A 3FFIA 3QJJA 1GXUA 2ACYA 2NCKL 3M8PA 1TL1A 1SJFA 3DLLQ 1HR0F 1RTDB 3C15B 3AH6A 5I4MA 1KNZA 1JXVA 3IAS9 2ZHAA 5KFJA 2M8DB 3Q2TC 1T9YA 5F3TA 3WBZA 2M4MA 2ZUAA 2XGPA 3BQ1A 1GMUA 2B8QA 2L48A 4OHXA 3N5FA 2FJVA 5E2QA 2B5JB 2CQBA 1B0VA 4CO3A 2NSCA 4LSLA 4WFXA 4A4JA 5ETOA 2E44A 3NS7B 2ZDPA 2BBEA 2IM3A 2XCAA 2ZOMA 3CDEA 3NAHA 2OPRB 3BSCA 1FERA 1L5UA 2ZH3A 2W8LA 1PYSB 4EO6A 3IR7B 2WVEA 3CJ3A 1OO0B 2IJRA 3TVKA 1RGVA 3SCIE 3TUPA 4YHHJ 2FC8A 1H2TZ 2QLXA 1RAGB 3A3OB 5DLFA 1WACA 1HWUA 1RBOB 3GFZA 4JB8B 2OO4A 2WONB 1FRHA 3D6HB 2PMZD 3J81U 5JVHQ 3BKTA 3GIMA 2WRMA 1NHUA 4YUDA 2M2BA 1YZ6A 3U02A 3DRSB 3K58A 3ZFVA 2CPYA 5K14B 3LQVA 1S6PA 3BYPA 1PSDA 5IT9U 1RAHB 4C97A 4CLUA 4F4KA 3H0PA 4IG3A 5DG7A 1ZS6A 4KE5A 1S1UB 4K59A 2EFGA 3W61A 2CJYB 2E5IA 2AD9A 2QMWA 4KGZB 3QGHA 1T94A 3PFEA 2NZCA 2ZKUA 2C3MA 4NYOA 3C6UB 3JSBA 3W2WA 3M6XA 2GO9A 1Y5LB 5GAGI 1DZ5A 3UR0A 1MG7A 2AQ4A 3VHQA 4ZPWR 4TVAB 2C2NA 3CD5A 2KI2A 4ECSA 2VDIA 4DU7A 3KLEB 2IIHA 4HVZA 4A48A 4QR2A 1F5AA 4DL3A 2QL5B 2KFZA 1JLFB 5KFIA 1GXLA 1X5TA 4P7TA 2ZD1B 3SDEA 1I94J 4DF8A 1CJUB 1TL3B 2G2OA 2AW0A 4JV1A 1DTQA 2VU5A 3D54A 1OPZA 2DXEA 2WW8A 4DWIA 1X4EA 2ZC4A 3SI8A 5BR8J 2XEXA 1PO6A 1TZ0A 4A46A 3MEDB 1SI9A 4B9UA 1IKXA 2NXNA 2MLYA 3D6MB 5HQMA 3VTIA 2DGTA 3O2IA 2PO4A 5J1NA 4OX9J 4QWAA 3P96A 4B08A 3K5PA 4DV6F 3M8QA 2FC9A 3B0MA 3GYXB 5M2RA 2WAQD 4L75A 2QFIA 3DDNA 3U7JA 3THTA 2MTLA 3R5CA 1FO1A 3D3BJ 1LWXA 3H59A 1YQHA 2Y9HA 4S3FA 4KH1B 4DFPA 3AQOA 1P9YA 3W8PA 4F4YA 3OSPA 3SQGA 1WNEA 5ETRA 4Q0BB 2HHVA 4B3RJ 3M6VA 3MPDA 4O3OA 2ZM6F 3T1AA 1DJ0A 5M2PA 3L7UA 2J6SA 3J7Z5 2APOA 2CPIA 3OUYB 3KLGA 1PBAA 5GMDA 1S59A 1X9SA 3W9HA 3MUVP 4RO0A 4EK2A 3NGUA 1EARA 3OTEA 5IXUA 2C22A 3IMQJ 3GJSB 6FDRA 3RW7A 4MIAA 2CQCA 1S79A 3W2VA 4A8SA 4RKUC 1RA7A 1SC4B 1U26A 1B70B 5DS7A 