4S38A

Ispg in complex mecpp
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
401
structure length
400
Chain Sequence
MRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
total genus 139
structure length 400
sequence length 401
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s38A01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s38A02
4D8AA 2OGYA 3H24A 3B0LA 2V4JA 3MM6A 4GEPA 4S3CA 4NHVA 3MMCA 1TWSA 3MCOA 8GEPA 3MM8B 2YCLB 1AD1A 4HTRA 4DJFD 4HB7A 4S39A 2AKJA 3MM7B 2Y5SA 1Q8AA 4C1NB 4MWAE 3MMAB 2E7FA 2YCJA 2GEPA 2XSJB 3VM0A 3TYUA 3TYBA 4DAFA 3H2AA 2H9AA 4NL1A 1Q7ZA 3OR2B 4MWAD 2YCIX 3MM5B 3TR9A 4S3DA 3BOLA 4DJEA 1ZJ9A 3B0HA 3TYZA 4DJDD 7GEPA 4O1EA 2V4JB 3MM6B 3H21A 4G39A 2Y0FA 3MMCB 4PZVA 4MWAC 5AOPA 2VEGA 1AJZA 1TX0A 4DJDC 4S3BA 3H2EA 1TWZA 3H2MA 1Q7QA 1EYEA 3TZFA 1Q85A 1ZJ8A 3VKQA 4NIRA 3VKRA 3MM9A 3H22A 2H9AB 4G9PA 4DJFC 4DJFA 1TX2A 3H23A 3MCMA 1Q7MA 3B0MA 4S3AA 3GEOA 3MCNA 2YCKX 2VP8A 6GEPA 4DAIA 3K13A 2AOPA 3B0NA 3TYCA 1AJ2A 3H2OA 1Q8JA 3BOFA 3AOPA 4MWAA 3OR1A 3TYEA 4DJDA 5JQ9A 2VEFA 5GEPA 4G38A 3H26A 4D8ZA 3VLZA 1AJ0A 3VLXA 3MMBA 3MM9B 3H2NA 4O1FA 1AD4A 2DZAA 3B0JA 4D9PA 3VLYA 4NILA 4S23A 2BMBA 4S38A 3NOYA 3B0GA 3VKSA 1AOPA 3MM8A 3VKPA 4S3FA 4MWAB 2YCLA 3H2FA 3OR1B 3H2CA 2DZBA 3MM7A 3VKTA 4S3EA 4C1NA 4CCZA 4DJED 3MMAA 3VM1A 1TWWA 3TYDA 2XSJA 3V5OA 4O0QA 3MMBB 1F6YA 3TZNA 3TYAA 3OR2A 4AOPA 2DQWA 3MM5A 4DJEC 4DB7A 2Y5JA
chains in the Genus database with same CATH superfamily
4AAJA 4BS0A 1UR4A 3TP4A 3PWGA 2VQTA 4IQJA 1BD0A 2AL2A 3GR4A 3ITTA 4IQEA 2G3FA 1K9DA 1EZ2A 3NQAA 4ZBCA 4KIEA 3VD5A 3UG3A 3OOQA 4MYXA 2YPIA 4ZQRA 3R89A 1MWOA 1ZPTA 5DBUA 4NXSA 4B91A 5AVHA 2CLIA 1A5NC 3ZO9A 2H9AA 4DAFA 5C9UA 5AYYA 3W53A 4PMYA 3P7YA 4H6QA 1PO9A 2VVSA 3KVMA 1BRLB 2RJHA 2RDXA 2V5JA 3QR1A 1DE5A 1DHPA 2XH0A 4V2XA 3BG5A 5H91A 4XQ6A 4LVGA 3W7OA 5C2GA 5F2GA 4JNYA 3SY8A 3UCCA 1RVGA 2PBOA 3W25A 1QOQA 4KCTA 4D6JA 2XINA 1J2WA 1EOMA 2WVUA 2E6AA 2X2YA 3RYSA 1WE5A 3EOEA 1JDCA 1YXCA 5JQ9A 4HYVA 2EHHA 1GYMA 1FXPA 4B5NA 5BOOA 1K77A 1DJIA 2YGYA 2DSWA 3BAYA 4XVDA 2VRKA 2XFWA 1EWDA 2A3AA 3ZJ8A 3SUWA 1OGBA 2GK1B 1WZMA 2CLLA 1IZCA 1WO2A 4PRTA 4E4UA 2XGZA 2POZA 4OIFA 1T8QA 5E6YA 1DP0A 1XDJA 4KT2A 4TV5A 5AKQA 3EWWA 3CL6A 4AU0A 5LXXA 3SB0A 5A8PA 4KWWA 3MI3A 4HYWA 1VR6A 2VCCA 3RGTA 3TDFA 3IVTA 1YLVA 3EX2A 3RO6A 4DM2A 2WXDM 4WLCA 4IP7A 2J6VA 3EGJA 4FPSA 5BXSA 1FWCC 5EKYA 3U2CA 3NGJA 1VZWA 1GPFA 2G3MA 3BW3A 3SZ8A 2VGGA 4Y6GA 6REQB 5D2VA 4O4VA 3W6LA 4Z1BA 1H7XA 3S6DA 4W7UA 1W3NA 4HIBA 3ITLA 3TC6A 4DAIA 4WD0A 4UTHA 4HVXA 3B97A 5TBOA 1MW2A 2XZ9A 4GD0A 3PK7A 1XYLA 4B2DD 4M24A 3HJZA 1KM1A 5JIPA 3WLMA 4RNFA 1AL8A 2F6XA 4GI4A 3B4UA 1J4EA 5CAHA 4GLEA 2W0UA 1KB3A 2EJAA 5AFDA 4LNYA 3KOFA 5M1TA 1E4IA 1EX1A 3LB0A 4CQCA 2YA0A 4J3WA 3QHNA 5CC3A 3VKPA 3F2DA 5HNNA 1WDQA 4H04A 4UMCA 3SDOA 3WH9A 4AIUA 3MT1A 2EEXA 3EXSA 2BBFA 4AOPA 4PULA 3DFHA 1WBHA 2C1IA 3BQ5A 5FJPA 5CCZA 3MM8B 1EPVA 1IZKA 3BLOA 4Z1DA 4MKNA 1GVIA 3FHAA 2OYLA 4RCXA 1N2VA 3OODA 4QQ3A 1WPCA 2VELA 4MAVA 5HMFA 1GVSA 1VBJA 3MSGA 2OQLA 3L21A 2ISFA 3PBUA 4RDZA 4NJKA 1OWQA 2ALDA 1T96A 1E55A 3RDKA 3K4WA 1H7RA 4NZFA 3OGRA 3VKQA 4CNPA 1XDLA 2P76A 3LLFA 1HNYA 3USZA 1OF8A 3S0CA 3HQOA 3ZXWA 2Z00A 2WQDA 4REQB 2RH9A 3OBKA 1XRTA 3L4ZA 4NT0A 3OR1A 3ABSA 2H90A 3GG7A 1EF3A 1VFFA 1AL7A 3CV1A 4Z2GA 3UR7A 2A7RA 3WLTA 3W72A 1Y5WA 1V5XA 5M2FX 3OEXA 3ABZA 4OV4A 1SO4A 3VU2A 1YNQA 2PDJA 4GYJA 4JL2A 3H2CA 5D37A 4ACZB 4M7TA 1ODZA 5LSMA 1ADSA 3QZEA 3SQSA 1QAPA 4M7SA 4NJHA 2NX1A 1CIUA 4B2DA 2RGMA 3RK8A 1NDZA 1RQEA 2F8QA 3V35A 2OZTA 2QGHA 1UR2A 1FWGC 4O1CA 4FO4A 5FJJA 3UWWA 2VZVA 3QQ0A 4DXXA 3LZ3A 1JJKA 1X8FA 5DCEA 1R3TA 3UERA 1OIFA 7REQA 3CHCA 4X60A 4ZOAA 3S5NA 4E4PA 1EFZA 2R94A 3TIMA 2D24A 3PJUA 2D69A 4YTQA 2O9PA 3EMZA 3Q67A 1JZ5A 3M6DA 4H6RA 1GVOA 3ARYA 3C86A 2FVLA 4ASTA 1CGYA 5D9PA 2VC9A 1TMQA 4FEZA 2QIIA 3AXXA 3ITVA 2B7OA 1VBUA 3CH9A 3ITXA 4CD5A 5BMWA 3NM3A 1V6XA 6TIMA 3GB6A 2GWNA 3CHEA 3B0MA 1I45A 3BZJA 3UY7A 4NZ4A 3VD4A 2GL5A 3DG6A 4IUGA 4KH2A 4EP8C 1GZ1A 4B90A 4KERA 1O68A 3VKBA 1J0KA 4IP4A 4O13A 2ZQ0A 2MANA 2CETA 2YDSA 4HCDA 3LUTA 4GY7A 2YL6A 1OX6A 4Z0SA 5HWJA 2PCQA 3QOMA 1BLIA 4NYYA 