4S38A

Ispg in complex mecpp
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
401
structure length
400
Chain Sequence
MRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Oxidoreductase
total genus 139
structure length 400
sequence length 401
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s38A01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s38A02
3H21A 1Q7QA 3MMCA 2V4JA 3MM9B 1Q8AA 3VM0A 1AJZA 4D9PA 4AOPA 4DJFD 2Y5JA 3MM6A 1AD4A 3MM8A 1TX2A 4D8ZA 3VLYA 2YCIX 4HB7A 3MM5B 3B0GA 2XSJA 3H2NA 2AKJA 8GEPA 5AOPA 1Q8JA 2H9AB 4C1NB 2VEGA 3H2EA 4MWAC 2Y0FA 3H24A 3VM1A 6GEPA 3MMBA 3K13A 3B0MA 4MWAA 3VKPA 1F6YA 1TWZA 3H2CA 3H2OA 4G38A 1EYEA 3H2AA 3H26A 1ZJ9A 4S3DA 3TZFA 2DZBA 2XSJB 3B0LA 3MMAA 2YCLB 2AOPA 4DJDC 2VEFA 4CCZA 3MM7A 2OGYA 2YCJA 3MMBB 4O1FA 3TYDA 4DAFA 1Q7MA 4S23A 4DJFC 3BOFA 3MMCB 2V4JB 4NL1A 3B0JA 7GEPA 4HTRA 4NHVA 4DJFA 3MMAB 4S3BA 3MM6B 3OR1A 5JQ9A 1TWSA 3TYEA 3MM8B 3OR2A 3MM7B 3B0NA 3H23A 1AJ2A 3VKSA 4DJEC 3TYUA 3VLZA 4O1EA 4G39A 4S39A 4DAIA 4DJEA 2DQWA 4S3CA 3GEOA 3VLXA 3AOPA 4MWAD 3TYCA 1AOPA 3OR2B 1TWWA 3MM9A 3VKTA 4DJDA 4MWAB 3H2FA 3TR9A 1AD1A 4GEPA 4S3FA 3VKRA 4PZVA 3B0HA 3TYZA 3VKQA 2YCKX 1Q85A 4DB7A 2GEPA 1Q7ZA 2DZAA 2Y5SA 3MM5A 1TX0A 4G9PA 3V5OA 2H9AA 3BOLA 4C1NA 3NOYA 3TZNA 4S3EA 3MCNA 2VP8A 3H22A 3MCOA 2E7FA 3OR1B 2BMBA 4S3AA 4NILA 3TYAA 4DJED 2YCLA 4MWAE 4O0QA 1AJ0A 3MCMA 4NIRA 3H2MA 5GEPA 4DJDD 1ZJ8A 4D8AA 3TYBA 4S38A
chains in the Genus database with same CATH superfamily
3MM9B 4AD5A 4A2RA 5KZEA 5K2ZA 4PULA 4B91A 4GKLA 4NZ3A 3N04A 1PS9A 1UWQA 2OLSA 1A0EA 4MNLA 4UTUA 5H1WA 4GQBA 3NFUA 4P8XA 3UWQA 7REQA 4PTDA 3W37A 3IGXA 1LL4A 4KF1A 1UIPA 1PZ1A 5CC7A 1LBLA 3N25A 3LI1A 4LRTA 3VNIA 3V0SA 4ERIA 2YGYA 4U5IA 1TPH1 3CNYA 2XH2A 1XLFA 3GDLA 1EJUC 4IIEA 1U5HA 4O0KA 2PDPA 1E6RA 4E8GA 3SQMA 4HYWA 1YNYA 2G3NA 5BOOA 1ZJIA 1BG4A 2NVAA 2YKKA 3N73A 4HP5A 1JQVA 1Z41A 4ZCWA 1TREA 4AZHA 3VD4A 2BGQA 3S3GA 3BW4A 3GUGA 3W27A 4AW7A 3I7RA 1KXVA 1Q13A 4G5DA 2PEVA 3HBLA 3APTA 1XM3A 1T40A 5G1YA 2VP8A 1VYSX 5FEXA 1RZMA 1DHPA 3HGRA 2GFTA 3Q2DA 5KZMA 4UOQA 4PSRA 2V2DA 3GB6A 4WJ8A 4DI8A 4HIBA 4D8AA 4MPKA 2WXDM 3NPXA 1PCWA 1J8VA 2WNNA 2YB1A 4RPPA 1RPKA 2GUUA 3MO7A 4OIFA 1ZUAX 3KRBA 1KTBA 2Y6ZA 3H2NA 3MJMA 4YMZA 4DQWA 4PMZA 3EOSA 4IOTA 3VE7A 2VEIA 5LIKX 3LMZA 3UPWA 3FKKA 1NU5A 2HROA 4J7RA 1B3OA 1LZOA 3WF4A 1W1A1 2PRLA 4KCUA 3IGUA 5D02A 5CSSA 3URBA 3HMJG 3QQWA 4HNCA 1K9DA 4DVOA 1G4SA 1TPWA 4GISA 5FJPA 2C1IA 5BU6A 5GPRA 3F1QA 1N82A 4JGDA 4H8HA 4XAZA 2ZTKA 2O9OA 4Y6GA 4EAYA 2J88A 3S1VA 2UY2A 5JUVA 1EHNA 5AHFA 2PWUA 4GFIA 1M7XA 3GDTA 1J18A 3PJWA 3KL5A 5FEZA 3UU0A 4YYFA 5LHFA 3VIGA 1A3HA 1JCNA 2CPUA 2RKXA 5FF4A 3TOPA 3PPCA 4GQ0A 3TTSA 3UZXA 1YIXA 5DELA 4P61A 4JDYA 1XYZA 3UESA 4S2BA 5E1QA 4OTKA 4M6VA 3UXIA 3GY1A 3W6LA 4ZO7A 3LXCA 4TX8A 4C7DA 4M3PA 3R4IA 5IDZA 1UUQA 1MXSA 3MUXA 4NP7A 4GIEA 4QNWA 2QF7A 1QW8A 2NV1A 3VM0A 2QCHA 4GHRA 3AIRA 4RXGA 1HF6A 3KOFA 4WVXA 3NO3A 1PWMA 1ITCA 2PTXA 2I5QA 3O0FA 5DFAA 1VGAA 2HZGA 4I90A 4K8HA 3G77A 1VCVA 2DSKA 3SIMA 4B5NA 3HQOA 1E43A 3UR8A 1Y8BA 4TU1A 2C0HA 1SZNA 5I24A 1XIMA 1GG1A 3URNA 3W1MA 3MDWA 3OG3A 5EPDA 4ZE4A 3AS1A 4LX4A 5FF2A 1DP0A 3RM4A 4GK8A 2W4XA 5I3KA 2ZUSA 3WFLA 1P0NA 3K46A 4E2OA 3H70A 4ZFCA 1NFPA 3GG0A 5HJXA 3LA4A 1SU5A 3N9SA 4GZIA 2JALA 3SRHA 3DFPA 1DWFM 1WDWA 3IEBA 2XZ7A 5I78A 1J2BA 3KWXA 5LNVA 3T0TA 5DY2A 1TTJA 1RQHA 1E40A 3MU7A 2WMJA 3EOLA 4LB4A 2DZAA 4TVDA 3HPAA 1G9HA 1VCFA 1HJXA 2A1YA 4AEEA 3VOGA 4WKFA 4TUFA 2YZRA 3Q65A 4C1LA 1K4GA 5EB8A 2FZMA 1DKWA 3DBPA 2D0GA 4C91A 3CM4A 3EGJA 1JL8A 5JBDA 4QE1A 3S1WA 1Q8AA 1LCOA 4Z1CA 1UR0A 2C6QA 1UD4A 3MM8A 3ITGA 4XIAA 2E3ZA 1LYXA 4ZSTA 2F61A 3UVIA 3PN8A 3B0XA 3NQMA 3LZ3A 1TSIA 3JVAA 3CUIA 3P67A 3LD5A 2ESCA 1OADA 6XIMA 4BKNA 5CBIA 4D1IA 1X8CA 3EB4A 1MVYA 2EJ1A 5D09A 2ZIDA 1XYBA 2W9MA 2PZ0A 3LS9A 3GH7A 4FNTA 1MQQA 1OCNA 4W86A 4EXAA 1JDDA 1R3SA 2I17A 3E6EA 3L9CA 3EPOA 3WD1A 4FX7A 3KUMA 5FJTA 2CETA 3HJEA 5FKYA 1CW2A 4MYXA 3WEZA 3RG6A 4F0SA 5EU9A 3R2GA 4HPHA 4KFPA 1E9IA 1A50A 3TOYA 3SN1A 3LHWA 3A4XA 4MFEA 1TJ2A 2ZWZA 3DFOA 2GJXA 1JAKA 4GEPA 3LZ5A 3O1NA 3RDKA 1C8YA 3WMBA 2VFIA 3GHSA 2JBMA 3DFYA 3LBCA 3NPWA 1VBGA 3A4JA 1SFSA 3KL3A 3PAJA 1F7BA 3MZNA 2QCGA 1MDRA 5C8BB 5H91A 1OZMA 5LXXA 1WYIA 2FZBA 1TCDA 5HQEA 2ICSA 1AMYA 3T2OA 4DO7A 1V6XA 2ZRWA 3WD0A 1BXNA 1Z69A 4CCCA 1F2JA 1HT6A 3GE7A 4AXNA 1XINA 4GI6A 3FYYA 2WV8A 3N4AA 5CPLA 5E6ZA 1UKSA 2D69A 3BK0A 1L8NA 5GJNA 4YWSA 5HMEA 5AC7A 4ZBCA 2W6RA 1QHPA 2IKIA 4DELA 1JG9A 3VPLA 1TV5A 4HZ8A 2GUBA 1H51A 3R0UA 4GG9A 1OFAA 1XKYA 1GVEA 1V4YA 3M0IA 3SM0A 4B5UA 3A47A 4GI4A 4Q8MA 5D9OA 2V3DA 1EHAA 2VGIA 3DFHA 2P8BA 5TBOA 2PB1A 2CCRA 4Q8UA 3MM8B 5U4NA 2FZDA 3P74A 3WNOA 4WGXA 1PX8A 2OOFA 1B2YA 1I9CB 5JH2A 4KEMA 4UOJA 5F7UA 1YDNA 2P3ZA 3DDMA 4XTDA 4JY9A 3W72A 4CQCA 1SYTA 3N2XA 3L68A 4PCFA 1QHOA 3WK1A 3N12A 2OZTA 2JE8A 3RR1A 1A3XA 6REQA 4HHLA 4R5EA 4TX6A 4UFMA 4RDWA 1TA3A 4MSSA 5K3VA 2G3MA 4UQAA 2FMNA 4IICA 4O16A 1SMAA 2Z29A 5AKQA 3ZFHA 1XHGA 1LWIA 1WBJA 2QDDA 3E74A 3VGEA 3CV2A 3H22A 4V1XA 1A80A 