2GA7A 1JIHA 2F9DA 1LFWA 3FCVA 4UTGA 1J5EF 3VR1A 3NMAA 4X66F 3IBCB 2CQGA 3ET6B 3ADAC 2DRBA 3C14B 4KTQA 1DLOA 4ANCA 4PYDA 3GG0A 2QIFA 2LA6A 1Q4RA 2DHAA 4ANEA 4YN3B 3NOYA 4Q8EA 2K1RA 5E3PA 1XMOF 2X7IA 4LIRA 4X4OA 1XN9A 1KC8T 4UY8T 3BN7A 4LR7A 2W9CB 4G1IA 2WB1D 4KR0B 3G82A 4J9OA 1F2GA 2W2MP 1MN9A 1L3KA 3VF0B 3LP2A 1AZSB 1U02A 2C3OA 5GAGU 3LWMA 3PR5B 4DZDA 1N34J 5C7PA 3CGIA 2XSJB 3M32A 1HD0A 2BE9B 2GVZA 4HEA9 5ADZA 4WFZA 2DNMA 1SKUB 2FHJD 2CYYA 2J9DA 3ULHA 2VPZB 5L1JA 2E5GA 3DLKB 3K89A 3OLBA 2XM3A 3H90A 5DJBA 2OEMA 1T9XA 4LF1A 2R7XA 4QR1A 3H5XA 5MAOA 2P8IA 5L9NA 2GHWA 2VC0A 5EX3A 3QRQA 2W2OP 4HR2A 1U47A 4UQTA 3QT7A 4DFMA 1UWBA 2RS8A 5A8RB 3ILJA 4NI2A 4OX8A 2DR9A 1CC8A 1FVQA 4J9VA 5J2PA 2UUWA 4DR6J 5M2UA 4Z7YA 3M8RA 2GJ2A 4S3DA 3W62A 3SQOP 3HSJA 4NZ0A 2CIMA 4F4AA 2FJDB 3PKYA 1AOPA 3G71S 2UVWA 5FD1A 2D3OR 4ED3A 1UA0A 1BY9A 3EDQB 2EFNA 5L8RC 3M6WA 4R5PB 2ZITA 4I2PA 4PXEA 1QVFR 2DO0A 5KG0A 3HHEA 2RRBA 1S6UA 4UOFA 2VG5A 2HFUA 4ZIVA 4J37A 2V5HG 1RSCA 1JNZB 2LEBA 1F3FA 3ZTSA 5HP1A 3UDLA 1NK4A 2V9WA 3L4BC 4S3EA 2B9EA 3OPKA 2YWHA 1KDNA 4RBUA 3OL9A 1FKPA 4X4TA 3H20A 1ZZFA 3JQMA 2HS4A 3SV4A 2B3TB 2HHUA 4LFAJ 2RU3A 4Y0FA 3MPWA 1YGYA 4OYOA 1VDHA 2XI2A 3TAPA 3DLBA 1Q5YA 4U7UK 1SL1A 4X4PA 4IFVB 2KH9A 3E8OA 2OPQA 2QA4S 1DBDA 2OLWA 3CJ0A 4K4VA 5C42A 1QDUB 1OSDA 2MY7A 5JXSA 5DDRC 2J7KA 3ZC4A 4EBEA 1SV5A 2RD5C 5IM0A 3G96A 3LPEA 1UW4A 3PNIA 2V4JB 3MECB 2R3VA 4ZJLA 1X5OA 1YLXA 3JTNA 2G13A 4Y2AA 5HJYA 2CDQA 2GW8A 3IWLA 3OBIA 3TVZA 4KAIA 3LW5C 3Q2SC 1Q78A 3Q8YA 4C9DA 1TK8A 3PEJA 3OTCA 1MMDA 4I7FA 4B3SF 3T5KA 1MU2A 2XZTB 1UAWA 2HIYA 3FSYA 2DYAA 1UA1A 4JI5F 1YJNS 1U2FA 1H98A 4M1KA 3FRZA 2GEPA 2YWFA 1NJYA 3PX0A 4DCJB 4P52A 1WEYA 2H51B 1X5PA 2OJ3A 1ROFA 2ZNZA 1BQXA 2WSFC 4LRDA 3FQLA 1F9EB 2BW7A 3VKQA 1SJRA 1IKWA 1N36J 4P2MA 1TK5A 3MAAB 4LSZB 2ZZMA 2VDHA 2AJ4A 3D6FB 3TO8A 2ZBCA 4NEYA 2QG9B 4P72A 2H5IB 1CJTB 1S72S 3C16B 3N4WA 3FDSA 2UP1A