3W1XA 1GT8A 4A3YA 5A94A 1W5PA 5CZTA 5ECUA 2DUZA 4O0QA 1WOAA 2VD9A 1KRAC 2I14A 3UZXA 4ZENA 4JYEA 1KA9F 2WC7A 1C29A 1ZAIA 2CESA 3K4AA 5AZ0A 4C90A 3BOXA 4HPXA 2ZIDA 4LUJA 8GEPA 3ES7A 3CU2A 4XZMX 2VFDA 1Q3NA 1VIZA 4B9YA 3LCXA 3VA8A 3W7GA 4KWUA 4JTSA 1ZY9A 3GK0A 3RO8A 3LPFA 2WANA 4HSHA 4O1EA 1JR1A 3VTRA 1LWHA 2J8FA 2RKXA 3LLDA 2HBVA 4G8TA 4ORMA 1LBMA 5E6ZA 4C6KA 5D2YA 4HHLA 4HZ8A 2BZNA 4F0HA 2L5HA 3KWSA 1GYLA 1VFUA 4OE7A 2A7NA 3EYPA 1I2OA 1VLWA 3GXNA 3TKFA 4PUWA 4DNMA 1ONRA 1IT8A 4O8RA 1LUCA 1VRDA 1RP8A 4BR1A 1G7UA 3GD6A 1UOKA 3N2XA 1FHUA 3EWXA 1TV4A 3S1UA 1ZFJA 4FLRA 4RZ6A 3PN8A 2DZAA 2GGEA 2OXNA 4QBXA 3NWRA 3C0SA 1DWAM 3DERA 3AI0A 3GXDA 4O17A 1XRFA 1FCQA 4CQDA 2DSKA 4MWAB 4WF7A 4MNLA 1K02A 5FSDC 2HPMA 4OECA 4JGDA 2Y7FA 1KBLA 1UMYA 3AOFA 2QPUA 1V6WA 5J5RA 1KTBA 5BNKA 4KF1A 3G2GA 3PBMA 3QTPA 1JIBA 2HXUA 5JMUA 4XSLA 4UTTC 1O94A 4IIFA 4UQCA 2QPSA 2OR2A 1DIEA 2DQXA 1G4SA 2PTZA 4S39A 3GHTA 3W81A 1M04A 1W5OA 4FXSA 2UY4A 3NQ6A 3DUGA 1NWSA 1G4EA 1V0LA 2J47A 5D05A 4ICNA 2DUXA 4Y96A 4PTNA 4JN6A 3NCOA 3QC3A 7TIMA 1C3FA 4GYPA 1UOZA 4FI4A 3DG3A 3CHFA 1AK5A 3WD2A 4LAUA 3W1AA 1I2NA 3FN9A 1ECEA 3QQ1A 1VGAA 3WUBA 3STFA 3GDLA 4JIRA 7ENLA 1Q7MA 1RZMA 4BWLC 3U48A 1HKWA 1A0CA 2FIQA 3EMQA 3GNNA 4HNVA 2ISWA 4N6FA 4QJ3B 3KBWA 4YTSA 5DMNA 2GGIA 1XYAA 4W8BA 3BV4A 3E12A 1X1NA 2CLEA 1J96A 2WCSA 2QJHA 1FWJC 4QEHA 4X22A 4HT3A 3WD1A 4DBSA 3EWDA 1K7FA 4FHAA 3W9ZA 4LVAA 3RJXA 3UQNA 1P0DA 1HW6A 3WQEA 2PWFA 4ZQMA 4S3FA 2DT3A 3IGUA 1W1PA 4IGNA 1M7OA 3DBPA 2NQHA 3ORWA 3PZNA 4ECLA 1DBTA 1H5YA 3UZ5A 4O0ZA 2NV2A 3WH7A 3CZ8A 1EYWA 1KM3A 5G4WA 1QW7A 3SUVA 5CJ5A 4IIDA 4AD0A 4L64A 3W2MA 3T6CA 3RU8X 4N02A 3WBXA 3NZPA 1KXVA 3UG8A 3N25A 1UD5A 3L68A 1Y7VA 4WY0B 2WMIA 1VB9A 3TQPA 2TRSA 4NSBA 3G18A 5CC6A 4ONVA 4QX4A 2GSEA 4MFDA 3CAWA 3GHUA 1FWSA 4EKJA 4KMQA 2VEGA 4M6VA 4YJ5A 2IKIA 3PBVA 4M1RA 2R1PA 3XINA 1HF6A 5JXQA 1FDJA 4QJ1A 1ITXA 1LL4A 5C55A 2PWVA 1EHAA 2YL9A 3INPA 5CLTA 4DWDA 4Q4RA 6PTDA 3N18A 1H11A 5A6KA 3OHMB 3PFMA 4S3JA 2CLOA 4J2MA 1W1A1 3E2RA 3ITYA 4HGXA 3GIQA 4MUPA 2WNWA 1RCOB 2ISVA 1Q66A 3F5JA 4GYKA 1U5VA 5AC5A 4W8AA 2NV1A 3LSCA 3CM4A 1PJ9A 1S2AA 3ZZ1A 2G8ZA 3VUPA 5LGZA 2VJXA 1PZ1A 4J40A 2X7WA 1W3LA 2WBGA 1R7OA 5F2MA 4Q6JA 5LNUA 1J01A 3MDUA 3LOTA 4CQ8A 3THUA 4A22A 4W7VA 3W7MA 2WPBA 2HSAA 4DUOA 5C9WA 4HMDA 4GZ7A 2QUNA 3RFAA 4FNQA 3B8VA 3HG3A 1KLYA 2CC0A 1GGOA 3F4WA 4JHOA 4PZVA 3IARA 3GTNA 4B3LA 3GUWA 2QPXA 5G4EA 2YXOA 1Q2SA 5I79A 3OA5A 1X6LA 3VCCA 2ZZ3A 1I2RA 4Z1YA 1B90A 2HROA 2CZDA 4AXKA 1I2QA 1F74A 4DIAA 1QNSA 2D23A 4DBDA 4CN1A 3ZT6A 3T0BA 4A3UA 3CL7A 3K46A 1UD6A 1UYQA 1SZFA 3EOLA 1ISWA 3O63A 4LANA 2PZNA 3REQB 4B5VA 3POHA 3AXMA 3NOEA 4L61A 4LAMA 4A6GA 3LS9A 4NILA 4N2YA 4F40A 1EP2A 5I3HA 1MZRA 2E28A 3II1A 3O15A 2ZRUA 3G8RA 4M82A 4P7LA 2Y62A 1G6CA 2NUYA 4LRSA 4H83A 2CFFA 1HL2A 4LEFA 1F6KA 1LOLA 1ICQA 3FA4A 4PB5A 1MQPA 1GZJA 3NDYA 3E02A 2PD9A 3IUHA 4HPJA 1RQBA 1FWNA 4XVEA 3N2MA 3AS3A 2DFAA 4GZIA 1UQYA 3CTTA 2J8TA 1PL9A 3W37A 1H0GA 2FYMA 2X41A 2A4AA 4PMVA 3WQFA 3W2JA 4LUTB 1XIJA 1OFDA 5T9BG 3VABA 1OFAA 3PPFA 3GC5A 5EU9A 2ON3A 3TQVA 3KL5A 3QFWA 1D7KA 4RZBA 4OKDA 3RITA 3IV8A 1TPB1 3UWYA 1TA3A 3S5OA 1W91A 3H23A 5CZKA 3QZAA 4N0RA 5GNZA 2PP1A 4PL1A 2O7QA 4JIPA 3AOPA 1MQRA 1XPYA 1XH2A 1UJPA 2DUAA 1OCBA 2J88A 4D1JA 3MM9B 2PGWA 3BCJA 3AMGA 2QCDA 3IUDA 2WAGA 3QYSA 4J3ZA 5JH1A 4KETA 4QRNA 4D71A 3N11A 3V4BA 2FZMA 5GVJA 2Q01A 2QEZA 3W7KA 5BWAA 1CENA 4ZODA 1YYAA 4DJED 5HOSA 1Z48A 3W1PA 1Z41A 4OHQA 4HA1A 3Q94A 1FOBA 3R2GA 3O0KA 2Y5JA 2AGKA 3NA8A 3B0XA 3QYQA 1DJQA 5C2CA 3EX1A 3MM6A 2IMRA 4DZ5A 3S5ZA 2J13A 2O55A 3C6CA 1QATA 2VOTA 3CB3A 2AL1A 1F73A 2P5NA 5D2TA 2W62A 4HHHA 3GYCA 5EMMA 3VOJA 1R9ZA 1TELA 3MO7A 3QLDA 2P0IA 4GE8A 5F4XA 3TYZA 5A8QA 4PTWA 4IPLA 4JFWA 3QKEA 3EZ4A 3IIZA 3GTFA 3SY1A 4IFKA 3GH5A 2PTDA 2Y8UA 4AMAA 4GOAA 3WBYA 1V7AA 4GJIA 1DKWA 5AC8A 1EL3A 3GY1A 1QT1A 3I7RA 4P2VA 1AZ1A 4FZIA 3CIWA 5G2WA 1X6NA 1QO2A 3DG7A 4F79A 1B2YA 2JGQA 3VNLA 3H55A 2G3NA 2Z26A 2YW4A 2J62A 4G7EB 2QQ6A 4POCA 2E4TA 3STPA 1NVMA 4HSNA 3WJYA 3QSRA 3L5AA 1RHCA 2XIJA 3MQTA 1RUSA 1W3HA 1KKRA 3LZ5A 3PZUA 5A6AA 1DV7A 1XKJA 5K9XA 3T05A 3SSZA 1VAHA 4CLMA 4JDYA 3RM4A 