3D0CA 1TV4A 5E0CA 3W25A 2ZZ1A 2NUWA 2ZX5A 3MCMA 1W5NA 3P82A 3AXMA 2QULA 4LF2A 3W7OA 3HMCA 4FXFA 2R9RA 4AFYA 1R2RA 2GJXB 5FL0A 3BOXA 1VEMA 3QPEA 4HA0A 1EIXA 4YTRA 3PZOA 1ZQ5A 2CU0A 3BURA 5HUPA 1EC9A 3M4HA 4JQ1A 3AC0A 3QQ0A 2F84A 5H2ZA 2NX3A 2PGFA 4DWSB 4IPPA 2FIQA 3BXWA 4JTUA 1CNVA 2GSJA 1ZNNA 4ORMA 1YLVA 3K1GA 2NX9A 4XUYA 1RQEA 5AC6A 3QW4B 4XBSA 1PIGA 4UFJA 3T05A 2FHBA 1O7AA 1BTMA 2FTWA 1TJ0A 2YA2A 4DZ5A 2XTKA 3MHUA 5T91A 2PCQA 3KHDA 4UZUA 1J79A 1QNQA 3PBYA 3GSMA 3QLDA 4JHZA 1H41A 2YYTA 2OSWA 4D8LA 1UUOA 1J96A 4K6AA 1VFTA 3GH5A 4DZIA 4OBRA 5CAHA 5A1AA 4DJED 3NURA 2PFHA 2X42A 4ADUA 4LB3A 3IK4A 4Y8EA 4PFHA 2DORA 5LGXA 4N4QA 3UQNA 2VXNA 2Y8UA 4GY1A 2PU0A 1PEZA 2WNZA 1TMLA 4PRTA 4HU3A 1TA3B 3IJLA 3N13A 3UZZA 4JAWA 4O4WA 2F6UA 3AICA 1R3WA 2TYSA 3MUZ1 2WB5A 3H2EA 2PDHA 1OFQA 3GDMA 5HWJA 3E2SA 3G3DA 1F6YA 3DYMA 1OC5A 3L0GA 3E2VA 3PTMA 1SFTA 3KFTA 2QCDA 4GUFA 3TEVA 1KRCC 4E0CA 3FVMA 3L2IA 2ZYFA 1A5LC 2NQ5A 2B0MA 2V3EA 4S3BA 4JICA 4O15A 2Z2UA 5EFFA 4RUBA 1GW1A 2V3FA 5C7HA 4Q33A 1MUWA 1DJQA 2IPWA 1H7PA 4FOJA 2A3AA 5I00A 3AZSA 4YCOA 1ZHAA 3AZTA 2G95A 1PVNA 2R1MA 5BOFA 2PC4A 3IK2A 4KRZA 4PMDA 2CYGA 1I0DA 1MZRA 3URAA 3OIXA 1PDYA 4IHCA 1M3UA 4GYKA 2ISDA 3OLDA 4C1NA 3LCHA 3WENA 4XZMX 5LHEA 4ZOAA 3L4YA 4WR3A 3WBWA 4ZB5A 1JF6A 2RHGA 1EF3A 4MWAE 4FHAA 4W85A 1UPMB 1V0LA 2HDJA 3R10A 3ATZA 2XN1A 1V3HA 4RW5A 1KRAC 4N42A 4ZR8A 5AHMA 3W29A 1H7RA 1LT7A 1WZMA 4Q4SA 5CH9A 3SFKA 1JYXA 4IMEA 2PA6A 3EEZA 1QW9A 6A3HA 1E0VA 1W3JA 1XCWA 3GDKA 3WO8A 2E9BA 3MMAA 4KETA 1E0UA 3QMTA 4XD3A 3BSHA 3RGTA 2FGBA 2NVDA 2V2HA 4KGLA 3GU9A 2JQXA 1ENUA 2QIIA 1RBOB 5JQ9A 3S6DA 3VKSA 2FVLA 5EYWA 3GYEA 4DAIA 3CPUA 4CQAA 3UYIA 1L6YA 2WYSA 4AY1A 7ENLA 4UQDA 3BG9A 2BS9A 5FCZA 1SZGA 2OODA 1V3MA 4TVCA 3W7IA 3GNRA 1EH9A 4PTXA 4NT0A 4GVIA 3CS2A 2QCDB 3PZMA 5TF0A 2HMCA 4O50A 5M03A 3KOWA 4CD4A 4YWIA 4LUYA 1U83A 4LAMA 1I1XA 2W79A 1XIBA 3SRFA 1H49A 4XBKA 2WJEA 4JZ5A 3QFEA 4DZHA 1FWGC 3E2QA 4H8NA 2TPSA 3AYVA 3MZ2A 4LTSA 1TYGA 1JPIA 1CENA 1XF0A 3QF0A 1XGZA 4C1NB 1E72M 2BODX 1CDGA 3SB0A 1H63A 1GKQA 4K38A 4H2HA 3IIPA 1XRFA 2E1WA 4J3UA 1UR1A 1L6FA 3MUCA 2QCFA 3BANA 2QJMA 1XLJA 3BMXA 4A2SA 1X1NA 2ZOXA 1EJRC 2H3DA 2E9LA 4JFTA 2VC6A 2QJHA 1QNPA 3VOIA 4A05A 1EEXA 2G4FA 3NQEA 2D23A 2H8ZA 5FL1A 1PX3A 2J7DA 4C6LA 2XINA 2OVLA 2WZEA 1F05A 4GGHA 1FCBA 3S8HA 4PCPA 2DUXA 1UR2A 1NELA 2R8WA 2NVCA 3RCMA 3I4KA 4HNOA 1NDWA 1K6AA 4N9BA 2X30A 2NWRA 1CECA 3PUDA 2ZKMX 2QHAA 4H3DA 1PAMA 3SSZA 2G41A 3IIVA 5IBXC 1XWYA 4QXIA 1MQPA 3MYPA 2Z6IA 1YW1A 1VYRA 3OEXA 1MI3A 5D03A 3VXGA 3C3NA 1GTHA 1BG9A 2PWGA 4BF7A 1VR6A 1Q3NA 4ONVA 6PTDA 1DXFA 5BZAA 1WKYA 3B05A 1JXKA 3I7QA 2WSPA 3G0UA 3FJLA 2PRHA 3P2VA 2XHYA 1D9EA 5FAJA 3KTCA 3R94A 4JTHA 4XD6A 2XSJB 1B90A 1R8LA 3H7UA 2AQWA 4E4PA 2XM2A 5D4YA 4O1FA 1OK4A 1DQXA 3S6TA 2WLYA 1PJ9A 3RU8X 1JYVA 4J28A 3ARYA 3ZR6A 4EPBC 2Z4GA 4JR5A 3D6NA 3W7CA 5LIYX 5BCAA 1C8QA 4C6PA 2X2YA 4EOUA 3AROA 4QEHA 4AZ6A 1X98A 3W38A 1S2AA 4LT9A 1LUCA 3AOFA 5BXSA 3QPZA 2OX1A 5G1MA 2X0YA 3W73A 4L9ZA 2XGZA 5I3DA 2VENA 2YXOA 2D73A 3AMKA 2QPXA 1ZGDA 3W22A 4E2VA 3AXXA 4J2PA 2ZZ4A 3VUPA 5JIWA 1KXQA 3PBUA 4I9MA 4U4MA 3EMCA 2TRSA 2DZWA 2O4QA 1TWIA 4H41A 3FK4A 3GXMA 3EB3A 4GQGA 4FI4A 1VB9A 3SCQA 4GYPA 2ZTJA 1EO7A 1R0MA 1GOXA 3H53A 3W26A 6XIAA 1IF2A 3IANA 3N3MA 1SFLA 1SSDA 1TUXA 2AKJA 1FWAC 2VOTA 1BGGA 3GVRA 3WDJA 3H24A 5FJUA 4MWAA 5C6MA 3NL2A 1F6PA 4KWWA 3B8VA 5G4HC 2Z24A 2ATMA 2Z2BA 3GXDA 2Y62A 4PSPA 3FJNA 4NY2A 4OZOA 1W5OA 3R5EA 3T7VA 3E0WA 2ZX7A 2W62A 2Y4SA 3KBVA 5D2WA 3KBNA 1EFZA 3C56A 1KO0A 2XFFA 4A35A 3FXYA 4TTGA 4H9XA 4RCXA 2QCLA 3FNDA 2QVHA 4N0RA 3BJTA 4J3ZA 4AISA 1QI4A 4IMCA 1WNOA 3OHIA 4ZQNA 4R88A 4O54A 4G9PA 1BYAA 1Q4WA 3FA4A 2CHRA 3W9ZA 3IV8A 4ICNA 2JKEA 4G2DA 2FPYA 5EKYA 1UD6A 1KKRA 4J3TA 2FJKA 4IFOA 3E12A 5E93A 1XXXA 3G1AA 4LS0A 1DBTA 3V4BA 1QT1A 2X09A 4HHHA 3ABSA 2OELA 4W9TA 2C15A 3MSYA 1OEPA 2PLMA 1LUCB 3VO0A 1NSJA 2NXGA 1CXFA 3GUWA 5J8LA 4W87A 3FIGA 1K8ZA 3VNMA 4WIWA 4I5UA 4BWLA 2BY1A 3W7EA 3DU0A 1RH9A 3WBXA 3P0XA 4NUWA 3RM9A 3VNKA 1TV3A 4DJFA 2QCNA 1ITQA 3RN6A 1GOMA 2WHMA 1OK6A 2OKOA 2PWDA 3WLSA 2YA0A 2Q8LA 1K8XA 3AS2A 3WUBA 1LLWA 4DJDA 4MWAB 2YX0A 3T4CA 4H4IA 3GVVA 3UGRA 4ADTA 1BVZA 1FH7A 1LG1A 1JDAA 4JIRA 4YU1A 1GYNA 4MLJA 2QF8A 3UWWA 4FS9A 3G2GA 1HFBA 3MCNA 1AG1O 4CN6A 3STEA 4M51A 1VFOA 2ZUMA 3WQGA 2PODA 5T8GA 2OSYA 4N4PA 1MUMA 3NSNA 3LEPA 3AZRA 3HA1A 3O8AA 4X22A 2NV2A 4A3QA 1FFQA 1K8YA 3CL6A 1H4PA 4QDMA 3GD6A 2MUCA 2PC8A 4XKMA 2R14A 4Y9PA 2I14A 4D6CA 1FOBA 2Y61A 5A3HA 3UWVA 2VURA 4HGXA 6TIMA 2KX9A 2R82A 2I16A 5IXEA 4L4LA 5D9MA 3B97A 4QSFA 4NL1A 3AFBA 3B8WA 2J8TA 2QIWA 4JX5A 4DWDA 2VEPA 2OWCA 5LA2A 4QGCA 4D1JA 4HNNA 1SO4A 1SJCA 2BLEA 3WJZA 1UD2A 3CT7A 3KCJA 3P80A 3VK5A 4PN2A 4MM1A 1NEYA 4YVXA 3CYJA 1S5TA 4HQVA 2V82A 2DEPA 1DPMA 1YTEA 3ZT6A 2ISVA 3QGAC 3VC6A 4PTMA 3BLEA 1V7AA 4S3EA 2AKMA 2OT0A 3R79A 2Y2WA 4PMRA 4AY8A 1ISWA 4Z1DA 1ZB5A 4PL2A 5DCDA 4NAFA 3TC6A 3CBWA 3QBUA 3K8MA 3WJWA 3O6AA 5C2GA 1RD5A 1ALDA 1RVKA 3IPWA 2OMAA 4IL2A 4LJ3A 1O68A 4K39A 4PL1A 5CJNA 5GVJA 1OINA 4K36A 