chains in the Genus database with same CATH topology
5KFXA 1RT6A 3F41A 2IM2A 4N8OA 3DRYA 4Y28C 5LL6d 2PC6A 2PFFB 4X62F 3I87A 3S6EA 4Q8FA 3TOQA 3D1QA 3QMQA 3MURP 4IRCA 1XNQF 1TV6B 1EETA 1QAXA 2DGXA 2VD3A 5EWGA 1RP5A 3KK1B 4YHHF 4RW4A 2N7CA 4CO4A 3FMWA 3NMRA 4PXDA 3W2VB 1LXNA 4G3IA 4X4VA 1LW2A 3DYAA 3BSAA 1U7LA 5CCLA 4MK7A 1Y7PA 1KHWA 4DQSA 3DRRB 2RVJA 1R0AA 2HZCA 4HI2A 2DGSA 3Q8SB 3AHPA 4QWCA 2EBGA 1UVLA 1W2IA 4N56A 1U6FA 2YY3A 1IKVA 5J1EA 1SIWB 3LALA 5U47A 3ZZRA 3UD3P 5KFPA 5DRKA 2VFUA 3T19A 3KMQA 2EPIA 4ZVGA 1CSJA 5CQGA 2I1RA 5B09A 2XMTA 1DHMA 2FJAB 2X1AA 3CDWA 5D8HB 1YWXA 4HI1A 2GFFA 1TKDA 1VQ8S 2GNKA 4MMOA 5DM7Q 1DLOB 4USIA 1U6BA 3A8EA 5EGYA 1VC5A 2J0QD 2GCFA 3HLUA 4HLBA 3CCRS 2P5VA 1HNXF 4QU7A 1KLMA 3IRXB 4O3QA 5T7LB 1IN0A 4QZVB 4NMLA 3LF0A 3M30B 4ZP9A 4FBUA 3LANA 1WWHA 4DR7F 1F0XA 2KXHA 4QBUA 5E41A 2XMUA 3VWSA 4FXDA 2K1RB 3ICLA 4LJMA 2CZVC 3DLEB 5K8MA 4B3OB 2DNPA 2UXCF 2KB2A 3NLCA 4FXVA 1N0VC 3BGRB 3NNHA 4OI6A 4RX6A 1HW9A 3MM7A 4ECTA 4F25A 1B7FA 2XBPA 3B0NA 4DUYF 3NG8A 3I31A 3MHYA 3PHEA 4LUBA 1R8PA 2C42A 2YKQA 4X4SA 5DG9A 4JV2A 1AROP 3K5OA 3H5YA 1IM4A 3S7RA 2EFVA 3QZ7A 4F67A 1B0TA 3PW0A 3TW0A 4C4WA 4NYPA 3MMAA 1EP4A 1FVSA 2YWKA 3O6QA 3D0HE 3OFHA 3FCHA 4CT9A 2MZJA 3HVAA 4GO7X 3LP2B 4MFBB 4QU6A 2D9PA 5LT5A 3CXCR 1TKTB 1YHQS 5B7WA 1S97A 1YI2S 3SYZA 2MZQA 2ZBIA 1A7GE 3TA1A 2ABYA 1UFWA 3OW2R 4WKYA 2E29A 3DCAA 1IBMF 4URQU 1T05A 2UVUA 2NPIA 4L3NA 2V4RA 3QO9B 4LVOP 3CVKA 1V3SA 1Y5NB 2J0WA 1S4FA 1S7HA 2XY7A 4NZ7A 1C1CA 1JJ4A 2KT3A 4QJVA 5D3GA 4KKOA 3N6NA 4PG6A 2JJ4D 2UUAF 4WCEQ 4FF1A 1VRTB 2IM1A 4WU3A 2R9LA 4ED5A 4GKKF 3ITHB 2M0GB 3M32B 3OL8A 3CSKA 2K7JA 