4IXXA 3THDA 3ARPA 2ZZ4A 1EKOA 4ICMA 1BG4A 3TTYA 1Y5XA 1RQHA 1GOIA 2YDQA 3W7IA 4QE1A 4ZO9A 4Q8VA 3M0XA 3DI0A 4MDOA 3WDQA 4JS3A 3EDDA 3VMOA 3MM7B 1J0ZA 3O6AA 1GQLA 3TR2A 4TX6A 3OVQA 4BEUA 3TJLA 4ZTXA 3DKLA 3QC0A 3C52A 4XAFA 4DJEA 3VDBA 2DZXA 3AYVA 2Y7EA 4NAEA 4J7RA 1U1JA 3DU0A 4P7RA 1N55A 3GDTA 2OO0A 3PTQA 1LBLA 4HA3A 3RLGA 2V8ZA 3S2CA 4CD4A 4RL3A 1GEQA 1XYBA 2R1LA 3M0VA 2CITA 1VBRA 4V1XA 1VEMA 3I3BA 1GVYA 3SN1A 5HJYA 3WQVA 4NZ3A 1BYBA 2YA2A 2Q8ZA 3TN6A 4ZE5A 3CV2A 3A23A 4H2HA 2YZRA 1S38A 2UZ9A 3AIEA 1OX4A 3QV8A 3VKKA 4PBGA 5C71A 1Q63A 2WM0A 1XRSA 5E9XA 1PUDA 1F5ZA 1LLOA 5HMDA 2ZX8A 4HQVA 1Y65A 5CSSA 3W7PA 3HQNA 4O4WA 4CD6A 3WFLA 1GORA 4EPBC 6ALDA 3ALGA 4UUIA 4YMZA 1GG0A 3KCJA 4CN4A 1XLJA 3LU2A 2QDHA 2RGLA 3VINA 4AF0B 2W3ZA 1JCLA 2QCCA 1X98A 3W2LA 5M03A 1EO7A 4C1NB 4U2ZA 3E2VA 1MO0A 1V77A 2HJPA 3QY7A 4AC1X 3FXGA 4JTTA 3OR2B 2A3BA 3IS4A 5I7GA 3EX6A 3VDAA 5BXPA 2AL2B 4PUKA 1MSSA 2YB1A 2ATSA 2D3NA 2W66A 3S9IA 1GTEA 5GJNA 3BAKA 1ADOA 2PU1A 2H9AB 1CNVA 4Q6XA 4RXGA 1KFWA 1X6UA 3MCMA 1GEHA 3I3EA 3QOKA 1QI3A 4H9XA 4HU3A 2GZXA 3PC0A 1W1IE 3LK6A 3HO8A 3QPEA 4XV0A 5DCBA 1Q13A 2PLKA 3V7PA 3MW7A 3ZOAA 3RU6A 3GFXA 3AMCA 1ODUA 3RRAA 3BJFA 3R58A 3M16A 2EGZA 1UR3M 1JNEA 2QCHA 2PE4A 3AS0A 5LA0A 1UPPA 4OUEA 1A49A 3UJFA 1NU5A 2V3FA 1N7KA 2FDSA 5FEXA 4BA0A 3FXYA 2V9DA 5AC6A 4AG0A 2V3DA 3IWPA 5FCZA 2GGJA 1R8LA 2OWCA 3APYA 3RLHA 1ECQA 4PUJA 1IEXA 1I2PA 2OGYA 4FR6A 3WN6A 2YJQA 2PRMA 4JBRA 4ZMGA 4M51A 3E2QA 4I6KA 2BTMA 1YTDA 1SYTA 2DZVA 2J7DA 4LBSA 2PAJA 4G6CA 4ADSA 1W5MA 3J7HA 3UY8A 1FWTA 3CO8A 2WVTA 4YCPA 4PA8A 1WB0A 3T0TA 8TIMA 2X0SA 1A5LC 1Q65A 1PTDA 1DWGM 3EMCA 2CZ5A 5DANA 3G3DA 1LT8A 2WZHA 3M4HA 4N7QA 3VKRA 1H7PA 2DJLA 4AZBA 4PTDA 5A95A 4DVOA 5CG7A 2ZUWA 2CEQA 2PDLA 2AQVA 3W07A 1F3EA 3FVDA 2GVGA 5DMYA 4H9TA 1Q8JA 3MMWA 1OK6A 3SQLA 1HKKA 4GUIA 4AD2A 1FKWA 5F2IA 2Y7GA 3WJXA 4F0SA 3IJ7A 3A47A 4MY8A 3OLDA 5MKGA 4YYFA 3UW6A 2VTFA 4FNRA 2OOFA 2OT0A 3WG6A 2XVKA 2WCGA 1AW2A 3CAQA 1A5SA 3M0HA 3UCQA 1NIUA 1KCXA 3GHRA 2INZA 2OYKA 3VM1A 1XCWA 3I6EA 4PB3A 1A80A 3VNIA 5F2LA 1P7TA 4HK6A 3CLMA 1E0UA 1R46A 1WZKA 1IYXA 1VCFA 2YL5A 2C71A 3S6OA 1ISYA 1EJXC 1NH6A 3NZQA 2BOGX 3TC3A 2CYGA 1AH3A 2IXVA 3GX9A 1UKPA 3IPWA 3AC0A 4UMAA 4HTRA 5DF0A 4U5KA 4ZFMA 1JL8A 2C19A 5ABHA 1W9UA 2ZX9A 3GLCA 1XR2A 1RBOB 1S2VA 5HJXA 4TX8A 4E8DA 1OFBA 1CXLA 5FI8A 2BVWA 4MFEA 3NQBA 1XWYA 4Q8NA 3W7NA 3UXIA 3O06A 4XAGA 2Y8KA 1XKYA 3WJZA 3R25A 1T5AA 1BF2A 3S2JA 2QJMA 3MMUA 4RZ5A 1XD1A 4LY8A 1QNVA 3PTDA 4CQ9A 1QWKA 2X1UA 3F1QA 4KBXA 1HQTA 1LOSA 2NW0A 1GQIA 4BI6A 3DHDA 3ARZA 3TSBA 4KESA 1DJHA 5ABEA 2QAFA 3V36A 1GZGA 1A53A 3ARRA 3OR1B 2IQTA 3G8EA 3TMQA 2Z1VA 4GFIA 4MGGA 1HVQA 3WKZA 4RE4A 3G1RA 1WZLA 2J6XA 1UUQA 1ZBWA 4ZOBA 3GDKA 3UETA 2XM2A 1H0IA 1E3XA 2FB3A 3WL0A 5L9FA 4LT9A 1WAUA 5LIUX 2Y88A 3UR5A 4JNMA 3VD9A 2P10A 4FA3A 2ZBTA 5EFDA 3UEQA 1EJUC 3U2ZA 1VS1A 3VCNA 1TO3A 3S1XA 3W87A 1JPHA 4EOUA 3R10A 3WELA 3GG1A 4C6BA 1OD8A 1QJWA 3GIYA 4AD1A 3VKAA 3PUOA 1XLBA 7REQB 3B8IA 1KWKA 2IKGA 3AFBA 4A35A 4BQ2A 1V0NA 4R33A 1NQ6A 2QGYA 2EQDA 1UKTA 3ES8A 4Q7BA 2EAWA 2Z7GA 3LGEA 1QHOA 2ACSA 2QJGA 5G1YA 1H09A 3DEQA 5ABTA 3F5LA 3TUUA 1MEHA 3GW3A 7PTDA 4WJEA 3WFZA 5E9AA 4KCUA 3GFZA 5BOEA 1XHGA 4IPNB 4IFOA 2JIEA 3PFRA 8XIAA 5DEZA 1FWBC 4S23A 1BWLA 1GYNA 3DFQA 4LPCA 1QDSA 4ZO8A 1E6SM 1W37A 3PJWA 1UWQA 2D22A 1B54A 4JTKA 4PYSA 3QHMA 5JBEA 5B80A 4PUNA 4QGCA 4D6FA 2BNJA 1VPYA 1TSIA 3QGVA 4W9TA 3ZYZA 2RDWA 1W3KA 5DQPA 4K38A 4AVNA 1NDYA 4DJFD 3RM8A 1XYZA 1L6WA 2FZ9A 2ZZ2A 5EL1A 4RE3A 3N17A 3KTCA 5HPOA 4C6JA 3RR4A 1A5CA 3AHXA 4JTRA 1MNZA 2ACQA 4WHBA 3U4FA 4YIWA 3MO4A 3SY5A 3TK7A 1B30A 2WZMA 2JF7A 2VCAA 4GNKB 2INEA 1QPRA 2H6RA 2ZXQA 3TLLA 3TOPA 1H4PA 1LM1A 3KDNA 4C6IA 4W4QA 6GEPA 2X42A 3PANA 1PHWA 1GOKA 5BYWA 1TUXA 3GVGA 3PS7A 3PG8A 3VNYA 4PMOA 1ZTVA 2BVYA 1DTUA 3LG3A 3VIJA 3ARQA 4CQBA 3L12A 1XXXA 3G24A 4EX4A 4TMBA 5LKYA 4ACYA 4QG9A 3NL5A 1V3MA 3HPZA 1GCYA 2GGGA 1LUCB 1OZQA 4HMCA 1IXPA 4LS0A 1GJUA 3AAMA 1V03A 4QDWA 5CPQA 1K6AA 4CNTA 1S1PA 5IDIA 3B8TA 1Q4WA 4YPJA 2ALRA 4M6QA 3R12A 1X1ZA 1PX8A 3EB2A 4D2JA 8CGTA 1A3WA 5CEWA 5I3JA 1J2BA 5GPRA 1S2TA 4WQ6A 2GSJA 4IFRA 3VD3A 1BFNA 1DEDA 