4MZ8A 1R38A 4K3ZA 3EKLA 5GJMA 3MMBA 4A4AA 2D22A 1CGTA 1HVQA 3S5ZA 3ZQ9A 3OLIA 4PB5A 3WF1A 4OQVA 3RCYA 1VFLA 1VEOA 3UG4A 3VM5A 1HJSA 3FYOA 3NUKA 2PBOA 3CEPA 3EMQA 1CI1A 1UMYA 5EMKA 2XZ9A 1DXIA 2IW0A 4PUJA 4ACYA 5I03A 3HPZA 3DCPA 3L23A 3CMFA 2HVMA 1EJWC 3EWUA 1Z89A 5I06A 5TAOA 3REQA 3ARQA 1QAPA 3K2GA 3BH4A 4OT7A 2X0HA 4GY0A 1UUMA 2GEPA 1UA3A 1N8IA 1QOPA 1QBAA 5ECVA 3KRSA 2EAWA 3PTQA 2XFYA 3OYZA 3BICA 1B3XA 4NJHA 5CG0A 1M03A 5CZJA 2WWDA 1UP2A 1JPMA 4PCTA 3P93A 1FHDA 5KEZA 2CWXA 5KTLA 5B80A 3GAYA 5M1TA 3WD4A 4IMDA 3WBAA 4UQCA 3W1PA 3C86A 2B4GA 4MNMA 5HK4A 1JI1A 2CERA 3W85A 3B0GA 5A6AA 4YTTA 4HNLA 3SY1A 1GONA 3AI0A 4ZB0A 3P14A 1UD3A 2QS8A 3W01A 1KBIA 4OFCA 1UMLA 4G38A 1R47A 2D2OA 5AVNA 4FA3A 6ALDA 4NAFB 1RP9A 1CIUA 1TFVA 3ARUA 1LQ0A 4IIFA 1NF7A 3ITTA 5CZKA 3L67A 4HPNA 4XD4A 3VKCA 3KXQA 4LUSA 3TKFA 2QV5A 5I6SA 4JTJA 4E3VA 5FACA 4LU0A 2NQHA 4FXRA 1J0HA 2UY5A 5CBJA 1Y65A 3VI2A 4MJ2A 2GLKA 1J10A 3KL0A 3XISA 2ZXDA 1CPUA 2P76A 1QI5A 1BWKA 1WAUA 1LWJA 1F4HA 4DF1A 2B7NA 4MGGA 2QJIA 3MHGA 1SW7A 1FVPA 2Z1BA 4LYRA 4LAZA 5AHIA 2FVKA 3ME3A 3FGCB 3DOPA 3VD7A 1R86A 1R9ZA 3A21A 1QDSA 1R3YA 3IIZA 1JR1A 3QN3A 4LVBA 2A0NA 3REQB 2J62A 3W2NA 1AD4A 4Z2GA 1XCFA 3KVLA 4LCRA 2QJGA 3U5UA 2B81A 4WJEA 3PZUA 2X8RA 2YDQA 3B9AA 3AWNA 4AWSA 2D3NA 1JD7A 3VKPA 4B4HA 1FWEC 1VHCA 3VD9A 1X7IA 1WDSA 2L5HA 1XLDA 2PDBA 3VFLA 3PJUA 3W1QA 5LNWA 4WD0A 4WGHA 3MSDA 2I5IA 2FGLA 1J0ZA 3W7NA 2Z6JA 3FYPA 3KLLA 3XIMA 1P7TA 3K4DA 1TPVA 5GJPA 2NLYA 1A4MA 2XVKA 5EGRA 3WUFA 1WXZA 4YTUA 3ZT7A 3VE9A 2HS8A 1PKNA 2ZA3A 3G18A 4WCJA 2GQ3A 1QI0A 3TJXA 4I9AA 3NQ2A 5AN7A 4LUSB 2VWTA 3S2MA 2Z27A 9CGTA 4IX0A 4FNPA 4JTFA 4LBUA 5IFTA 4RK8A 4ZQPA 2ZDSA 4CD7A 3WQDA 3TH6A 4QAIA 4AF0A 3E5PA 2ZQ0A 2CLPA 3SY5A 3M5YA 4F0MA 5I5RA 1GK8A 2RH9A 2ZX9A 1H61A 4HOZA 2PTDA 1UOZA 3SSJA 4O8RA 3BLLA 2EKGA 3BCFA 3N4FA 3ZWTA 1GQIA 4IQEA 5AOPA 4HA1A 2BHZA 2ALRA 3EPNA 4GUJA 2PDMA 4U5KA 1UKQA 1WV2A 4E2DA 4AAJA 1F4AA 1VLIA 1JNEA 4DJDC 1LORA 4ILSA 3IVSA 2DW6A 1K3UA 2GGJA 4JTTA 4W5UA 1P5BA 2Y1HA 3D3AA 3B0NA 1SFJA 4D6HA 1V3KA 3VA8A 3HG2A 4HU8A 2ZE0A 1QW7A 1TKKA 1EOMA 1A5KC 1B54A 5D2VA 3V16A 1VLWA 5C71A 2BV9A 3W7LA 1D7KA 1Q6LA 2ZDRA 5D9PA 3TR9A 4Y9AA 1HUVA 4RJEA 1A47A 1B4KA 3B3DA 4H8VA 3THUA 3CLWA 2WBKA 5KINA 1XP3A 2PRMA 2CESA 3GVGA 4HD5A 1N8WA 2PZNA 4B2DA 5FJRA 1TG7A 3M7SA 1RK6A 2NZLA 4C6IA 1JCYA 2VUYA 1AFSA 2BGNE 3P61A 3CB3A 1L2UA 4ZQCA 3CYVA 3F4NA 4W93A 3EPMA 1H7WA 2VGFA 1TQXA 1H1YA 2ZVIA 2ZZ2A 3H4GA 4AVFA 4ZB2A 4CVUA 1C7SA 1E6QM 1R3RA 2A3BA 3LCFA 1XIDA 1QPOA 4F4RA 2HEJA 3IUDA 3QMRA 4EWND 3QZ6A 1X6UA 3A3XA 4E8CA 5HNRA 1KQZA 1QUMA 4UTTA 4A6GA 3ABOA 3G0XA 3T07A 1EBHA 4H1ZA 3EZ4A 3L5MA 4P7LA 2XYLA 1WZKA 4AF0B 3GNDA 3N9RA 2GVJA 4GXWA 5AB3A 4HTBA 3EXTA 2BVDA 2NWSA 2VC9A 3WJYA 3TMQA 4PH6A 2CFFA 2WVUA 3V0UA 3TVAA 2OFJA 2J79A 1ZP4A 2J25A 1HW6A 4IPLA 3ATYA 4W5ZA 2ZE3A 4MY9A 2JK2A 2VFGA 4ZMGA 4TO8A 4BEQA 1CB7B 1KBLA 1O4UA 4JTDA 1CLXA 4E4UA 5CPOA 1W8SA 3EX2A 1B1YA 3KP0A 2D3LA 2VR2A 5D33A 3KBJA 4P2VA 3VINA 5A95A 4QE4A 1W3NA 5H8MA 1GQKA 3VDGA 3E96A 3B0YA 3M6YA 4JD4A 2V38A 1DJXA 3HOJA 1REQA 4HYRA 4WQ6A 1GNXA 3KTSA 4Z0SA 1E71M 2DQXA 4UTJA 5I79A 3VGFA 1S3HA 3SEPA 3VOHA 5LA1A 4D8ZA 3A5FA 1BGAA 1OFBA 1EO5A 1NWUA 1A5NC 3WQOA 5IOBA 2O4MA 3LXAA 3MMWA 3S47A 1GEHA 4AB4A 5HWMA 3S9YA 2BWGA 3L2MA 1TVNA 2A3LA 3HIJA 1Z3NA 3H26A 3SCUA 1GZ1A 3G1DA 5A6LA 5ABHA 1G5AA 3PC0A 3R8RA 3WBEA 4H9VA 3QSRA 1FDZA 2O0TA 1U5JA 1W3HA 3O7UA 1EC7A 1K9FA 1E5NA 3HG3A 3E02A 4FMVA 3HQPA 2AAMA 1KWGA 5JIPA 1OIFA 3GU1A 4MY8A 3W81A 3CWOX 2VKZG 1HIZA 2B7OA 1AQHA 3P62A 3LSCA 4TV5A 3AIBA 1V6UA 5CC6A 3ISIX 1XYMA 3STGA 1IT0A 2YW3A 1C9WA 1TELA 4LC6A 3TIMA 1K70A 1V6YA 4G56A 4PUDA 1RBAA 1SO3A 1EA9C 3VD5A 4IGNA 2BZNA 2PWHA 2PF0A 5C9ZA 4ZO9A 4AX6A 3OVRA 3RX3A 2E8ZA 1JYNA 1S2VA 3OVPA 1P1MA 4E38A 1UH3A 1V93A 5HMFA 1F07A 5CLTA 3CZJA 4DBSA 3I6TA 4O57A 1W5MA 1XISA 4HN4A 4JX6A 4L64A 2OKTA 2AMGA 1VFHA 2VEGA 3XINA 2WVVA 1UASA 2X1UA 4GVFA 4R9OA 3D46A 3UZYA 4EX4A 3ANUA 2E77A 2VRQA 1XLKA 1M41A 4QLKA 1AZ1A 4IGMA 3WF2A 1VRDA 4OV9A 2FTYA 2ZBTA 1BHGA 3ZJKA 2BHYA 1YQ2A 3FHAA 3O2LA 1EF2A 1O1ZA 2WNWA 3HGOA 3A3WA 5L6UA 3CQIA 2PD5A 3LLFA 3TTEA 5FJJA 4A22A 1XLMA 4NZCA 4J3WA 4DUXA 5BXRA 1JZ8A 2UY4A 3BG3A 5C9RA 5ENLA 3RPDA 4MJZA 2CBVA 2HK0A 3T1GA 4O0ZA 1ZCCA 3KZPA 4MPQA 1SZRA 3CAVA 1Y5XA 2F6XA 3HFYA 5BW6A 5D37A 1E1FA 3NQ8A 3H4XA 5FEPA 4RZBA 4Q7IA 4JN7A 3AYSA 1V3IA 2E25A 2XVGA 3N14A 5TD4A 3LRMA 3EKZA 2VELA 3S9IA 1QU4A 4ATLA 4LUTA 1OGBA 4S3KA 3VOCA 3U2EA 4YHEA 1KRMA 3MI3A 1OCQA 2G3JA 1AVAA 3SCRA 4B3ZA 2DUZA 1KFLA 5KETA 3CPRA 1Q4NX 1V6TA 4EPKA 2WBGA 3DG6A 1KV8A 4AZGA 3DG7A 3WH9A 1MUCA 3U2ZA 2XIIA 4AQLA 3QR1A 4R7WA 5EL1A 1BYDA 2OGJA 4NRRA 2EPKX 3SI9A 3TYUA 4G39A 1TJPA 3NDOA 4GO8A 3C2RA 3L65A 3NQFA 3V1HA 2J13A 2WVVB 4XZHA 3WQ4A 1CXKA 5M2FX 5I3FA 3PZVA 4O13A 1DJWA 1LQ2A 2ACQA 4Z1AA 4H2CA 2J7FA 3FOKA 3EA1A 1PHQA 3RJYA 2X7WA 2VRJA 3VYLA 4I9TA 1QRQA 4A8LA 1S1RA 2HSAA 1ZJAA 3NJ3A 3NXLA 1RK5A 1A5OC 1PZ0A 4TMCA 1ZLPA 1I0BA 3VZXA 3N3TA 3QH2A 2FHFA 3TLQA 1JYWA 5HA7A 2P8CA 3UEQA 1OC6A 3B9DA 5LNSA 5HQMA 