4HDHA 1LXJA 4HTIA 4HTJA 4K5RA 3LH2S 4CQ1A 3PIOQ 3GV5B 1I94F 2KXFA 3D0GE 4H4KA 4M94A 2LYVA 1Q1KA 4I6YA 2W7OA 4FS1A 4J9LA 5EUHA 3PDNA 4ICLB 4B3TF 5GAHI 2YWEA 3KHLA 4ECRA 1HBOB 1RWUA 1VMBA 1FDBA 3DU6A 2FHMA 2HNDA 4RLEA 2W9BA 3D28A 1S1WA 2GMLA 3SCLE 4CNYA 2BJDA 4IOCQ 4WYWA 4B02A 2MJNA 3I0RA 4P7VA 4DUZF 1FJEB 4FS2A 1UJ5A 1URRA 4E0DA 1Q7LB 3PV8A 1RT5A 2CPZA 4KV8A 1U1OA 5BR8F 1N8RT 1HI8A 1U25A 3R5DA 3UR3C 4CCHA 1X4AA 4YB7A 2MJUA 5THWA 1D9DA 2Z8QA 1Q81T 3O44A 1VQ5S 5KG7A 1KD1T 4RU2A 3BGFA 3RRGA 1X4GA 3FEYB 3Q24A 2OPPB 5IFMA 4JI8F 2DNNA 2D74B 2YKMA 4EGLA 2WSCC 3MM8A 4OX9F 5K8OA 1VQLS 3IR5B 4E98A 4J9PA 3PXGa 4ECUA 5LSOA 3PO4A 5DQHA 1RJJA 4RNFA 3H40A 1FKOB 3VQTA 3M2VB 3NP5A 5EDWA 6FD1A 3CC2S 1UWBB 2IRXA 2DNRA 4ATNA 4OZ5A 3RAXA 3KTQA 5F8JA 2EVZA 2ZVSA 1SQEA 4WFBQ 4ZHRB 3ENVA 2HW3A 2DTJA 1R8HA 1QSSA 2I38A 2KG1A 2IAJA 2VA3A 4QIGA 2N7YA 2EC0A 1HBUA 1ZAXA 4ZCLA 5I3UA 1JLBA 1RT4A 1WHWA 2E7XA 1VQSA 3EPGA 2XG8A 5J2PB 2XHWA 3EPIA 1URNA 4WE1A 4ZPBA 1V3ZA 4F26A 3B78A 1Y5IB 1VQ4S 1IJFB 1C4CA 4KO0B 4ZPAA 3IS9A 2QSWA 4OJGA 3GE9A 2YKNB 1LFPA 5BJRA 1Y0HA 5CA5A 2MKSA 2ZHBA 4ETZA 2J9EA 1X4HA 4OLOA 3CJKB 3KMSA 1Q86T 1NJZA 4MIBA 1HFEL 4OJ3A 4ECYA 2MZSA 2VV5A 1HNWF 4OHWA 2B4PA 1FTCA 2B6AA 3FZBA 1BQMB 4TNOA 2AF6A 1DQ8A 1ZM9A 3LOUA 3V6DA 4UQGA 4B3RF 4HYKA 3IG1A 2QRRA 4HT7A 1RAJA 2CJ9A 1WD6A 2HLUA 2YVSA 2LU1A 1R89A 4RW7A 2HNYB 1UFLA 5KFUA 3MEKA 4CO2A 4QWEA 4PUOB 2K3KA 2AYBA 3GV8B 2YNIA 1RT1A 4LFCF 2YNHA 1U1NA 2YKAA 2PSZA 3L7OA 4DQQA 1S9FA 3KK3B 1QAIA 3PJWA 2A2CA 3IWNC 4N47A 2VPYB 4G39A 3O8WA 1T03A 1JLAA 3OXLA 4PWUA 3G8SA 1IBLF 1VQNS 4WFYA 3V6KA 2DNYA 3AB2B 3MM5A 4H4OA 4H54A 2BR0A 2O66A 4C3MA 3AJ1A 4I2PB 1YJTA 4PG5A 1KONA 1X0FA 4DV1F 3V81A 4FF4A 2CPDA 2VB6A 5K8NA 1TVRA 2VOPA 3KLIB 2N4DA 4B3MF 1C0UB 3PW5A 3FEZA 