4XKMA 1XGZA 3LI1A 5EPDA 4YHGA 1EP3A 2P8CA 3W75A 4KFNA 3B0HA 1U83A 3UZWA 3S2LA 3PY2A 1X39A 1NP2A 3ZMRA 3GDRA 2XH7A 2QT3A 1TWZA 2ZE0A 2ADAA 4GQRA 2PGEA 1NOFA 2QDEA 1OFEA 3WF4A 3A12A 4DJFA 1I0DA 3W24A 2GJXA 4HBKA 1XBYA 4AMCA 3SAZA 3P60A 3DH7A 4M5PA 4RNIA 5DMMA 1F8MA 4FLOA 2CHRA 2VDHA 3R0UA 1H49A 4EAYA 1VFLA 3FJLA 4TUFA 1JD9A 5DT5A 3ARXA 3APGA 1D7FA 1OSEA 2J74A 4MIMA 1UZ1A 4PCTA 4UQDA 3ZSSA 1KV5A 1ZQ5A 1O6IA 4MG4A 3IACA 3FY1A 4DF1A 4F48A 6REQA 4Y9PA 2Z29A 4WXYA 3VIFA 4UTUA 1QRQA 3CUJA 4P7QA 4I9MA 3A64A 4ZVJA 2NUWA 1TE6A 5EA9A 2X1SA 4FXFA 3SR7A 4EANA 1VLIA 5HNTA 1C9DA 2C7FA 2PWHA 4DM1A 4ZFCA 4ES4A 4W86A 4Y9MA 5E70A 2V5DA 5BROA 3S83A 2YSWA 4KWVA 3A3XA 1BWVA 3O6CA 1EJWC 3GYEA 2XVPA 3DECA 1SM9A 4WSHA 3S8HA 5DY3A 1XFBA 4PUUA 4I5XA 4GGHA 3U7BA 5E1QA 2JALA 1XIFA 1FKXA 1BG9A 4XTIA 2WMIB 2OJPA 3TSDA 4ZGYA 2OCZA 3WNMA 1Q45A 1TPC1 4AZHA 1HKIA 3MZNA 1V02E 4JTQA 4GXPA 2DT2A 2PDGA 3DBNA 4UR8A 4ZEPA 2VKZG 3MKCA 2XDFA 2E67A 3EB4A 3PJXA 3NQEA 4QDPA 1AD4A 4X2RA 3GXIA 3S42A 1LLZA 3VUSA 1SR9A 1FBAA 3V0SA 4DELA 4ZQNA 3KTSA 4YL2A 4K37A 2Z6IA 2D2OA 1HFBA 2D2GA 3R0KA 2QUTA 1EWEA 1AW5A 3UXAA 3W0KA 1OZMA 3PZGA 3PB0A 2V63A 1HJSA 1WKEA 5FSEC 2CBVA 4BQ4A 4R53A 4X9YA 1E51A 2O0TA 4H7VA 5HR7A 3TNOA 3R1ZA 4JPGA 4PMQA 3BLKA 4DUWA 3BJTA 1H7OA 4H19A 3HFTA 3F7JA 1H5VA 4DBWA 1V8EA 1QK2A 1P6BA 1ZBKA 2HMCA 2YL8A 1Z9AA 3B8DA 4JTJA 3CUIA 2JFEX 1C93A 3CWNA 1NDWA 2J7EA 2OX1A 5GNXA 1KC7A 4ACZA 3URBA 2TODA 1ZL1A 1DJGA 3STCA 1R85A 4UTJA 3QF0A 1UZHA 3WQOA 3APTA 4JQAA 1LWIA 1RR2A 1EOKA 4Q7IA 3RMEA 2CBJA 4GIEA 2BGNE 3SRDA 2B81A 3W7JA 2Q6ZA 4TR9A 1EGMA 1K4GA 3PAOA 1D8WA 4H7ZA 4ERAA 3OGSA 4GINA 3GKAA 4YNGA 4A29A 4D8ZA 2FMNA 1U22A 3C5QA 1E3ZA 6ENLA 4Q33A 1F2JA 3OBEA 4L4LA 3I3DA 2BG5A 1KV8A 2O9OA 1F7BA 3T7VA 2C0HA 4QE5A 3LEPA 4PFHA 2CLPA 4AISA 3LGDA 3RMJA 4JTFA 3PTMA 4HA4A 2V38A 2I5QA 5BZAA 2DQWA 3KZPA 2WHMA 1BTMA 3VX0A 3LHWA 4QLKA 4BY3A 1KR0A 3MBDA 2Z1BA 4UQEA 4F0RA 3OJGA 4EK7A 4PCPA 3CT7A 4JTUA 4MNJA 3GXTA 3NZGA 5C54A 1JYWA 1MZHA 1K9TA 1QCWA 2CLMA 4UTTA 4P8VA 5D02A 1TWDA 3HQ1A 4UXDA 4GX8A 2G4JA 3SBFA 2JE8A 1IIHA 3HG4A 4Q8QA 1TV5A 4AY8A 3ZVHA 1Z8AA 5EBUA 1E1FA 1QOPA 1V3JA 3HOJA 2A85A 1XGEA 1K3UA 5HNUA 2WBKA 3DZ1A 3EKLA 3NQGA 3PBGA 5DRCA 3TYEA 4JIHA 1TA3B 4GG9A 5F4SA 4PGLA 3EB3A 4XO7A 3WDRA 4BZYA 1C7TA 4XWUA 4NNBA 4ROPA 3DGRA 1AQMA 3M0JA 3H6OA 1AOPA 3G0UA 3ZR6A 2GGHA 1L9WA 2GSHA 4O11A 1VCVA 3BLPX 4YLWA 5FAJA 3WK1A 2QCDB 3MM5A 4PE8A 3KBSA 4JN8A 2VRQA 3M0LA 3ARUA 3A3WA 1JEZA 2XIQA 3GAKA 1W3IA 2J4GA 3CQIA 4L7ZA 1IIGA 1DXIA 4YN5A 2V5BA 4Y7EA 2PP3A 1ESWA 4A3RA 4LCRA 1B9ZA 1LOQA 1Q6LA 4FNUA 3HMCA 2PI6A 2X1IA 2WK2A 1OGSA 1EGVA 3V0TA 5JIWA 2XH2A 2RAGA 2VWTA 1J11A 3FGCA 1BAGA 4KW2A 1LT7A 3MM6B 4R27A 1V51A 3VD7A 1H62A 1UZDA 3N6JA 5CZ0A 4XAZA 3XIMA 1DWJM 3UPWA 3H2EA 4RDVA 3SCWA 5E0FA 1YMYA 3ARTA 3CEUA 3ATZA 3AS1A 3M44A 1ME8A 3TW9A 2EPOA 3P14A 1UWUA 1UQZA 3CL8A 5BRPA 5K4XA 4ZO6A 4IFKB 3NO1A 2Y1HA 1MXGA 3MKKA 2F6UA 3WLRA 4D9PA 4L80A 3N6QA 3IVSA 3W1RA 3ZT5A 2ACUA 4CEXC 5FA5A 3WQWA 1LTDA 2FZNA 3FSUA 4DY1A 1JDFA 2FTWA 4MZYA 2VX5A 4WY0F 3NL2A 1GK8A 3B9OA 3L2LA 4HYRA 4ZL1A 3KL0A 2X2GA 4UTIA 1T0OA 2F2HA 5DELA 4UNKA 5TD4A 1KGUA 1HVXA 1JUBA 1JZ6A 3DAQA 3LI0A 2GFTA 2YXGA 3C4UA 2PA6A 2ZFAA 1OEPA 3NSNA 1A0EA 3O1NA 1TQJA 5IM51 1PEZA 1QI4A 1EXBA 4TOQA 5ECVA 4IM4A 3T0DA 3CAVA 5AOPA 1FFQA 4W8LA 2PD5A 1MW0A 2QUMA 2OEJA 3G3MA 3ZVIA 4GK8A 1KQYA 4LH8A 1O60A 4DYEA 1LL6A 4G1KA 4GUHA 3QQWA 4PCSA 5CPLA 2VP8A 3T9PA 3S9YA 4NAEB 4G1NA 1UD3A 3QW3A 3W85A 2NQ9A 5LIYX 4UZSA 1SPQA 2G96A 1U33A 1NJJA 1P0BA 3PTKA 2G4FA 4GH1A 2R82A 4FSAA 1JI1A 4O53A 2WMJA 3B0PA 4ZB5A 4URIA 3WLQA 4H8HA 4DLMA 4J9JA 4ZR8A 4JXCA 4RXFA 1VCGA 1FWDC 3S2MA 3KOZA 2BXZA 1SSDA 4CCZA 1OX4B 2AAAA 1DQXA 4K39A 3M9YA 4IL2A 4IH3A 1J0YA 3S1WA 3CUGA 1UA7A 2CBUA 3L9CA 5A8OA 3CYVA 4PMRA 2E09A 2OODA 3QV6A 4GVHA 3P80A 3W22A 4MWAE 3MZ2A 3H12A 2YFNA 2IKJA 1PIFA 1UWIA 4ADUA 3BSMA 4IMDA 3BMXA 5CKSA 4AFYA 4LAZA 3R8GA 3V0UA 5G1MA 1VRXA 1VPQA 3QJAA 1SJCA 4AX7A 1KTNA 4GABA 1KM2A 4GVFA 4F0LA 4UCGA 1YEYA 3SURA 5HQMA 5CSRA 3XISA 3IK2A 2WSYA 1EQPA 2PRLA 4Z2LA 4CU6A 3A6OA 3E96A 2ZWZA 1T40A 2WSRA 3TYCA 2C3ZA 3R13A 3QW4B 1FRBA 2JF6A 4A8NA 