4C6KA 5DQPA 4DUOA 2POTA 4PB4A 1VPQA 5FSDC 3IUIA 2GK1A 4PMUA 1QNOA 1OSEA 4H9ZA 5ECUA 3H7RA 2F2KA 3LHUA 4IIGA 1B31A 4XX6A 3DUGA 2WSQA 2YR1A 2J6VA 3Q58A 2OYMA 2GQ8A 3KAOA 3NVDA 3MI6A 5FOOA 2Y85A 4XISA 1Q65A 4IG2A 3RM8A 4LUTB 3ITVA 3SUWA 3TSMA 4MWAD 3QOKA 1J0IA 2CXGA 3QTGA 1H0IA 3MO4A 1PIFA 3GG7A 1XG4A 4FSAA 1V0MA 4C65A 4LVGA 3N34A 1M1BA 1GKPA 2FH6A 4V27A 3V5OA 1CEOA 2PTZA 2VNCA 3IVTA 1MNZA 2XIMA 3OBAA 3TK7A 2FZ9A 4OECA 4UTTC 2OZ0A 1AJ0A 4LVDA 3OZYA 3GQYA 4QG6A 1X39A 3MMCA 1KLYA 3UA4A 2QCEA 1GVQA 2C79A 1OC7A 4BA0A 1O5RA 1FX6A 2BASA 3FS2A 2Y5EA 4H6KA 3G1SA 3M64A 2YA1A 4LS2A 3EX3A 3L0NA 1ICQA 3QJAA 1KRBC 1GKRA 5AYIA 3S6OA 1XDMA 1RA5A 4IISA 3UWUA 1FWNA 5DCBA 1P48A 4Y90A 3H2OA 4IWWA 3SO7A 1YBQA 2PDNA 3CH0A 3V18A 3WIJA 1XJBA 3NXFA 3PUGA 3KM8A 3VGBA 1GOQA 2VEKA 4JKLA 1EGZA 3Q67A 4J40A 1YTKA 4OVXA 1JDEA 2D2HA 2YDSA 4FO4A 1PTDA 2Z1KA 1T7LA 1UA7A 1FBAA 5A2CA 4H8UA 1UR3M 1X6NA 2Y63A 4JKKA 2QPUA 1XS2A 1E4IA 1SMDA 1YDYA 2PCEA 3O6CA 4ZSUA 5FF0A 1QOQA 3GNOA 4F0RA 2CW6A 4KPLA 3S0CA 2DW7A 3KVJA 1LM1A 1DJZA 4HU0A 4WK9A 3VGHA 3G6LA 1ZENA 4AUBA 5CQ1A 2PGRA 4FNSA 1WKEA 3ZVHA 4GPNA 3M0KA 4K8EA 2UZ9A 1G01A 1YYAA 4IG2B 3AS3A 4K7YA 4MJMA 5FF3A 1V0NA 3W88A 2DT1A 1NDZA 4DJDD 1XL9A 2ZRXA 3LX9A 4DBWA 4ZL1A 4H9UA 4GKTA 4W8LA 4NX0A 3U48A 1J93A 2J4GA 3FAXA 9XIAA 2O9TA 4CD8A 1XSKA 2NT1A 3PWAA 1S3TC 2GQ9A 5AC5A 5AC4A 1WOAA 5DRCA 2ZX6A 4LNYA 3MWCA 1DORA 3RPTA 2FTPA 2WQDA 1P0BA 3LGGA 4P8UA 3U5YA 3MMCB 3O15A 3A6OA 3W76A 1GQNA 4HZ6A 1BF6A 2V68A 5LYRA 3WQWA 3PB2A 4ORIA 1WZAA 4JFSA 4DPQA 5AVHA 2DP3A 2PDFA 5KZDA 2YL6A 3UZWA 2CLMA 2VVSA 5CZTA 3OB8A 2BXZA 3L12A 2J47A 4GNJA 5CC3A 3WL1A 1FP8A 1HN1A 1YBQB 3CUHA 4DEFA 4PTVA 3F2BA 1I2RA 1AUSL 4MKVA 5C5YA 1HL9A 4K7VA 2GJLA 1I45A 3FVDA 4CN1A 1POJA 3NR0A 3N2CA 1BAGA 4GWEA 3TW7A 1JVNA 5C2CA 3KEHA 1HKVA 2BXYA 4C6OA 5G2IA 4I5XA 3CH9A 1XIJA 4XZNX 4YLWA 4Q4OA 3R25A 4HJFA 3CLMA 2B31A 3OW1A 1Z8AA 1UPPA 1XH1A 1EGMA 1E70M 4U2YA 2QXWA 3KZSA 2VX6A 4UZSA 4NXSA 3F2DA 4HB7A 3HTWA 3N2MA 1RA0A 1RV8A 2G4JA 3EAUA 3P8JA 2J8GA 2XWEA 3FKRA 3UWZA 3VM7A 3CAQA 1E9LA 1BEUA 1PB0A 2VJXA 2PTYA 3B9NA 4QQ3A 4F0HA 5HMDA 3WN6A 1WXJA 1N7KA 3GTFA 5KITA 2V63A 1G1YA 4AZIA 1XSJA 4J27A 2QUUA 2R1NA 1IGSA 1DJGA 2P5NA 3QPYA 4U28A 3U9IA 2RDWA 2V9DA 5M3WA 5HPOA 2XSXA 4QQUA 1QI2A 1W91A 2D2GA 2R1LA 4GNVA 1EDQA 1LP6A 3UG3A 3V7PA 4AG0A 1OYAA 3NYDA 4LAKA 3ZJ7A 4C6DA 1MRAA 1S2CA 3MV01 1Z32X 1NQKA 2FHCA 3SQLA 3WLOA 4GX8A 3P0WA 1CXIA 4TV6A 1JAEA 3NPUA 3BDKA 4KCWA 4MB5A 4MB1A 4BQ3A 4QCFA 3EDFA 2KZHA 3GDRA 3ZLGA 3ZYZA 3MCOA 2HNHA 4DNHA 4QAWA 2XDFA 3OA3A 2X1SA 1RALA 1OYCA 3UNTA 1VKFA 4NNCA 1HGYA 4AYGA 4ICMA 3CQKA 1VAHA 3TWBA 4W7UA 3I65A 3H21A 1HKKA 3MPGA 3QV7A 2QKFA 3NQAA 3QHNA 1FWBC 4IMAA 5C55A 2GVLA 2DSWA 3GXNA 3JS3A 3LCLA 3ITCA 3CHCA 4HMEA 3BQ5A 3CHFA 3LRKA 3K13A 1FWTA 2WZTA 2UV8G 2ZXBA 1IV8A 1W8GA 3E1F1 4OBTA 4UIOA 2DUAA 1QNSA 2G0WA 3T9PA 3M5ZA 3BGGA 4QBXA 4Q8PA 4ZQMA 3W2KA 4ERGA 3PG8A 4W4QA 3CPGA 4JTLA 1VBJA 2QMKA 3QKZA 3G1RA 2VZVA 1TB3A 1KXHA 1P1XA 4HMDA 4IFRA 4KWUA 3T08A 2DVXA 3ARWA 3KCOA 4OGZA 3UT0A 3UJSA 4MZYA 4AC1X 1A4LA 1FWDC 3LB0A 2Z1WA 1NAL1 2XVNA 1JCLA 3B40A 2VDGA 1KGUA 1FCVA 2G37A 3TN4A 5HDRA 3OZPA 1E15A 4D2JA 2P3EA 4WZHA 2GYIA 3KVKA 2XU2A 3VCCA 3UG5A 4O18A 1FWJC 5LKYA 1TJRA 3B8SA 3DESA 4O19A 2FPTA 1OT1A 2HPMA 1OFRA 4ECLA 1KR0A 3VDBA 1I2PA 4I9JA 2E6FA 1UYQA 4I7WA 4LVFA 1LQAA 4GBDA 3NQVA 5A94A 3GS6A 4NI8A 1PX4A 3VGGA 4HPJA 1HQTA 4J2MA 2BOFX 3WQ6A 2W67A 1LROA 4IIDA 1MEHA 4JBRA 2H8XA 1KFWA 1C90A 4XSLA 3MM7A 4HPGA 3CGTA 2WK2A 2A21A 4GZEA 9XIMA 5H8UA 5I02A 5A6BA 4LW7A 2A85A 3UJFA 1W9BM 4IFKA 1LG2A 3GRIA 4QFUA 1ZS2A 4H6RA 2Z7GA 3W7QA 3GG8A 1R3QA 5FF7A 3W7DA 4LY4A 1Q45A 3TYCA 3OHMB 2ZUTA 4QP0A 4AD1A 1KB3A 3T8QA 4OHQA 4C6MA 5AYXA 1ICPA 2X0SA 4JFVA 4LCSA 1VFSA 1E1CA 4F2UA 1GJWA 2GWGA 2J7EA 3HG4A 3TJLA 3WQ8A 2AQVA 5HANA 3IS4A 4JFUA 3BW2A 1XYFA 4NZJA 4PTWA 2VTFA 2X40A 3WH6A 2ZFAA 2VC7A 3VKAA 1XYCA 2D24A 3V5CA 4O53A 3NQDA 2DZVA 4K37A 3LM3A 3W1AA 2QR6A 2QAPA 1XBXA 2EG6A 1UWRA 5J5RA 2ZX8A 4C6QA 4AHOA 4GH3A 1HXJA 4B5WA 1OABA 4WXYA 5U7SA 1KCLA 1G94A 4UTMA 3DFQA 1VFFA 2DY3A 1FDYA 3POHA 1IQ8A 3AHZA 2WZHA 3KS6A 1I2QA 2I1OA 3U0HA 3L0KA 4Q3MA 1A5SA 5CZSA 3GXFA 4O4VA 3NWRA 2JEQA 1HKMA 3N9KA 2DDXA 2EPLX 1NM9A 1HKWA 4D6EA 3OP2A 4M5PA 3BVJA 1FCQA 4WDXA 3W82A 5EBAA 1BWLA 1V03A 2SFPA 2IMRA 2OJPA 3WQ5A 4Q8NA 4AY7A 4HA3A 1F8IA 4AEOA 3G24A 4HHMA 1KFEA 3FHQA 3OBKA 3GIQA 4HOXA 3QV6A 4IQLA 2WZIA 3G1FA 3DX5A 2CIPA 5EA9A 4FK9A 3T0CA 2JGYA 1VS1A 2GJNA 1MQRA 5K9CA 2DJXA 3UCCA 3VCNA 3NG3A 4BI6A 3NSMA 3G0SA 2OWXA 4ZXOA 2R1KA 4MAVA 3O06A 3PBGA 1GVYA 4F8XA 4DLFA 3KVMA 3W0KA 1QATA 2R91A 1KD0A 2HXTA 4GLEA 1DWIM 4PUKA 3V0TA 2WZMA 5T9CE 1NY1A 2DT0A 5A6KA 2NQ9A 1PKYA 3TC7A 5IRPA 4GJJA 3QLLA 1VH7A 2RAGA 3LTYA 3AXIA 3PFMA 1E1CB 4IJCA 2WO5A 4LPCA 4B2DD 3USZA 3BAIA 3MKKA 4L65A 4BCEA 2NXIA 1TJ1A 2VL4A 1CXEA 4OOZA 1UWTA 7REQB 2YIHA 2J75A 3Q45A 4MB4A 2QLYA 3VIIA 3C0LA 3WMSA 3QZEA 3KDNA 2TAAA 1KM1A 3L66A 3LBMA 2AL2A 1Q2SA 3F2CA 5H6HA 5CPSA 1YMYA 4PFMA 4ZA0A 4UTWC 3SADA 1XX1A 5I3HA 1ZJBA 2BVYA 