2MZRA 1CEZA 1D9AA 4OHYA 4V19J 1R8CA 2GMJA 1K73T 2ADCA 4FNHA 2CRLA 4ZP6A 2LDIA 1UVNA 2OPSB 1H2VZ 2C2DA 3I55S 3IGNA 2VG5B 4WFNQ 2R7WA 2AYEA 3GFXA 2XMMA 1HNVA 2CFXA 2PE8A 4G1QA 1GH8A 4RW6A 2ZUGA 4A8FA 3WX4A 4WXOA 3M2RA 3TVYA 2DH7A 4K4YA 3MOJB 3B0LA 5HP1B 5J2MB 4TQSA 2ZC3A 1J5OA 3BR9A 1HMVA 2Z0GA 1M5PC 4KPYA 4MH8A 3GFYA 4RW9A 3MWBA 3O3LA 3VM1A 1JMTA 2DGWA 2ZOFA 3L09A 1LW0A 3UPFA 4EUVA 2XS2A 2HRYA 1RT7B 1FKPB 2WHOA 3I5BA 4OMFG 4Q2MA 4KC5A 4YMEA 2CQPA 1DQ9A 3MEEA 4QR0A 4M5DA 4ED7A 5KOXA 2BV3A 3RB0A 2KM8C 2UXBF 2DO4A 4F4WA 2UUTA 2CQ3A 4FF2A 5L39A 1D8YA 1Z1ZA 3CO9A 1WHVA 4GKJF 1FRJA 5DM6Q 2MGZA 1LWFA 4IFYB 3Q8PB 4ZDNA 2HAIA 2F1FA 4Y2CA 1SB6A 2LA4A 2CQDA 1VS3A 3US5A 1NJXA 2NYIA 4UUWA 3GEOA 4WK3A 3DXBA 3VLYA 2XMJA 2FLNA 2RQKA 2AJFE 3WC0A 3RB4A 4PQUB 1JLGA 2E1CA 4F3MA 2JC0A 4OLPA 1QSYA 4W92B 4AUKA 2P9CA 4DJBA 3TAQA 5CZVA 4F3QA 5KG3A 1C0TA 2AGOA 2JVRA 4CT8A 4C2MA 3LAKA 3CULA 1FKAF 1RT3A 4O4GA 5JVGQ 2QEXS 5KFOA 4NCGA 3D2WA 2E7WA 2XSFA 4QWDA 3ZZTA 2QV6A 2IA6A 4QIFA 2VPWB 2OPQB 2MQQA 4DN0A 4IDKB 4A8XA 2V94A 4NRTA 3DFEA 4TY8B 5F0WA 3SXLA 1DARA 3AA9A 4KB7A 3M6UA 4B9LA 1VRUB 1LWEA 5DLGA 3QLHB 1HA1A 2KYXA 1S99A 2EG1A 4BS2A 1E6YA 2K8GA 5C42B 3OJUA 2F40A 4G9PA 1S0OA 4A47A 1PC5A 4PWDB 2DNQA 5LSLA 2AGPA 3HHDA 3Q8QB 2F8MA 4H4MA 1S1TB 1KQGB 3KK2B 2JOQA 4WYLA 4XIUA 5D77A 3BSOA 4Q7AA 1S1XA 4FPRA 4WK1A 3HVTB 2KHCA 3DLJA 5CHCB 5DDQC 3QWUA 2OTLS 1DTTA 4DV0F 5E3RA 2CZ4A 1G3OA 7FD1A 2R8JA 2J9CA 1XNRF 1XWLA 1N34F 1SV5B 3OTBA 5A6PA 1FDDA 3NCPA 4DOZA 1CG2A 3G86A 5EWEA 3KJVB 3IRWP 1N5YB 3OXFA 5IM0B 2ERRA 1C1BA 2NZ4A 5KFGA 5KFHA 4DHVA 4EO8A 3N6LA 4TYAA 2PA3A 4W90B 5KFDA 3CJ5A 2Q3PA 1VQ7S 3DRXA 2XS5A 3F44A 2GGPA 3CMES 2PMHA 5HBMA 2AJQA 1T3NA 4YQWA 2A3JA 5G4DA 4IYQA 2FGCA 2SXLA 4DSLA 1UKUA 4NLRA 3SFGA 2JEGA 5KT2A 