3GU1A 2HE5A 3NFUA 4GZEA 4Z1CA 1JUKA 4NY2A 3MWAA 3W38A 7TAAA 5JVLA 5LNVA 3I10A 5AOUA 3WEOA 4JFSA 1K8CA 3DDMA 1RXOB 3BPWA 3KHJA 3EDEA 1EH9A 3SCVA 4GUFA 3W7RA 1R3VA 3N9RA 3SGZA 3LMZA 3H4WA 4PH6A 3D5HA 3LSBA 4BQ3A 1ME9A 1VJIA 3DESA 3U4AA 3P3BA 1MVYA 2WM1A 3G1XA 1WKDA 5B7YA 1UMLA 3OLGA 3DFYA 3LHUA 2A7PA 3SM0A 4PFMA 2GDUA 3UWUA 1HO4A 3DKJA 2OLSA 4NUWA 3VOCA 4FALA 1W3TA 4KRTA 1ZBCA 4E2DA 3MUCA 4F3HA 2WKLA 3WMCA 4JTAA 2VEPA 5DLCA 2OZ3A 2OZ0A 3CB8A 5IOBA 3CZKA 3TJXA 4CVWA 4IHCA 3W76A 2R1KA 4N9CA 4DF0A 2W79A 1J12A 3Q4DA 3NZRA 2DVTA 3FJ4A 1EX5A 2VD8A 1UD2A 2E25A 3TV8A 2FH8A 2JEQA 4PC8A 4AIBA 2A6LA 3G1SA 1OYBA 1POJA 1W9XA 2HNEA 3KS6A 3B9AA 3KBMA 5H2ZA 2WHJA 1BVNP 1CYGA 3CZEA 1IT7A 3IJDA 1MUWA 4HN4A 3PJTA 1QNRA 4HD5A 3CTLA 1M41A 3HA1A 3MHGA 1GHRA 2OLAA 1T41A 3W82A 2MNRA 1O1HA 1IQ8A 1JF5A 4CUCA 2WV8A 4R9XA 3LRKA 1J8VA 1ZALA 5EYWA 2DVUA 4PUMA 3MKVA 1XSIA 2J9YA 2RJGA 2VDGA 1LBFA 3DI1A 4YVVA 1AA1B 2JK2A 4B4HA 4Q8TA 3S1VA 3KRUA 2OVLA 1TPWA 4LX4A 1EDQA 3G1VA 4IMFA 2ZVRA 4UNLA 1KRMA 3FYYA 2QDGA 3L2MA 5EY5A 5MKGB 1F3TA 2FZ8A 4XISA 4JTLA 1JYVA 2ABAA 4CEUC 3QMRA 2NWSA 2DSVA 4R7JA 3NAVA 2BHZA 3EXRA 4P8WA 3WNKA 1T99A 2QJJA 1F8IA 1TPH1 3MBFA 1UROA 2QW5A 3N14A 2E3ZA 4O1BA 1OINA 2Y61A 1HN1A 5BRQA 2OX4A 4NQ1A 7CGTA 2J66A 5FACA 1W9BM 3KRBA 3WJSA 2A1YA 3TVAA 4WEVX 3MUY1 3WUGA 1RLDA 1GTHA 3MHUA 3T42A 3RNDA 1XF0A 5H1WA 1QPKA 4PEKA 5CBBA 4DXVA 2D0FA 2NLYA 3ZS4A 4YVXA 1JCXA 5DRIA 4LGXA 3KOYA 2FDMA 2GUBA 1Y5VA 1NELA 3AIQA 1W9DM 1WCGA 1UKQA 3TN4A 1JXJA 4JQ4A 3OGVA 2VEFA 2WWDA 4FOJA 2O9TA 3B8SA 3BGJA 4WXZA 3B0JA 1H50A 3L65A 3TAKA 4ENLA 1JYNA 1OG6A 4W93A 1GONA 2JKAA 4GO8A 1TCDA 1KW1A 1THFD 1EO5A 2X1RA 4Z2KA 1O5QA 1UP0A 5FIPA 4RPQA 4HZMA 1NM9A 2DW7A 2NZLA 3YPIA 1VYSX 3C2EA 2V5CA 3ZIZA 4GXMA 1W2PA 2GVEA 4QNEA 3MCOA 2PDXA 4GRSA 4P61A 2Z1SA 3BV7A 1QO5A 1DHKA 5DO8A 1ZS2A 1UUOA 1YRRA 1ONWA 1LZOA 1TFVA 1VJZA 2I7GA 3GC4A 5CPMA 1A5OC 1L6FA 1RVKA 1E9IA 1S3TC 2V2CA 2KX9A 1O5RA 2WSKA 1OD0A 4MM1A 4RKAA 2Z6JA 3A3HA 3N29A 4NP7A 4YYCA 1VJSA 3R5EA 4XKYA 1HP5A 3FLUA 4F8XA 4K36A 1JDAA 3AROA 1ZJBA 1Z7AA 2YKKA 2OFJA 2E5BA 1YPXA 4TO8A 2VEIA 4HPNA 2DY3A 1G7VA 4UMBA 1CLVA 1JCYA 2GQ3A 4MKSA 2BB0A 4HOZA 4HN8A 2VC6A 2D3LA 1N8IA 2QUUA 3VE7A 3NL3A 4A3HA 1QI5A 1XLAA 3JVAA 2XN1A 4XBJA 3DFNA 2PLMA 1FWAC 4U4MA 3N04A 1A0DA 1XQLA 1TIWA 1EDTA 1VD6A 5AC7A 2I5IA 3VKSA 3OG2A 2ZYFA 4N9DA 1GOWA 2QIWA 4AYGA 1XLMA 3URNA 2CXEA 5A6SA 2PWUA 1F6YA 3MTWA 1LQ2A 3KCLA 1FVPA 1PAMA 3MVIA 4P7OA 3IRDA 4XB3A 2GUYA 4ZO7A 1KQZA 1TIMA 4HK5A 1Q6OA 3IV3A 2P0OA 1Q8AA 3ANVA 2J77A 1B4KA 1SSGA 2C1HA 3MP5A 3UNTA 2OKOA 4K8EA 3AJ7A 3WMLA 4D1IA 3RCNA 1RD6A 1DIDA 2GOKA 1V02A 4L5ZA 3T0AA 3W7HA 1XRVA 4ZXLA 3KAOA 1Q85A 2Y8VA 5DN1A 2CXGA 3ZJKA 1E73M 3L0KA 1HTIA 5TF0A 2ZC1A 2Z25A 3EDJA 1EF2A 3GS6A 1MRAA 1TPEA 2GVJA 5D33A 5U7SA 4JTEA 3CV7A 9XIMA 1SFJA 3WLLA 2BX7A 2OLHA 2I56A 3HU7A 1G94A 1PZ0A 4GMEA 4L4PA 2VZSA 4IUOA 2VC5A 4US5D 3TN5A 1IXOA 3WNOA 3DC0A 5KTLA 5HJLA 4AZ6A 2V69A 5KZEA 1OX5A 2PDFA 3E0VA 2FPVA 1NFBA 3BTNA 3HF3A 3C2VA 3NVTA 4EWND 4S38A 4F0MA 1WXZA 3TWBA 2X16A 3AU6A 1ZB5A 1IV8A 3VK5A 3TLQA 6A3HA 1U30A 5LIWX 3VILA 4U28A 4CCDA 2J79A 4LYRA 4P7NA 4WKAA 2ZUNA 4LAKA 3MC5A 3UR2A 4YTUA 2V4JA 2QJNA 3QV7A 2F84A 1VBGA 3CIVA 5CBJA 1XCXA 4F0KA 1F9CA 3CNYA 3AALA 3Q58A 4AWUA 3K8MA 1X38A 3WDHA 2XPKA 5EB8A 1QNQA 3UYIA 3VO0A 5HMEA 3DENA 1U2YA 5C5YA 1R2RA 3NGFA 3B9NA 3H21A 3MUZ1 1EB3A 3OIXA 3MJMA 3ANUA 2YA1A 3AMDA 2XM1A 3KP0A 3NO5A 5AYXA 4BI7A 3O07A 1BHGA 1KGWA 4Q4QA 3SCPA 1FDYA 1S5WA 1XW8A 5BXRA 3CZLA 3BAJA 1J5SA 4O8AA 1V79A 2ZDSA 3WF3A 1KRCC 1MNSA 5DCDA 3EWZA 4M81A 2FTPA 3FDKA 2D2JA 1DORA 3BANA 1U1HA 2WJDA 1H1NA 3N4EA 1UR9A 5HR6A 2GJXB 5FJUA 1UW9A 1Y0EA 4L6HA 1J10A 1VFTA 3O0FA 3MP4A 1PWMA 2P88A 4IPIA 5HAOA 1CZ1A 4YHEA 5LXEA 3TFXA 3NJ3A 2OO6A 2QJIA 2EPLX 4O14A 4TV6A 2WVVA 4PTMA 2PFHA 5KZ6A 3TZNA 5JBDA 1EPXA 4AHPA 5K9DA 3F2BA 1BXCA 5K2ZA 1P5BA 3H24A 4US5A 3V75A 3B0LA 1NWRA 2E40A 3LTSA 3CGTA 1PX4A 1KM0A 2PS2A 2CW6A 4Z1AA 1XIHA 1YQ2A 4RE2A 5PTDA 4MMWA 3WK3A 4C5ZA 2EG6A 4HNLA 4JIIX 4Y8EA 2VEMA 3AYSA 5AB3A 3DC8A 1NFPA 1V7YA 4DJDC 3SECA 5BMXA 4L9YA 1GKRA 1FTXA 3BH4A 4EXBA 3MSYA 1RSCA 1AG1O 2I5GA 4CNOA 3DIPA 1QBAA 