1DWAM 2E6AA 1JPDX 1Q6GA 4E5TA 4GIAA 3M0XA 4IUOA 4DO6A 4WY0A 4OE7A 3GEOA 2PDYA 3INPA 3N2TA 1ESWA 4HCHA 4JOMA 2CNCA 4C6EA 4ML9A 1X97A 3VKRA 2QGHA 1TVPA 2VFEA 4QJ3B 1PXGA 3WG6A 4LC8A 1UC4A 1FQ0A 4IIHA 3MBFA 3NOYA 2W5FA 3AIWA 4P8WA 1MYRA 3CZ8A 1JQXA 3POCA 1MSSA 3TYAA 2X1TA 2Y89A 1IWPA 4MZ1A 3T55A 1V5XA 1R85A 4GVHA 1WUEA 5I3IA 4RV8A 4FP1A 1ZALA 3ES8A 4XAYA 3VKDA 1I60A 2YBVA 3M47A 3ZS4A 5CCZA 2NUXA 3FSTA 5BRPA 5E70A 3STFA 5CEWA 4DXKA 3W70A 3AU6A 3H8AA 1H5VA 1TCMA 2Y7GA 3NO1A 4IXHA 1DEDA 2IPGA 5CSYA 3AISA 3WK2A 3IUHA 4MYAA 3W07A 1UIOA 3W28A 3UWYA 1TIWA 1IWBA 1NOWA 1QO5A 1XIIA 2YLAA 3BE7A 3OR2A 3T0DA 1ZL1A 3WK3A 3LSBA 4HK6A 3ZSSA 4TR9A 1ZBWA 3EB2A 3TN5A 2OU4A 4J4KA 4D6JA 2GOKA 2OLAA 3GG1A 3IWPA 3AJXA 3H12A 1XIEA 4JL2A 4Y8FA 3K1DA 5C9WA 5FD0A 4UFKA 2VFDA 3AHYA 4NVTA 2Y5SA 4A3UA 2AL2B 3BMWA 3NL6A 1WCGA 1GPWA 4DN1A 2DSUA 3WEOA 1F3EA 2HBVA 3UCQA 4XQ6A 5K4ZA 2WJFA 3VOFA 3M9YA 1HKIA 3U2CA 5GEPA 4WY0B 4FNQA 3MI2A 5IDIA 4EXBA 3S42A 1JZ5A 1JDFA 4JTSA 3IGSA 1JZ2A 5LXEA 3EEGA 4N2YA 2BP1A 1WUFA 4HBKA 1BWVA 1PYFA 4Q6JA 4AD3A 3DYPA 1B30A 3H6OA 4ZTXA 1L2QA 1J12A 1GPFA 3JW7A 3VKJA 1UBPC 3UY7A 1HO1A 1RBLA 1WDDA 1GOOA 1H2JA 4JYFA 1SSGA 2C8NA 4JQ2A 1JGMA 4GFSA 2C7FA 1Q2RA 3MVIA 3UF9A 1O66A 2E5CA 3NZQA 3T81A 3QHOA 3NQBA 1FXPA 4XV0A 1PPIA 4YN5A 3WUEA 3T2QA 1AJ2A 3BGJA 4X3ZA 1G6CA 3KCLA 1DE5A 4QDPA 4S39A 3IJ7A 2CLKA 3WDHA 4QIUA 2INZA 4JIIX 1R7OA 1XIFA 4O1AA 3TC3A 3RX2A 3DFTA 3OQ8A 1OF6A 1S5WA 4PE8A 4OV4A 3EWZA 3N11A 1OFDA 3QGVA 1XC4A 2E1DA 3C2YA 1XH2A 2IXUA 4JFWA 1FWIC 1A49A 2E4TA 3OZOA 1W2VA 1EJVC 1XR2A 3TTQA 5IBXA 2V5CA 5HNNA 2YL5A 4RR4A 1IEWA 2REQA 3CQJA 4ZODA 5HOSA 2C0AA 4XO6A 3VU2A 1W1YA 2RJGA 2V30A 4PTNA 3PR2A 3FXGA 3MUY1 3M0VA 3SDOA 4CVWA 3F4WA 2HS6A 2H6RA 4XB3A 3EOUA 1NFGA 2V6AA 3S83A 2QAFA 4ZFMA 1H7XA 1JPKA 1W5QA 1OX6A 2PWFA 2Q71A 5K9XA 1DL3A 3W87A 1IEXA 4KKXA 1XLHA 2OO0A 4ENLA 1WXYA 1IIGA 1KLZA 4GZ7A 2E68A 4JTKA 4WRHA 4XAFA 2PWVA 1RJPA 3T4WA 3WYZA 3W1RA 3T44A 4S3CA 3O16A 2CBIA 4U2ZA 5CZ0A 3WD2A 3FAWA 1B3WA 1G4EA 3MS8A 4HSHA 2YCKX 1X1ZA 2P53A 3FLUA 2XIJA 2CWNA 4UNLA 1W5PA 3KOZA 4DO5A 2BTMA 2BBFA 1IEVA 2GZXA 2BY3A 1UHVA 4LYQA 1MFUA 4C6FA 3CU2A 4NJJA 4K68A 4CNUA 4FIQA 5E09A 5HAOA 3QYSA 1SUXA 3GHRA 2CLEA 2J27A 1YKWA 1WO2A 4A3YA 2EKCA 4D9PA 3TXVA 1ICSA 5PTDA 1WDRA 3R6IA 3BCJA 4GZJA 3QEZA 3MQTA 1QWGA 1Y5WA 1LL6A 3PZIA 1LOSA 4Z2LA 5DBUA 3W2JA 4PR4A 3M0JA 3AMDA 3EWBX 4C6CA 3H2CA 5A2BA 1AL8A 1K9TA 2ZUNA 3TFXA 4JTEA 1T6MA 3PNUA 2HV5A 4ZXLA 2V0TA 1D8WA 1D3CA 4DLMA 1Q66A 1RR2A 5D8WA 5DF0A 3DERA 1HL2A 5A6TC 3UR7A 4GE8A 1GZJA 2INFA 4PGLA 3C2VA 4BK9A 1HX0A 2R1PA 4FR1A 2X05A 1X1OA 4LUJA 2W0UA 5JMUA 1QOXA 4NAEA 1RJQA 1SQ7A 2IQDA 2VDIA 3RXZA 1JIBA 1JD9A 3GYCA 3CAKA 1SM9A 1FH9A 3P8IA 1SJBA 4CU8A 1W1PA 4DBEA 1Q7ZA 3I10A 3WLHA 1IXPA 3F4DA 2VCBA 5I2UA 4GGBA 1N2VA 2E40A 1XUZA 3IV3A 6REQB 1HGWA 5DMNA 3W7RA 4LALA 5BRBA 1WA3A 1YTDA 3PTDA 2F7FA 4FLOA 2ZRYA 3HURA 3APYA 4HYVA 1RLCL 1TPDA 1W37A 4NYYA 4JEJA 3LV6A 2YL9A 3I4EA 3ABXA 3UXAA 2WANA 1HJWA 3WQEA 1QWKA 3N4EA 5C54A 2XFRA 3BL3A 1EKOA 1TV8A 3WLTA 4IMGA 1WKDA 3ARXA 3GHTA 1LBFA 2W66A 4QG8A 4MF4A 4I6KA 2I9UA 4Q8QA 3APGA 3QHMA 3VIKA 3UVAA 4W88A 5A8OA 3FDKA 2YCJA 1EJXC 2GVYA 3R11A 2ON3A 3AYTA 4NSBA 4GBUA 1SR0A 1MMFA 2ZUUA 5XIAA 3C2OA 4TQTA 1W9UA 2OQLA 1A5MC 5FI8A 4BHYA 4NYUA 2E6DA 3CUFA 5D04C 4F0LA 5F2GA 4H6QA 1I6NA 3HQ1A 4AHQA 3AOPA 1UWUA 3UGVA 2EG8A 1GVIA 2P0IA 1UCWA 4OOUA 2ABBA 5AYBA 2A7RA 1GG0A 3UY8A 3F5JA 4S3JA 3B0VC 1ISZA 1KFKA 2A3EA 1V7YA 4Q4RA 3C0QA 3PAOA 5AHLA 3VMOA 1XLCA 5DLCA 1WBHA 1RCXB 1XQLA 2J7CA 3OYXA 4F9DA 3N6QA 3AHVA 3ERPA 4AZ7A 2FZNA 1EUNA 2E28A 3TJIA 4O1DA 2PP0A 3M5XA 2GDVA 4PBGA 2YL8A 2QUVA 2AGKA 3M41A 2G8ZA 1WDPA 4QLJA 2VHLA 1E6PA 5AFDA 4Q8TA 4NAEB 4XD5A 3DFNA 3T42A 3GTIA 1E0WA 1GVSA 5FESA 3EDJA 3MM6A 5F4WA 4KT2A 3C5QA 4FEZA 3LNPA 1ZPTA 4WLCA 1MNSA 1YE4A 4QTGA 1W3TA 4XO7A 1C8VA 3MVTA 4M1RA 4MY1A 2Y24A 3NPVA 4HZMA 3S1GA 3NM1A 5JBFA 1IT7A 2OQYA 2QUNA 2CLFA 4WKAA 2CZDA 4HU4A 1EYEA 1W56A 1W3KA 3PHAA 2Q8ZA 3CUZA 1E6ZA 1BSIA 3ENLA 3PS7A 4TXEA 3S1UA 3BO9A 4IJBA 4X0NA 1BYCA 4MADA 3UR2A 2FZ8A 1A0CA 3M6DA 4YNGA 4A8IA 1ZY9A 1WPCA 1E73M 4O1EA 2VT0A 1W9XA 3UW6A 1JF5A 1CYGA 3Q94A 3ZR5A 1L8PA 3T40A 1JZ3A 3W1TA 1M53A 3Q37A 2O7SA 4Z1YA 1YNQA 3JUGA 2VFFA 4ATWA 1XPYA 2Z1SA 1K77A 1JJKA 4DF0A 3CWNA 4HK7A 2F6KA 4KCTA 2VCAA 4JTCA 2DFAA 1DIDA 5LIXX 3OOQA 2YLLA 2O7QA 4A3RA 3JR2A 3SY8A 3W71A 3R13A 4PRWA 4Z2KA 1AQ0A 1LTDA 3LERA 4NIRA 3KW3A 2Z1XA 3WQCA 3VILA 1EZ2A 4YYCA 1VPXA 1UP0A 2Z25A 3WLNA 1W3LA 4DM1A 1GCYA 1EWEA 3IJ6A 1CGWA 4EPEC 4Z08A 5A6JA 2EEXA 5HULA 2Y0FA 1FHUA 3EX1A 2EG7A 2VGBA 1UKOA 2RDTA 4KESA 1PTAA 3LK6A 2WJDA 4GABA 5G5IA 4WEVX 4RNHA 4KS0A 1TE6A 2NQJA 3CUJA 3GR7A 3EWXA 5BWAA 1S39A 5M5DA 1NFBA 4HKPA 1XLEA 3WMCA 3TP4A 3GTXA 5BXTA 1W9PA 2HPIA 2OCZA 3HPFA 1QPNA 2AKZA 3LHYA 3MMAB 4PB3A 3K30A 3PUEA 3WH8A 3MM6B 4XTIA 3D5HA 4G1NA 1J9YA 4W8BA 2OB3A 1GJPA 2J78A 4UMAA 2WM0A 2DH2A 1LOQA 4H7VA 1KWKA 1VHNA 3CT2A 3UJ2A 1BRLA 3DYOA 5GQBA 4AU0A 4YHGA 3U7VA 5B7YA 3THCA 1VFUA 4U33A 3VKKA 2WVSA 1B3YA 4IZGA 3LM7A 1NH6A 