3RYLA 5GVQA 3KFWX 3X1LB 2UZAA 4AXJA 1RQ0A 1FK9A 2BE2A 3I0SA 4NRUA 2XNRA 3GG1A 2RKIB 2FLPA 1UVIA 4X65F 3VLXA 2FY1A 1RTDA 4KFBA 4QIEA 2DD8S 2C3UA 3KG4A 1MNEA 4NOHA 2XGQA 1REVA 2DJWA 2R4FA 1P1TA 2YKOA 2B9YA 2CJKA 2VFTA 4TYBA 2YQ3A 3BB5A 2OSQA 5K8PA 2DK2A 5GAHU 1H7WA 2EFPA 3PEHA 2DH9A 4CO5A 1TFWA 4LSNB 3MUMP 3OV7A 3I5AA 3MFHA 4KIAA 4ED1A 2D3UA 3FVYA 4ELUA 6GEPA 2MQLA 2BQ3A 3TA0A 4O3SA 3N9UC 1N32F 4X4RA 1FJCA 2AJ0A 4D3HA 4I7FB 3HHNB 5AXKA 2RRNA 1VQKS 3MD1A 1WHYA 5L1IA 4DSJA 4DL0C 2DVIA 1N5QA 2B5JA 1MU2B 5HLFA 3KLFA 2L9DA 4YP3A 1VC0A 1NK6A 2DT9A 5FLXY 5D4PA 4I2QB 5DGBA 2BW2A 3POTA 5GAEI 2OMOA 1QUVA 1RA6A 1KFDA 2BDPA 5CXTA 3QZ8A 3EXCX 5F8MA 3V6JA 2CQIA 3KWMA 3I96A 1HHSA 3RTVA 4DR6F 2CPXA 4LF7F 4BWJA 5KOWA 2OAUA 1N88A 2CQ0A 3FQKA 4I4BA 2BANA 5AE2A 4WXWA 3BM7A 2FLOA 4L72B 4DPOA 5HQ8A 3SFUA 2K7KA 2X51A 1NKBA 3T5LA 4QCLA 1OQ3A 3B82A 1P6TA 2A1BA 4NLDA 2OPRA 4JBCA 2PD1A 4L6V3 3VZHA 2L9WA 4R25A 3OR2A 1NEEA 3DDKA 1WHXA 1HBMB 2MMYA 2XC9A 2M9KA 1RYSA 3CCMS 3MMCA 3PRBA 3HVWA 4IRKA 4RZRA 1S1VA 1IXKA 3PKMA 5I3QA 3JYTA 2HNZB 5BYSA 1N48A 5HROA 4NLVA 2HGMA 2P6SA 4RNHA 4ED6A 1T7PA 3RR7A 4DL6A 3AJ2A 1IKWB 1HPZA 3MOZA 2HVIA 2P9EA 4NLTA 4BCAA 1Q8IA 1SH3A 1FDAA 4I6AA 4I64A 4RUHA 4ERDA 4HKQA 3SSSA 1YTYA 2ZH6A 1K1SA 2DRAA 4M8LA 2DITA 4DQPA 1X5SA 2MZTA 1RTHB 2DHGA 3TAMA 3OQ2A 4BWMA 5H1SV 5F0UA 1IKYA 5CYMB 3MTJA 2ASYA 3T9NA 1GX6A 3LP1B 3DRPA 3K57A 4USJC 2DBBA 3HDSA 4ED8A 2MYFA 4BDPA 1HWIA 4F4ZA 4ZK7M 4IRDA 2D41A 3BJYA 5KT5A 1SJ3P 2ZOGA 3PACA 2QA1A 2XZWA 2WONA 1RT6B 5C24A 1MMLA 2LKZA 3P6YC 1X4CA 1M0SA 2QZ8A 3K5MA 4ELTA 4BC7A 2BVZA 2M7SA 2ZH8A 1YBAA 2MQPA 1EETB 4N41A 1I1GA 1SBRA 4LF4F 4RW4B 1GT8A 1S0NA 3GFHA 4NA1A 2KN4A 1LW2B 3DYAB 2RQCA 5LMNF 2ASLA 3KNAA 3I9V9 3DRSA 2HHTA 1FJ7A 3ZZOA 1RISA 1SXLA 2XY6A 4K4UA 3CWJA