3A22A 4W87A 4WCJA 2CKSA 2HXTA 4X0NA 1WP6A 3CWOX 4C91A 1GVFA 3UJSA 1N82A 2HTMA 5F4WA 3MUXA 3OP2A 2E77A 3LMYA 3VLXA 4QS5A 3BLEA 4PRRA 1AUSL 2OU4A 5HUPA 3STGA 5IBXC 3MUAA 4N9EA 1J0HA 4A8RA 4GX9A 3CUXA 4DWSC 3QBUA 2OEKA 4JY8A 3WLPA 1C91A 3JZEA 1BSIA 3BSHA 4XUGA 4U2YA 5AVNA 1ML1A 3H53A 3AJXA 2BP1A 2H3BA 4MY9A 2Z28A 4DO5A 1CDGA 3CJPA 5D8WA 4GEPA 3LRLA 3ZLHA 3TMLA 4KWSA 1R87A 1WUEA 3M0MA 1ISZA 3I4EA 3T8QA 3LHTA 1CWYA 4LXFA 3UWEA 2V82A 2VHLA 1SZRA 1NWUA 1ME7A 5FF3A 1KM4A 2B4GA 1XC6A 1GKQA 2TMDA 1Q7QA 3BCDA 4CU7A 1RY0A 3IJIA 1FHLA 2RDTA 3V1HA 3S5SA 1ALDA 4IIEA 3SFWA 4S3AA 1QW8A 3MCNA 2GPTA 5A2AA 1BF6A 1GOXA 4MB3A 1C8YA 3VI2A 3WBAA 4BF9A 1HUVA 3WYZA 2QCFA 1Z42A 5HANA 3ZR4A 1W0MA 3RPDA 5CPSA 5AHNA 3A4WA 4HK7A 3C3NA 3WLOA 3UJRA 1Z44A 2E5DA 3N2OA 1KFJA 3ABXA 3FVMA 1XLGA 3LLXA 4R85A 1Q2RA 3Q65A 3I4KA 4KEMA 4GQBA 4WOZA 2D20A 3T4WA 4MDPA 3KW3A 4LYKA 2FVMA 4GJJA 1F6PA 4JFVA 2WPGA 2PSNA 1DJYA 2WZIA 5DT7A 3WNLA 1KCZA 4LV9A 1VFHA 4BEQA 4A4AA 1K9EA 1XUUA 1PZ2A 4QROA 3S47A 4YS1A 1SFSA 1PPIA 1I9CB 1TPVA 3GR7A 4R5EA 4AW7A 4LQ1A 3PZMA 1YX1A 5A6BD 3LCGA 3QV9A 1Q6QA 3FKRA 4I6VA 4UIOA 2ZUTA 3UU0A 2KZHA 3EEGA 2BY2A 1VYRA 3G77A 2HISA 4LVDA 4F2TA 1Q5MA 4A2SA 1DYSA 3POCA 4GIYA 2EPNA 3PP7A 2NQZA 1F3XA 5LA1A 3WQPA 1L2QA 3RCYA 1KBJA 2P3EA 1IE7C 1B9BA 2A21A 2Z4GA 4JQ1A 2DGAA 1ZENA 3ZVHB 3UNDA 1VBHA 4JHMA 4H00A 5CXPA 3LHZA 3CC1A 3N3MA 4RNJA 3H4XA 4AYSA 3K4DA 2RFGA 5D38A 2BFGA 2QMKA 4I7VA 1AQHA 4A05A 1JPDX 2J7CA 1S39A 3BVJA 4G2DA 3UBPC 4GNVA 4UNIA 3MSDA 2VR5A 1EC9A 2OSWA 3CUZA 5FF2A 4AD4A 1Z3NA 4NAFA 4CVUA 3EPNA 3RG6A 1E1EA 3QFEA 1YHTA 5A8NA 3CPRA 1LG1A 3S9ZA 2V5LA 4CD7A 1VC4A 2R91A 6CGTA 2E7FA 4FLSA 4E3TA 3VM0A 1CXEA 2QF7A 1T7LA 3MM5B 4RUBA 3TR9A 3BOLA 1NF0A 3KHDA 5KITA 3UG4A 2WCAA 4OBSA 2V30A 2EJ1A 4PMDA 4HCHA 1A5BA 1DOSA 1ZAJA 4K8HA 4I5RA 1XCFA 4RX0A 4X3ZA 2ZRWA 1NF7A 4CCCA 4ZTYA 4L65A 5FAGA 3CBWA 3DFTA 4AD5A 3FGCB 3L4XA 4KKXA 1QXLA 3L4WA 3WEMA 5D9NA 2C0AA 4LS2A 1TVPA 5A6BA 1G1YA 5CSUA 2XFYA 1V0KA 4LYQA 4P5UA 4B15A 4HNCA 2D2HA 4LS1A 1KLZA 3K8KA 1RA5A 2PDIA 4NZCA 3ZWTA 3FHQA 2V5KA 3PZQA 3E0FA 3WH6A 2PWDA 3WF2A 3GR8A 2FKPA 4OUIA 3FIGA 2XSJA 2VMFA 2VO5A 3PWIA 2IPFA 1DWFM 3MYOA 1R7AA 2WZTA 1UH2A 4PSPA 4YTTA 2AQOA 3AHVA 4XO6A 3BO9A 3GKFA 3W7DA 3N1AA 2FQIA 4LVFA 4LWWA 2JQXA 4L1WA 3CWHA 2F61A 3GZ3A 1GOQA 3WDJA 3QLLA 2WSQA 4DNHA 3O3RA 2O7SA 2Z1KA 2XIMA 4B5UA 3WF0A 1UKOA 3LCHA 3ME3A 1RALA 2O56A 4W7WA 1ZJIA 3URQA 1JULA 4AY1A 2G5WA 5HUOA 2OSYA 4CU8A 3CK5A 3E0WA 1ZLPA 5T26A 5M5DA 5M3WA 1HIZA 1S2CA 1H41A 1K9FA 4Z2IA 3D6NA 4IGMA 3B0VC 3DFPA 1RBAA 1H7WA 4S2CA 1ZJAA 2NQJA 3WCZA 3VMPA 3OBAA 1CGVA 3FYOA 3IRSA 3H2NA 5CC5A 5D09A 4FIRA 3EA1A 2OWXA 2CLFA 3QGAC 3GC2A 5K9CA 3G0SA 1G5AA 2GJLA 5F1UA 4XAYA 2X8RA 5JBFA 5FEZA 4B4FA 3KVKA 5G2IA 4AX6A 6XIMA 4CNNA 2Y89A 3TTOA 4WDWA 3VDCA 2ODOA 2Z27A 1J0JA 4TTUA 3W23A 4WIWA 3L5MA 3C61A 1L6YA 4E5TA 3BLLA 3PM6A 2FVKA 4A2RA 4Z17A 2XSBA 2V67A 1JD7A 2X09A 3BG3A 4FNSA 4DYKA 1W32A 3SUSA 3LNMA 3LGGA 3IJQA 2ZUVA 2FPYA 1US0A 4PN2A 5HQEA 3VIOA 4D6CA 1S5MA 4N42A 1UIOA 3TTSA 3UPMA 4W85A 4L1XA 2BS9A 2Z2UA 3M0ZA 4JTHA 2VX6A 1UD4A 1R2TA 1LF1A 1UH4A 4GJ1A 4BK9A 3VNDA 3M43A 2BSLA 1SW0A 4AD3A 5DY2A 2YDRA 5AY7A 4YWSA 1R3RA 1I8JA 3D0CA 4WSKA 1Q6DA 2J7GA 3SGUA 1PKNA 3W1TA 3BLDA 3K13A 2QUVA 4ZQCA 3ICJA 5HWNA 2FMOA 3TSMA 4H41A 3E74A 2PP0A 3BW2A 4GPNA 1GHSA 2YDAA 3ITOA 1G69A 1AJ0A 3L4UA 3WEZA 4UQAA 2Y4SA 3BG9A 3D47A 1QPQA 2I1OA 2WJZA 1J79A 2VRJA 4HSOA 4LJ3A 3UVAA 5I77A 4O1DA 1K6WA 5FL0A 1R3SA 4OOUA 3VOGA 1UR0A 3W2NA 4UFHA 3DXIA 1ZP4A 1TTIA 3CH0A 3TYAA 4O28A 1RCXB 3HN3A 4UQ9A 2Y24A 1NP0A 2YXXA 5A1AA 3EWCA 3QKZA 1EC7A 1W5QA 3WD3A 1TWSA 3W70A 2LLEA 1ZZMA 3SIMA 2AKJA 1HKJA 2GEPA 5CGTA 1WZAA 5DBTA 2X1TA 4KEUA 1UP2A 2BASA 2GVLA 1XINA 4LBRA 1YE4A 4HZ7A 3A5FA 1CB7B 5F7UA 1DXEA 4KRUA 2DH2A 3GVVA 1EJSC 1FXQA 1ICPA 2E9BA 1PDZA 4AVFA 3MI6A 2XFRA 1M53A 1HKMA 4C1KA 1V6VA 3W6YA 1WNOA 3ZJ6A 3UD6A 4Z08A 3QVQA 2PTWA 2V2DA 3PZ9A 3DHFA 4IP5A 2UWFA 5M17A 4HZ6A 4D6EA 5D04C 3EXTA 3L4TA 4N4QA 4J3SA 1UKSA 3OB8A 3NTYA 3BARA 2WKGA 4EXAA 3P62A 2Q8LA 3CZJA 1PWLA 4HHPA 2NX9A 4I7UA 2XU2A 2BVTA 5K4ZA 3WBEA 5C0QA 5E0CA 3A9BA 1MUMA 3VE9A 1BYAA 3NXLA 2HEJA 