1A5UA 4GJIA 3VC5A 3W53A 4REQA 1CGXA 5MKGA 5I3GA 4IGSA 3ECQA 4EACA 5IHRA 1F8MA 2ONEA 3MTWA 1QPQA 3PM6A 3RLVA 4N02A 3O3RA 1EJTC 4XVEA 1OCBA 4OWGA 2NW0A 3FSUA 3I6RA 1SW0A 4UBPC 1XIGA 3GHUA 4UWMA 4G7FA 2WHJA 4GY7A 4WHBA 1XUUA 3FX4A 3KHJA 4V28A 5I09A 3B9EA 3F4VA 4RDZA 1VD6A 1CBGA 4IM4A 1OFPA 3OVGA 5AHNA 3A23A 2ZADA 3PF3A 4WF7A 4L56A 2ZA1A 2HK1A 1ZBKA 2GOUA 3TE9A 5AOUA 2MANA 8XIMA 1TUFA 4W89A 3ITYA 2OX4A 3OODA 2G3IA 5AYYA 4XKYA 3DI0A 3ANVA 4NZ4A 1B3VA 1Q6FA 1V6WA 3ANYA 1TZ7A 3QKEA 4DJEC 1GOIA 1VEPA 4DXVA 2A3CA 4FIRA 3LNMA 3E5BA 3I3DA 5E0KA 3M1ZA 1V79A 1G7UA 4U10A 1VPYA 2NSXA 5JBEA 4L6HA 1A53A 4J9JA 4NJGA 5HWNA 4OU1A 3GX9A 2IKHA 3TYZA 2IUZA 4YVVA 4NU7A 2WM1A 1E1EA 5G4WA 7PTDA 4KIRA 3WQFA 2Q3OA 1DJNA 2W92A 1QHZA 3LLDA 3ZOAA 1O5KA 3AU2A 5E9XA 1ZSXA 4K2SA 1K7FA 2NT0A 4QROA 3A4WA 3VKBA 2HE8A 1TTQA 4AZBA 3SUSA 4X9YA 4ZOBA 1NVMA 5KZ6A 1BRLB 1M04A 4JIHA 4CNTA 2YCEA 3G1VA 3SECA 2FMOA 3IAPA 3BLKA 4CNSA 3AS0A 1K9EA 1UKPA 4TVUA 1G69A 2RGMA 3M44A 4R33A 4RXFA 4ZOEA 5C9XA 4MUPA 4REQB 4LF1A 1HP4A 5MKGB 4QITA 4A21A 3U2OA 1H50A 2XPKA 4PCNA 4R53A 1E55A 2HE5A 2E09A 3SJNA 2VEFA 4WX2A 2G50A 2POZA 4L5ZA 4GI8A 1H0GA 1XG3A 3AWOA 3B4UA 1GWJA 2BHUA 4U31A 1KCZA 2AAAA 2O55A 1Z48A 1P4CA 4I8YA 1JFXA 4HNTA 3H23A 3GM8A 4X2PA 1VENA 7CGTA 2QUTA 2PAJA 2A7PA 4UFHA 2HXUA 1HTIA 3SFWA 1M5WA 3HPXA 7ODCA 1KM3A 1B57A 2H90A 4U3AA 1HJQA 4B9ZA 2E67A 4Q4QA 3MV11 1G4TA 3HO8A 3FV9A 2ISWA 1RY0A 3THQA 3EWWA 1IEIA 5A6BD 2ZRUA 4KRTA 1AA1B 4XIMA 4XKYB 1BF2A 5BYWA 1QBBA 5A5WA 3PPFA 1I2OA 2YCLA 3WJXA 1KW1A 1CLKA 3PBMA 3AIQA 1GZGA 3NSXA 3M46A 2OWWA 4GXPA 1KFCA 4CNPA 3S5NA 2FFCA 5EY5A 2V4JA 1DQUA 1T8QA 2W61A 1R6WA 3JU2A 4IIBA 4IF2A 3VIJA 1KFBA 2ANUA 4C5YA 4GNKB 2ZRZA 4J3VA 1XCXA 2DZUA 5A8MA 4DBDA 4LWWA 5C70A 1ZZMA 3M16A 4LGXA 4AZ5A 4UTLA 4KMQA 2AMXA 4BQ5A 4AD4A 4E8DA 4UTFA 3H2AA 2GUYA 1RLDA 5D2TA 4B92A 1LBMA 1SPQA 1N8FA 3W23A 5H8PA 3UG8A 4PMNA 3HV8A 3BOFA 3M0LA 2EPHA 1XD1A 2DPEA 3M5VA 1Y7VA 3W2LA 3EOOA 1K02A 5LNUA 3TCEA 1T0OA 1V0KA 1I4NA 2QV4A 3EMZA 1OBAA 2GGIA 3W7PA 1DWJM 3SRDA 5DMYA 3BLPX 4AD2A 4PMJA 3BAYA 3RHGA 2CZFA 5MHBA 4QX4A 4ZE5A 3P7YA 2B7QA 4N7QA 3RMEA 2J74A 4CEXC 5TIMA 1TX0A 5F4XA 3J7HA 3OTRA 3WNNA 3ZLHA 1K6WA 4F9JA 1GYMA 4KFNA 4FLRA 2OT1A 2MNRA 2GPTA 4US5A 2BGSA 3FFSA 3GC2A 4AH7A 2CLOA 1VYPX 1MW2A 1KM5A 4Y7EA 3AJ7A 1VJSA 3WLQA 2JIWA 4EKJA 1S1PA 1R2TA 5DBTA 3V3WA 4KH2A 3GFXA 1EDGA 2I56A 5EMYA 2F2HA 2ASHA 4I5RA 2VR4A 3W1XA 4M1BA 3WELA 2J6XA 4LV9A 4PBFA 4JNMA 1KKOA 3I68A 5BNKA 2AL1A 3R12A 1RY8A 3FEQA 2ZXQA 1XDJA 3F4CA 3HJZA 2YCLB 2WLZA 4BS0A 1W0MA 3IGHX 4XAPA 1MO0A 1FH8A 4XK2A 4YIWA 2V4JB 4LVAA 3W83A 2O9RA 1XGDA 3KBMA 3KRZA 1Q6OA 1LJYA 1C93A 1XLIA 1ZBCA 3ARZA 1TZ9A 3GNXA 4JQ4A 2Z00A 3NEHA 3WLRA 4UTHA 3KS5A 3A64A 4CUCA 4NJIA 2XIQA 3IJDA 3B0HA 4R7OA 3N29A 4E6MA 2I7GA 2VEMA 4A29A 1EEPA 4D72A 1C7TA 1NOFA 2ODOA 1R3TA 4F66A 4MFDA 3U8GA 1AH0A 1GHSA 3HFTA 3PK7A 5A8QA 5D32A 4HJWA 2DSZA 1I75A 3CL8A 4PUNA 3DAQA 1UROA 1E6SM 4WJXA 4B15A 3ARPA 1OD8A 1VIZA 3GVQA 1DTNA 3CWHA 2CC0A 3LV5A 3D3FA 3AMCA 4JX4A 5EMLA 2PLCA 2EF9A 1U30A 3WLLA 1WP6A 1EOKA 4B4FA 2C3ZA 2GGHA 1F3WA 2Z2AA 4Y9MA 5LIWX 3MB9A 1W1VA 3G8EA 3LOTA 3WNPA 3SJ3A 3NVTA 4B3LA 2DZPA 3SAZA 5DCEA 5J5DA 3DBNA 4DHGA 3B0LA 3G3MA 1JXJA 3LMYA 2Y88A 2QJJA 4O28A 4W7VA 3TV8A 1ADDA 1KC7A 2X1RA 3EDKA 3R8HA 3FEMA 3TA6A 1CX9A 2PMQA 4AWEA 4S23A 5TNVA 3N6HA 4RE0A 4YL2A 1F3XA 1IZCA 2QQ6A 2Z0IA 3FA5A 3QOMA 1M7OA 2PDJA 2PF8A 1OY0A 3P3BA 2CZ5A 2YBTA 1AOPA 3VNYA 2WMFA 2VCCA 1I8JA 3SN0A 3DGRA 3UPBA 1CWYA 1HO4A 3TFCA 3FDGA 1SJAA 2ZC1A 4RLIA 3C8NA 4RE2A 2CXEA 3PPHA 3CEUA 4DF2A 1BPLB 2D0HA 2ZZ6A 4GUHA 4O1CA 2YPIA 4CU7A 4PMYA 3UJEA 3TMLA 3ARSA 4Q8VA 1WZLA 2G96A 3VVGA 4A8NA 5ABTA 1PYMA 5AECA 4LEQA 1K1DA 2XM1A 1L6GA 4JTGA 2CKSA 5JVLA 3F5KA 5J04A 1SGJA 1EZWA 2F8QA 3LPFA 4EP8C 2JKPA 2WMHA 5LA0A 4IMFA 3ORWA 3A24A 2J9YA 3GKAA 4Q4PA 4DWSA 2I57A 3NGJA 4JN8A 3WDRA 2Q02A 3K8LA 1J5TA 3WSUA 2AOSA 1VC4A 4UMBA 3DKLA 4NNBA 1XLBA 2BOEX 5KSWA 2CKRA 3MMBB 2VQUA 1E3ZA 2V8ZA 2QJNA 4DAFA 1Q7MA 2YSWA 3VDCA 4MOZA 1LDCA 2PDCA 4NHVA 3VNJA 5BMWA 4JPGA 3UZJA 2IKJA 1PSCA 1JULA 2D1ZA 2ZZ3A 3MDUA 4D6GA 4BF9A 3MANA 1YEYA 2IXVA 2ACRA 1IR2A 3CTLA 4RNIA 3GAKA 1EUAA 4M82A 4RZ6A 3W4RA 4AC7C 4LAOA 4PCSA 3MBDA 1YPIA 1QK0A 1A3WA 1C91A 1RUSA 1RQBA 4Z42C 2IS7A 1MFVA 2PU1A 3C0SA 2RJHA 4P7OA 3EXRA 3WMLA 4UC5A 3HG5A 1PV8A 2J8FA 4P7NA 3RU6A 3PJTA 4HTYA 1DXEA 1ISVA 3U57A 3AIEA 3BW3A 3OG2A 1AK5A 1GHRA 3LI0A 4KWVA 1BVWA 3U4AA 3VAVA 4XZWA 4QJ4B 1GVOA 3S2JA 1X8FA 2PUZA 3VIFA 2PDLA 4J3SA 3VCRA 1QJWA 1BVNP 5BU9A 1JRCA 3AQUA 5FJOA 2WC7A 5TQLA 4QCEA 1FWSA 2ADAA 3LTSA 4HMNA 2NV9A 2RDXA 4DXXA 1H11A 1AH3A 1IXQA 3SR7A 1CGUA 3AALA 1SJDA 3QGKC 4W8AA 2NXHA 2O56A 4GINA 4US6A 1YPFA 3W75A 1F73A 3ZT5A 1OGSA 5LGZA 4GO9A 1EJ7L 3R0KA 1QR7A 1ZFJA 4IQDA 1ZRQA 5F1VA 4R7JA 4XAGA 1UOKA 2OOGA 1OM0A 4PMQA 3ALFA 1WKFA 4UFIA 1E51A 1J01A 2BXVA 1DYSA 2ZZ5A 4FLSA 4UR9A 3S1XA 4EWJA 3SGGA 3S4TA 4S3FA 2GVEA 1K03A 4MAZA 2Y8KA 3VUSA 2YXXA 3W2UA 3RMJA 1W6TA 3IIXA 3NTYA 4WXZA 3GU2A 3BOLA 1JFHA 1FP9A 5XINA 3UXLA 1XPGA 1UC5A 2Y70A 