2OB3A 3T44A 1R38A 2VZOA 1QU4A 4I9TA 3ATYA 3LPPA 2PRHA 3UJ2A 2ZICA 5FJOA 2V68A 1D9EA 1W54A 2QF8A 2E9LA 5JUVA 4JEQA 4QDMA 9CGTA 1HX0A 2G3JA 5IRPA 1HL9A 1U1UA 5I09A 5J5DA 1KM6A 4XUYA 1WAWA 3RILA 3A9IA 3AWOA 2WLYA 1W8GA 1E4MM 2Z2BA 2XFFA 4Q4OA 2VGFA 4JHZA 8RUCA 4N9BA 2V0TA 3N3TA 4Q4KA 1OADA 3PUDA 1CGXA 2YBUA 2ZTJA 4GYFA 4LC8A 4IL0A 4H8NA 1XQKA 3IK4A 2VZUA 3QZ6A 1GW1A 4AQLA 3IIXA 4ADTA 1JZ3A 1MDLA 1IWBA 4JFUA 1XI3A 2W9MA 5CC7A 4FK9A 3GBEA 4IQDA 3OTRA 1YNYA 3UWQA 1OG0A 1R9YA 3RX2A 3TU9A 3KL3A 3OYXA 5G5IA 2YCKX 1KFEA 5LIKX 3E49A 1B3OA 2A79A 1FDZA 2ZA1A 1E6PA 2QMJA 5FJTA 2GJRA 3W4RA 1TUFA 2WWCA 4KRZA 4KS0A 4UFMA 4KCVA 3VAVA 3W7CA 4DO6A 1E9YB 3LQLA 3FSTA 4RLIA 4H7CA 4QITA 4ZQOA 2WHKA 1YDNA 2C8NA 4UWMA 1EUAA 3MMAA 1JCTA 1Q6FA 3MPGA 4QJ5B 4ZCWA 4CN6A 2QCLA 3ZQ9A 2Y7DA 3HPSA 3TNBA 4NZ1A 1BGGA 2J8GA 4JX5A 3P6LA 5D32A 3VDHA 1L0PA 3AO0A 3PVFA 2GVYA 3SUUA 2PLJA 3TE9A 2ZOXA 2OT1A 1BQGA 3WQ6A 2F2KA 3QMTA 4OZOA 5LGXA 1PB0A 3UP8A 2V2HA 4XD3A 3LRMA 4NRSA 2AKMA 1TTJA 3N12A 1XBXA 1KO0A 1TPDA 4QP0A 2WJFA 3MY9A 1R0MA 3SCSA 4UTWC 4RE0A 3UT0A 2DW6A 3AXKA 2X05A 4IPPA 4BHYA 3QY6A 3NQFA 4W84A 3RCMA 2PF8A 1UWRA 1CW2A 1P0KA 1CT5A 3E2SA 2Y6ZA 4FP1A 3H2OA 4XKYB 4ATLA 4B9ZA 3HGSA 3PZIA 2PLCA 2QHAA 4W88A 4BKNA 5CGMA 1EBHA 4J3UA 4DHGA 2WC4A 1US2A 1TPUA 5J8LA 1LWJA 2F7FA 4KWOA 3BMWA 1JRBA 4X2PA 1TJ0A 1FHDA 5I3KA 2F38A 4GKTA 1YPFA 3VGDA 4J1OA 3NM1A 1GVEA 3O16A 1P0NA 3PUEA 3CT2A 1XG4A 2DJXA 2DIJA 4C6QA 1CX9A 2ZE3A 2XTKA 4WDTA 2DV0A 2YX0A 1M03A 3UA4A 3GQYA 4QAWA 5IFTA 3K1GA 4X61A 3UGVA 4FF7A 5T9CE 2MUCA 3VVGA 1UA3A 1M68A 1QASA 3VGGA 3SADA 3P81A 2BWGA 2VCBA 1NEYA 3TW6A 4Q8WA 4KPLA 5T91A 2VUYA 5KETA 2R14A 1FCBA 3IVUA 2GDVA 3WD4A 3WF1A 2QLYA 1M5WA 4XAPA 5D2WA 2EO7A 2CBIA 3W86A 1XIMA 4E0CA 2YW3A 3UESA 4NRRA 4S1FA 5KZDA 3W88A 1V6YA 4GNJA 1O95A 3OW1A 2VNCA 3FYPA 4IG2A 4PUDA 2VX4A 4IGHA 4E2BA 3GZAA 4OU1A 3EA3A 4A21A 3NUKA 4K68A 2DZTA 1QHPA 2EF9A 7ODCA 2GJPA 3M1ZA 2AOSA 2AOPA 4FLQA 3B0NA 3BE7A 5MHBA 4M19A 2KAUC 3QY8A 3CPGA 3EBVA 3CPUA 3MB9A 1XG3A 3B9DA 3N73A 4S3GA 1A50A 1EJ7L 3OVGA 3OVPA 4MADA 2FZDA 2YBTA 2P53A 2G95A 4NYUA 3VGFA 3VIPA 4LSBA 2XJ7A 2DH3A 1C7SA 2J25A 1RK5A 4JTDA 2YCEA 1NAL1 3VKJA 2Z7KA 5XIAA 2JKEA 4MJ2A 4HNOA 1WYIA 1IF2A 2HRWA 3STEA 4PMNA 3GG0A 5FF0A 3BJSA 1V3KA 4KCWA 1I60A 3OVRA 3R6IA 5LIXX 1SUXA 1OHLA 4UFKA 4Y90A 3LBOA 1W1VA 1NTHA 5FKYA 2YLLA 5CZSA 2C1GA 3OZMA 3ANYA 5KZMA 2GQ8A 2OWWA 2WNQA 4M1BA 5KINA 4V27A 1VF8A 3FCPA 3P84A 1G4TA 4PRWA 4JX6A 2V4JB 3FEMA 1KXHA 1US3A 2Y0FA 3KLKA 1MFVA 4AUBA 1O5XA 2WNZA 3I7QA 4R34A 3E3HA 3CO4A 1JAKA 1A3XA 2HVNA 4UTFA 3W2UA 2PTYA 1PYMA 2C16A 3SI9A 4P8XA 4PTXA 4M3PA 5C6MA 1DJNA 3BDKA 3IJLA 1XS2A 1W2VA 2G41A 1EP1A 3VLZA 4IT1A 1E5JA 4IWWA 2ZCGA 3W01A 1ZJHA 4O15A 2PDMA 3FV9A 3PPHA 2HWGA 2BLEA 4WJXA 3S2NA 2Z0IA 4X63A 2XVLA 2V81A 1ADDA 2CHOA 4Z42C 4EPEC 4BJHA 1TV2A 3VZYA 1LLWA 1BKHA 2VFFA 4Z2JA 2NSOA 1SMDA 3AICA 4F4RA 1VFOA 2A3EA 5HPCA 3E1F1 3N6HA 4GUJA 2WMGA 3HTWA 1GOOA 3IAQA 3T55A 2VURA 2HBXA 5AHLA 1K8ZA 4AZGA 2OTDA 2WVVB 4NL1A 1Q7ZA 3PUGA 2BV9A 3T0CA 3M64A 3F4NA 3F4VA 1E72M 4HNTA 2B7QA 2VR4A 4Q4MA 4RR4A 1CGUA 1WDPA 1TJRA 1TCMA 3SJNA 1IR1A 2EG7A 5K7JA 3P93A 1VHNA 1SQ7A 1VQTA 4JCMA 5FJRA 4D6DA 4LUYA 4W5ZA 1I1XA 4ATDA 1E6QM 3FOKA 4DJFC 1W6TA 2RHGA 1CXIA 1IEIA 3QSTA 4B5WA 1TMHA 2E9MA 3USBA 4WGXA 1B3XA 3W83A 3JW7A 4FX8A 5HINA 1E0VA 3ZSTA 4FX6M 4XZHA 3BC9A 3D3AA 5I07A 4QCEA 4U31A 5HNRA 2NLIA 2BHYA 2D73A 3L4YA 4K3ZA 2CLKA 4H9UA 5AYIA 3IGSA 3BGAA 4Y2WA 4LF2A 3VLYA 3VFLA 4BFAA 4TTGA 5EFFA 1GQKA 4AB4A 4H9YA 4DX3A 3R11A 3C2YA 1RCQA 3PULA 4GC3A 2PGRA 3ELFA 1RBLA 5AHEA 3IUIA 1EZWA 4IICA 4DN1A 2ZC8A 4ATWA 1PDYA 1DIKA 2WMHA 1RPKA 1A5AA 3QRHA 3GIPA 3P5YA 1XICA 2B7PA 2XWDA 1RK6A 4JNZA 2F6KA 1ELSA 3ITCA 3G1FA 4WZHA 5TNVA 1Q6EA 4GC4A 3C3UA 2V6AA 5REQA 4MPQA 3TCEA 3GH7A 3E5PA 1PV8A 1A47A 1P43A 3NG3A 1YDYA 4JEJA 3TC7A 5D2XA 4AWEA 1W1YA 1TJPA 3WQCA 2YLAA 4LVBA 2A6NA 4XZIA 3HG2A 2VFGA 5MF5A 3NQCA 4YXGA 1TMLA 3RAOA 1SR0A 5I03A 3QXBA 3B8WA 1E0TA 2NV9A 4TVCA 1TZZA 2XSXA 1TG7A 3GXMA 5XINA 4JIEA 2PODA 1MXSA 3U2EA 4XZWA 1K1DA 1PIIA 4LEQA 1LDCA 3LBCA 2A3HA 3PNZA 1QWGA 1M6JA 3HFYA 2CNCA 4AVOA 4DI9A 1GJWA 3B40A 3URAA 