3LCGA 3VDHA 4HVXA 2V81A 4BZYA 1OX5A 3W7KA 1BQGA 5DANA 3TYBA 1B4EA 3RX4A 4JL1A 5CSRA 3K4WA 4L6OA 5A8NA 2FQIA 4BFAA 3WBYA 5FEWA 4OUEA 2LLEA 3L4WA 3VLYA 3RILA 4B5SA 5MF5A 2BVTA 4CQBA 1HJUA 1E6NA 2WCGA 3BV7A 4R3UA 1K8CA 5CPMA 3S5OA 3WNLA 1M01A 3MW7A 3RLHA 4EK7A 3G1YA 3SCOA 3UA3A 3C0JA 2Z26A 4QJ1A 3QC0A 2P1FA 2J7GA 4JHOA 1UW9A 3CUGA 5LIUX 3B0JA 2P50A 5GNXA 3BZJA 3U4FA 4DY1A 1KM6A 3LXBA 3OBEA 2A4AA 1IXNA 5EMUA 2E5BA 2XSAA 2VX4A 2WCAA 4L4MA 3R43A 1EGVA 2PDUA 1P0DA 3KRUA 1H7OA 1LF1A 2JKAA 3H54A 1P7TB 1AD1A 4IXXA 2C71A 3MKCA 1RJRA 3VIMA 4H04A 2EPNA 2V5BA 1D8CA 3QVQA 4AIBA 3TZNA 2YYUA 2FYMA 5DN1A 3LHZA 2BNJA 4N6FA 5E6YA 3W02A 4L1GA 3U3HA 3RITA 1JCMP 4V2XA 1ONEA 1SVDA 1W31A 3RK8A 1TMHA 3BSMA 1X6LA 4Z2IA 1H1NA 1UR9A 2W63A 3WD3A 2GJPA 2JF7A 4M8UA 4S3GA 2OZ8A 2YCIX 5EFDA 4L4OA 3ZVIA 1X38A 3RCNA 3VDAA 1NWSA 3LCXA 2IPJA 1UP3A 1JEZA 4UUIA 3CO8A 1F76A 4TMBA 1J6PA 1XYLA 1DHKA 4S3DA 3G1XA 1YE6A 5I0DA 2XN0A 3V1PA 3P5YA 2DZTA 1VFMA 1US2A 1DJHA 3HB9A 5EMMA 4ML4A 2P88A 4FALA 4UNKA 2JF6A 3B0UX 2HVNA 2GGGA 3E0LA 1RVGA 3TCSA 2PLJA 1VIWA 2PS2A 1MEWA 1XV8A 1E5JA 3TNOA 3CV1A 4LS1A 4QHRA 4IL0A 1KBKA 1CLVA 2YZ5A 4X61A 3MY9A 3B9OA 3B8UA 1XC6A 2GL5A 5L9FA 1VP5A 1GUVA 4Q6XA 5A8GA 3BARA 4RX0A 3SQSA 4H83A 1JCTA 4NI3A 1OFEA 4R9XA 1EQCA 3NQ6A 1O5QA 1SO6A 3W00A 5E0FA 4GCAA 3M0HA 4RE3A 1JCJA 4HCDA 1TE1A 4RL3A 4WOQA 3CZLA 3RF9A 3VNZA 3RLGA 2YDAA 1JRBA 4M7SA 3USBA 2XGIA 3KBSA 4UCGA 2XSJA 2DU2A 3OQEA 5CGQA 1M7PA 5CGMA 2WC3A 7TIMA 3EA2A 1TV2A 3L5LA 1W2PA 6TAAA 4EF8A 3CIWA 2J77A 4GIYA 5BRQA 4PMVA 1ZAJA 2OEJA 4AIOA 4MMWA 5CAKA 3LYEA 3L5AA 1EQPA 2WOQA 3AUJA 3TYDA 1BFNA 4KRUA 4RV3A 3O05A 4UTIA 4TTUA 1UQZA 4NJKA 1J0YA 1F74A 3Q4DA 3OR1A 5LZLA 3NQCA 3TSBA 3EBVA 3TYEA 1P6CA 2VX5A 1KCKA 3QXBA 5HR6A 4MNKA 3ZO9A 3ICJA 3WL0A 1J2WA 4DZAA 1KCXA 1H3GA 2QT3A 2WSRA 1UJPA 3VLXA 2DH3A 4B16A 4C1KA 1XLGA 1Z6KA 3LRLA 2QDEA 3T6CA 3SBFA 1FXQA 5JXQA 3ALGA 3ITOA 3W6MA 3GK0A 2DVUA 1ME9A 1J11A 3SW6A 1XSIA 5D30A 2W3ZA 5K7JA 3HGJA 3NDZA 1EP1A 4G7EA 2PD9A 1E0TA 3CB8A 1VBHA 5G2WA 5AYZA 4X0VA 3QV8A 3TTOA 4DWSC 3QM3A 4UTKA 1XYAA 4ZQRA 4NNAA 2IQ0A 4P8VA 3GW3A 1EX5A 2VQTA 1J0JA 2X1IA 3ABZA 4UR7A 5D9NA 5DY3A 3G1HA 2ZVRA 3CMGA 1KFJA 4YPJA 1TX2A 4XG1A 2VDHA 1REQB 5I3JA 1JUKA 1ZCOA 3QFWA 5I23A 3UR5A 2YFNA 2XISA 3KTXA 1DVJA 1O5XA 3SGUA 5CSUA 1TR1A 4KEUA 3W7JA 3GXPA 1QASA 1XBZA 1TPFA 3ARTA 3I7SA 2YDRA 3COTA 2CZVA 4ROQA 4EPDC 4IX2A 4X9SA 1IEQA 3PZNA 4QJ5B 1Q63A 2IQTA 2C19A 3JZEA 1RD6A 1WX0A 3GC4A 1T41A 4O8AA 4IPIA 4C60A 3PWGA 3GBEA 3GNNA 1MWOA 3GFZA 4F3HA 1M65A 3PBWA 3H2FA 4N9CA 1BKHA 1RCQA 2CITA 4DYJA 2OYKA 3GVWA 1W1ZA 4PZVA 1ZTVA 1IZKA 1PL9A 4FAMA 1XW8A 2E6YA 3MMUA 1O12A 1QVBA 4ZZ9A 4TOQA 3OR1B 1J0KA 2C1HA 1XRTA 1D7FA 1XBVA 1B9BA 1F6KA 5BROA 4JDBA 2HQAA 4I6VA 2V69A 3SUUA 3TDFA 4GRSA 3GKFA 3M0ZA 2XH7A 4EIVA 3UJRA 4CU6A 4MUZA 2BFGA 3I6EA 1CXLA 2YB4A 3BJSA 4RZ5A 2G3FA 1W54A 5DEZA 4GXMA 3LCIA 1G7VA 4G7EB 2AQOA 3F7JA 3EXSA 2XH4A 3ONCA 1EP2A 3DHPA 2PSNA 2Y8VA 4NKCA 2OXNA 4Z17A 3KP1A 4RPQA 1A5CA 1PKLA 3EWCA 1ADOA 1OX4A 5A6SA 1CB2A 4DUVA 3TU9A 1O94A 4IJRA 2FPVA 3QYQA 1ZP3A 4MIMA 4UB9A 3UD6A 2O9PA 5K9DA 4YVPA 2XN2A 1PZ2A 4L61A 2WSYA 1V08A 2TODA 2GDUA 4NG3A 5BWFA 3WX7A 3B0PA 3R89A 4UQBA 4LYKA 4HHPA 4ZOCA 4AZCA 4XZ9A 1C3FA 2HBXA 5CKSA 1XI3A 1XRVA 1MW1A 4QE5A 5G2HA 5M17A 2E0PA 3L4TA 3GW0A 4KEZA 2OQHA 3CHVA 3GLCA 3RYSA 1LOLA 3WUGA 2VMFA 4JHMA 3EDEA 1CCWB 3VZYA 3VABA 1NP2A 1U5VA 3OGSA 3RRAA 1EP3A 3W2MA 2BX7A 4C90A 3AHXA 1C8XA 3PTKA 3PULA 1XBYA 5G4EA 4IPNB 1N55A 4Z1BA 2A79A 3NL5A 1W1B1 1X96A 2QDGA 4O52A 3MUIA 2C18A 4MTVA 3ARVA 1WAWA 5XIMA 4LOCA 1EC8A 1FWRA 2J24A 4GJ1A 3MYOA 8TIMA 1TR9A 1VRXA 1OCJA 4GYJA 1UD8A 3BQ6A 3PZGA 4J3XA 2A6LA 1PBGA 3WLIA 4WSKA 3PPGA 1K4HA 4C7FA 4YTQA 1F9CA 2Y7EA 1TTPA 1YXYA 4S2CA 3NZ1A 4QS6A 3DENA 1JZ7A 1U22A 3W1LA 3WCZA 3DXIA 3W74A 3A22A 3NEVA 4M80A 1CGVA 3C8FA 2QZRA 3PBVA 4M29A 4Q4KA 4JIEA 3SCTA 4KEVA 1T8XA 3S2CA 1TWWA 1W3IA 1E0XA 3UP8A 1FFRA 3R58A 4UOZA 1GJUA 1HNYA 1V3LA 3THDA 1C29A 3NQGA 4URIA 3VX1A 3HM7A 3IVUA 2ISFA 5DXYA 4XVDA 4GACA 1NDYA 4OBSA 4F0KA 1PTGA 3T78A 5EBUA 5LNRA 3TTYA 1GEQA 4A8RA 4LUIA 3TQPA 1BSLA 1J6OA 4C6JA 2HISA 1OX4B 2YOCA 8XIAA 3DC8A 3TUUA 4RW3A 4JYDA 1Q7QA 4IPJA 1QNVA 3S9ZA 3MKVA 4JCMA 2WJZA 5D2YA 5AZ0A 3LGDA 1A0DA 3HU7A 4PC8A 4E4FA 2VVNA 2E8YA 1KGWA 1JZ6A 4AZCB 1Q8JA 4P7RA 2X7VA 3E2RA 4XWUA 1ONRA 4DIAA 1OGGA 3C3UA 1LL7A 2GK1B 4CCZA 3CO4A 4N6EA 1TPB1 2GQAA 4DO4A 3RPMA 3UXKA 1QK2A 1LRQA 4M56A 4J1OA 3LHVA 2BB0A 4MB3A 3RUBL 4KWOA 4LSBA 4AXKA 1IR1A 3W24A 2X2GA 2DZSA 3EX6A 4WDWA 3IRDA 2YXGA 3DKJA 1JUEA 3S46A 1TPEA 2R6OA 2V67A 3ES7A 5FSEC 1DOSA 4AMAA 3QRHA 3CHEA 3EX4A 3IARA 2IKGA 2A2IA 3O0KA 5HATA 4DYEA 3TNBA 3HZ3A 1IGWA 1IWAA 2R24A 3WLJA 4KWSA 1DIKA 2C91A 3HPSA 3PWIA 3CTTA 3R7MA 5LSMA 1EB3A 4NRSA 3TQ0A 1JI2A 3CUXA 1TPUA 3PSVA 2QNEA 3L7RA 3AXHA 2Y5JA 1YXDA 2VO5A 3TONA 4N9DA 1MXDA 1FHLA 3TWAA 3QSTA 1R5YA 4LEFA 4Y9NA 4XZBA 1UJQA 1S46A 1P6BA 3SN4A 3MWAA 4H19A 4US5D 3L21A 4DNMA 3DN5A 1IXOA 1V77A 2WMGA 1BKSA 1BXBA 4XBJA 4DX3A 2WWCA 2QCMA 1T99A 2DV0A 2PI6A 2OGYA 4EF9A 4HMCA 2DVTA 1FUYA 4F79A 3CIVA 4BY3A 4UTWA 3QZAA 1OIMA 4CNNA 3BWWA 4K1GA 1YX1A 1HVXA 2VFHA 3ARRA 1EJSC 3BAJA 2PE4A 1LRTA 9RUBA 3TAOA 1YXCA 1IIHA 2FKPA 3OA5A 2G97A 3UXDA 4DYKA 3PZTA 1TQJA 4GI9A 3GWQA 1K7EA 4PA8A 3MM5A 5EMJA 3FGCA 1BLIA 2YFOA 3GIYA 1CGYA 4L9XA 1S5MA 5GNYA 4JQ3A 1CXHA 3ZMRA 3BAXA 5IHSA 4M6PA 2FDMA 4ACZA 5I77A 2VM8A 2P10A 4FF7A 3SIZA 1OD0A 3I3BA 4LQ1A 4MDOA 4PYSA 3ZVHB 3K8KA 2VI0A 5DMMA 2QW5A 1FWCC 4AD0A 1R30A 1RHCA 6ENLA 1S2UA 1DTUA 3WNKA 1O95A 3MT1A 1KBBA 1FTXA 2OO6A 3NZPA 3G5EA 1UZHA 3ZSTA 1YHTA 5DRIA 2E9MA 3T0BA 1AH4A 2XWDA 1F3TA 4QS5A 5CG7A 1KBJA 1EXPA 2NLIA 4Q7BA 3W3OA 1Z44A 2Q01A 1ITXA 3M7WA 4L80A 2VYOA 3W7GA 3WLMA 3TAKA 4L1XA 3F03K 3P84A 4RZ4A 1XFCA 4FB7A 4BI7A 4F2BA 3TQVA 3QY6A 3BSGA 3NL3A 3VLZA 4NQ1A 4MKNA 4JTQA 2XUCA 4FR6A 4QG9A 1E4MM 4AVOA 3BLOA 4Y9OA 1RSCA 4ZO6A 3LBOA 1U1JA 3WF0A 1GQLA 4QM1A 1V8EA 4ROPA 3S5SA 3W7HA 4CGTA 1S5NA 4P7QA 1PUDA 2RFGA 1S38A 3B4YA 1Q85A 2CLIA 2H3BA 3SGZA 3MUAA 3STCA 3G22A 4MVAA 5AHEA 3LTPA 3SCSA 1MZHA 2Y7FA 4JTIA 1XQKA 2BMBA 3T09A 1MEIA 2DIKA 4R34A 4JQAA 3GXTA 2WQPA 2EBNA 2PBGA 1UR8A 3TR2A 3LG3A 4CCDA 3V36A 2CHOA 2QGYA 1VBRA 3A9IA 4E3TA 3CQHA 4R27A 4GYPC 1NQ6A 5HBFA 3GH4A 1KTCA 4K8GA 1FHVA 2RUSA 2Q3RA 1J5SA 1IT8A 1VZWA 2Z28A 3ITXA 2CLHA 1KTNA 4EAMA 3MM5B 1Q6QA 1R9XA 4FPSA 3E3HA 4MWAC 4X63A 2PDXA 4FX8A 3QMSA 3OGRA 1MDLA 5F4SA 4ACZB 4Y96A 5BMXA 2PP3A 4Y2WA 4CEUC 1U33A 1UZ4A 3RLUA 3II1A 4AMCA 3P60A 4HK5A 4IUGA 4NF7A 3GZ3A 3GZAA 2RDUA 3KLKA 2XGBA 2VD9A 1TWSA 2JFEX 3VX0A 2W91A 4A3HA 6CGTA 2OSXA 3HQNA 1W1TA 3UNDA 4DWSD 4DUWA 2XVPA 2C16A 4DI9A 4KIEA 3PY2A 2PDGA 4EXQA 5K4XA 3DIPA 1PE1A 3ELFA 1QFEA 3VOJA 1ECQA 2A5HA 3QC3A 2V3GA 2QPSA 5AZ1A 1K7XA 4PRRA 3H4WA 3UERA 4HOWA 4INFA 3WEMA 1L6SA 2OEKA 1AW5A 3PSWA 4GVGA 1DIEA 4YTSA 4Q32A 3RAOA 2O92A 4I8DA 4FOUA 1QPRA 1I1WA 3LQGA 4XZLX 4CQ8A 1ONXA 1UQYA 5CPQA 3ZR4A 3HV9A 2VZUA 3TROA 4KQNA 2XG9A 8CGTA 4X2RA 5IFPA 1UBSA 3R0DA 4OJYA 4BWLC 3U7BA 3HGSA 3AIVA 3V75A 1SR9A 2NSOA 5DMLA 2YBUA 1G0CA 6GEPA 1PZ3A 3JZUA 3VIHA 5FJIA 3PG9A 5HQLA 4UXDA 3FCPA 1ZJ9A 4HSNA 3A3HA 2BVWA 2EQDA 3WNMA 5C9UA 4DJFC 7GEPA 2DT3A 4ICCX 1AL7A 4HTRA 1SO5A 3CIXA 1UKTA 5HR7A 5BOEA 4C6NA 4ZQOA 3DECA 1R9YA 3VIPA 4QSHA 4JN6A 2QMJA 1WB0A 3R8GA 1XLAA 2OTDA 2R94A 2CZEA 2TMDA 4JY8A 5AY7A 3PZ9A 1WOBA 1BD0A 3ITLA 4AEFA 3K5XA 2JGQA 1OF8A 3GFYA 1R87A 4LV4A 3N17A 2WPBA 3OLGA 3NZGA 2J9ZA 3AIUA 1KV5A 2D2JA 2YW4A 4RDYA 4H7CA 4QR6A 1PHWA 2Z1VA 2ZA2A 3ZXWA 2FDSA 1YRRA 1ZAHA 3RJXA 2ZUWA 4B5VA 3H7VA 3L4XA 1C9DA 4KW2A 1GW9A 2I9EA 1TO3A 2PDIA 2PGWA 5ABGA 4LH8A 1H1ZA 3E0VA 3RO8A 5ABFA 3DH7A 3LHTA 2PGEA 1THFD 1PCKA 3WH5A 4F40A 5F2IA 3ZJ6A 1RXOB 3BJFA 4AYSA 2WCSA 2FH8A 1OB0A 3LDVA 4AIUA 3A13A 3RNDA 3H55A 3ZIZA 1BTCA 3GTHA 4QISA 4ERAA 1H09A 2QDHA 4HT3A 1XKJA 2FB2A 4AHPA 3IRSA 2DJLA 3ONBA 4L7ZA 4NX5A 3RR4A 3MM7B 3MP3A 4UCFA 3TW6A 1P43A 4KFOA 3SURA 3DGBA 2BY2A 1Q5MA 3P5ZA 4JYEA 4L9YA 3THAA 2KAUC 1KGXA 3TN6A 3I3EA 3DEQA 4IFKB 5T26A 3BAKA 3PNZA 1O1HA 3A4AA 3L2LA 3WQVA 4W7WA 3GBDA 2DIJA 2X41A 3VKQA 3B8IA 4BQ2A 8RUCA 3FY1A 4AWUA 1PWLA 4AIEA 4CQ9A 5E9AA 3S5YA 1I2NA 4M81A 3AXKA 1ME8A 3OLEA 2A6NA 2ZRVA 2J7HA 4D6IA 5DX7A 3BLFA 2WHKA 1AW1A 4CCEA 1BYBA 3LUTA 4PUUA 4D6FA 4HZ7A 2DGAA 5CPNA 4Z2HA 1ITUA 4LBRA 1EWDA 3SCNA 2INEA 4JKMA 4POCA 3G8RA 4O14A 4CQDA 1BQCA 3NGFA 4M0XA 3SUVA 3KDOA 1LT8A 1MRQA 2V2CA 4BR1A 4UQ9A 1W1IE 4FZIA 4B5XA 4O10A 4LFYA 2V5LA 4H9TA 2QYGA 4IP5A 5FIPA 4WSHA 1TPC1 3TA9A 3CZGA 4MHBA 5CGTA 1AMKA 4G8TA 3SUTA 1Q6EA 3TW9A 3IJ9A 5ABFB 1W9VA 4HSOA 3OVQA 1M68A 4DRSA 3E0FA 4IH3A 3ID7A 3M07A 1EL3A 4GQRA 2DSVA 3BZGA 1DE6A 1JGIA 4XUGA 4BF5A 2ZCGA 1QPKA 3P81A 4GC4A 2WSKA 1YADA 1NARA 4WKHA 5CLWA 1OG6A 4FF5A 4GX9A 4U3CA 3E38A 1UWIA 1NWRA 4GIRA 5JH1A 1D3HA 2W27A 3BV4A 3NDYA 4AVNA 2HJPA 2Q6ZA 4HN8A 3DZ1A 3UYCA 7XIMA 5HMSA 4MG4A 1HG3A 2ZZ7A 1R2SA 4G6CA 3AAMA 1GTEA 3V35A 1QNRA 1QXLA 3KOYA 4BQ4A 5E5CA 4GUIA 4GH1A 4S38A 4WDUA 2GVGA 3QY7A 1ADSA 1ME7A 3PJXA 3RO6A 5D05A 3BG5A 1ECEA 3VFCA 1T5AA 4YXGA 4JNZA 5CJ5A 5ABEA 3MA8A 1VCGA 2PURA 5HNUA 1T96A 4MDPA 2X16A 4M7TA 4O17A 1GVFA 1ZBVA 2GWNA 3QY8A 3TSDA 3VD3A 3P6LA 1UH4A 3WY1A 4IP4A 1QO2A 5IM51 3HN3A 4IGHA 1QI3A 1W32A 3WDIA 3AMGA 3IAQA 1CZ1A 2E5DA 3V5FA 1PDZA 1E9ZB 1UWSA 3GIPA 3OJGA 4HCLA 1US0A 1KR1A 3CJPA 1RCOB 2FB3A 4XZIA 1AQFA 1S2TA 1DWHM 2BDQA 1C92A 2GSHA 1TVLA 1KM0A 2Q09A 4RE4A 1DV7A 2BSLA 1P6WA 1ZAIA 4PBEA 1ZJHA 1R46A 4GMEA 1V02E 4LAUA 4RNJA 4QNEA 3C6CA 3STPA 5FA5A 1FKWA 5F1UA 5DXXA 1E6XM 1OWQA 4H9YA 2BG5A 3NIYA 4EE9A 4QRNA 2D20A 1OG0A 3MSGA 1UZ1A 3EOEA 3TXZA 2ABAA 4J5NA 3PP7A 2JIEA 2VUNA 1JPHA 2AGTA 4JXCA 4BEUA 4HA4A 3SCPA 3RRXA 2GGEA 3N6JA 2NQLA 3MP4A 4L1WA 3L4VA 1NDVA 3CAWA 4L4PA 3BLIA 1F5ZA 3PUOA 2G5WA 4GCXA 3DC0A 4L6DA 1DQWA 3CXOA 2PDWA 3VTRA 2UY3A 3MMDA 2PLKA 2J66A 2J7BA 4M24A 3IJIA 2XJ7A 3LY0A 1AODA 1GQJA 3O07A 1EDTA 1U2YA 3FJ6A 3IJQA 5A69A 5A8PA 1TIMA 3GR8A 3ZM8A 5CBBA 5F2LA 5F2MA 2F9RA 3M0YA 1B0IA 2HWGA 2XSBA 4TX9A 3KX6A 3B03A 4NASA 1B5TA 3CV7A 1TRIA 2XVLA 4WOZA 4W84A 1VQTA 4HPXA 3W84A 1TZZA 2CLLA 2NX1A 1YPXA 3AHTA 3NM3A 3O6DA 4KERA 3L4ZA