3MYPA 2A3LA 1SZGA 3M5XA 4ORIA 2P1FA 3N4AA 3ID7A 2ACRA 1R86A 1XM3A 1YTKA 4XZBA 1TZ7A 3PHAA 4MUZA 4FX7A 1RP9A 3A13A 1KBKA 1UWAA 1F05A 4LU0A 3TJ4A 3GNPA 2OZ8A 1YBQA 3SO7A 2IQDA 4EWJA 4L4OA 3EDFA 1IEQA 4RDYA 3E38A 4IPJA 3AMKA 4C6LA 1B4EA 4GI9A 1TZ9A 1TYGA 2OSXA 1FP8A 3FS2A 3KRZA 4NNCA 1PKMA 3QR3A 3AIRA 1KWGA 4IIHA 4B92A 4YVPA 1QTWA 1V08A 2QVHA 3LA4A 2R24A 4IJBA 3GXFA 3TA6A 1QBBA 3BXWA 1G4PA 3R0DA 4DJDD 1KKOA 4K7YA 2J27A 4G39A 1GG1A 1Q6GA 3GRIA 1DJZA 1E6RA 3W1LA 3WD0A 3DYMA 3TQKA 3NPXA 2PGFA 4CD8A 3NO3A 1B1YA 1YXYA 2BVDA 2ATMA 4Y9NA 4ZE4A 3VX1A 3LCFA 5EMJA 1IHIA 1VENA 4DO4A 1TREA 1VEPA 3LCWA 1OT2A 1SO6A 1A4MA 1H3GA 3W27A 4F2UA 2Q71A 5C9RA 4D6HA 4DWSD 1EBGA 3RXZA 1OYCA 2J75A 1KFCA 4WOQA 4H01A 4MF4A 1XYMA 4UFLA 1OGGA 4DYJA 4L1GA 1J6PA 1FHVA 4JKMA 3ONBA 4I3GA 1OC7A 3DYOA 5AYBA 4H9VA 3IJ9A 4TVUA 1IZJA 3Q2DA 3CQKA 4XD4A 4RDWA 1E1CA 1A4LA 3MWCA 1TKKA 2ZZ1A 1ZAHA 3NURA 4TIMA 1B57A 4WK9A 1AD1A 1EIBA 1FA2A 1XUZA 3A4AA 5HXMA 3GVRA 3TONA 3NSMA 2PTXA 3LPOA 4AEEA 1S5VA 5CPTA 4NAFB 3BAIA 4S3DA 1X97A 4C1LA 1E0WA 3NDOA 1JFXA 3W28A 1UWTA 1JUEA 1FH7A 4NZ5A 3THCA 4C6CA 2WJEA 3RHGA 3PG9A 1XSJA 4AEFA 3BL3A 1ITQA 2NT0A 3U9IA 2QAPA 3AS2A 3M5VA 5T8GA 1YXDA 3EPMA 3ONCA 3UZYA 1LRTA 1CXHA 8A3HA 3B8UA 1OC5A 1E5NA 1QK0A 1H1YA 1AJ2A 3BGGA 1XYFA 2CPUA 1ONXA 4L9ZA 2ZUMA 4DJDA 1WXJA 1C8QA 4AZCA 3M5YA 3MU7A 4IJRA 3NYZA 5G1TA 1XH0A 3TJIA 1JF6A 4WJ8A 3IJ8A 1LRQA 5CJNA 2ZXBA 4JQ2A 3BMVA 1UHVA 3NQ2A 1W9VA 1JDDA 2OKTA 2V3GA 1HXJA 3W74A 5C9ZA 3EEZA 3TYDA 1LCOA 3DFSA 1S2WA 1U5HA 4B5SA 4I9AA 3EWYA 1CECA 1V3LA 1H63A 3MANA 1CEOA 1C9WA 1XJBA 4GVGA 1LG2A 3VIHA 2FGBA 3GU9A 2O4QA 1SZNA 5IBXA 2VXNA 3MMCA 3HV8A 4NI8A 5EMKA 4C6DA 1KNWA 1R30A 4DWSA 3WFAA 2PURA 2QZRA 3A21A 4L4MA 3WLKX 2XSJB 1ICSA 1XBZA 3LHYA 1OVDA 3VIGA 4FNPA 4AIOA 2ZX7A 3BLFA 4GIRA 2GUUA 2YCIX 2IPWA 1UBPC 4Z0JA 2A2IA 2VQUA 2FPTA 2X30A 4MWAC 4ZSUA 1ITUA 3MV01 2GLKA 3S5YA 5H8PA 3COTA 3AWNA 1XLIA 2EXOA 3H7RA 1PHQA 3E5BA 4L6DA 1UH3A 2QV5A 1R3YA 2FH6A 3NQVA 4DBEA 5BCAA 2ZRVA 1QI0A 1J5TA 4DPQA 2B7NA 3VMNA 5FL1A 2CZVA 3HG5A 4H6EA 2DSUA 5G4HC 2VOMA 4UCFA 4IX2A 3SCUA 1W31A 5ABFA 4IIBA 3MMBA 4QR6A 3SW6A 1WX0A 4UFJA 9XIAA 4O0KA 3B4YA 3B9EA 1JZ4A 1MMFA 1BEUA 3B03A 1SO3A 1OQFA 4O57A 5HBFA 4ERIA 3D3FA 5I78A 1L6GA 2DT1A 4IOTA 2NSXA 4Y9OA 4KQNA 5ENLA 2X0HA 3WJWA 2AKZA 1P1MA 4UOQA 1OYAA 3PSVA 2VI0A 3L5LA 1KFBA 3T09A 2YIHA 3OQEA 4I5UA 4HTBA 1X7IA 1TQXA 4MLRA 3I6RA 3ERPA 1WKYA 3ITGA 2TSYA 3BUVA 3WK2A 1ONEA 1GJPA 3OLIA 1O12A 4IF2A 5H8MA 2R8WA 4HMNA 4QNWA 3HZ3A 3JS3A 3TTEA 4J3XA 5DXYA 2WQPA 2EBNA 3GNRA 3FNDA 3WMBA 3CASA 2ZZ5A 4W89A 5CAKA 3AZTA 1HG3A 4ZXOA 4YTRA 3G0XA 3TN3A 2WOQA 1DWIM 1GUVA 5I3GA 1D8CA 3QHOA 1M7XA 3FAXA 4GGBA 3R8HA 3E9AA 3PBWA 4GWEA 2PDYA 4AZIA 2EKCA 2O4MA 2VFIA 3GBDA 2C14A 1ZSXA 3WLNA 3RF9A 3FEQA 2JKPA 4INFA 3ARWA 2G3IA 1VIWA 1ZCCA 3R7MA 2XVGA 3TROA 1TJ1A 1J9YA 4LBUA 4BI5A 3WX7A 2NVAA 4C7GA 4RZ4A 1L8NA 1PSCA 4QE4A 3DHUA 3NQMA 3DFOA 3T2PA 3LPGA 4MKVA 4BF7A 4HMEA 2QS8A 5EMLA 3TYBA 1V93A 4OV9A 4OBTA 7GEPA 1NOUA 1JZ8A 4TVDA 3NQ7A 4A3QA 3QMSA 1K03A 3EOOA 3WH8A 2C13A 3BURA 3PAJA 1PCKA 1BWKA 1JVNA 4RV8A 2PDCA 1PBGA 5A5WA 5CG0A 2JBMA 3WH5A 4G9PA 4B5TA 1TVNA 4CKQA 1EJRC 7XIMA 3HV9A 1EA0A 3GNOA 3L2IA 4WUIA 4FR1A 3WUEA 3ABRA 4MJZA 3I68A 3SRHA 3VM5A 1PTAA 2DEPA 4LYPA 1W3JA 3L23A 4QS6A 2AMGA 5D30A 4G38A 4CNUA 3HQPA 3WLSA 4RK8A 1VHCA 2R9RA 5EGRA 2DZPA 2DP3A 3A24A 1HJUA 1WXYA 1SW3A 5I2UA 4H1ZA 1JDEA 2TPSA 1KTCA 4NX5A 4OTKA 5EMUA 3VNZA 4PMZA 4Q8UA 3VKTA 1WKFA 3QEZA 3G5EA 4DRSA 1JI2A 4J3TA 3WBWA 4PBEA 2POTA 2ZRYA 4H8UA 5AHFA 3W00A 2WW5A 1UP3A 3O6YX 4UOZA 5I0DA 2I9UA 3VM7A 3N9KA 1JRCA 3AHYA 4KEVA 1UWSA 1JNDA 3IIPA 1UUMA 3M0IA 3W7QA 1NARA 4GCAA 1PIGA 1JG9A 1XDMA 4MTVA 3U8GA 1CPUA 3BAXA 4RJEA 3R8RA 1V4YA 1YPIA 2P8BA 2W6RA 2AAMA 1IGWA 4C7FA 2ZRZA 1W8SA 4MZ1A 1D3CA 3TXZA 1XFCA 2J9XA 1E4NA 3HGRA 4QIUA 5JU6A 2IUZA 3VC6A 1WV2A 4BWLA 1UR8A 4QG8A 4IMEA 1FP9A 4M6PA 4F66A 5HQLA 1OJXA 5DXXA 2DORA 5CQ1A 2FZBA 1VPXA 1XP3A 1Q4NX 1JPMA 5A2BA 3AHZA 4H2CA 3RJYA 3OO2A 3GFYA 4S3EA 2J24A 2NWRA 4NX0A 4U33A 2VZTA 4GUGA 4EAMA 2WVSA 2FFCA 3VNJA 2HS8A 4D8AA 1VFMA 2QULA 3SSJA 2VGBA 3SN4A 1DXFA 4J35A 4NHVA 4GI6A 1PE1A 1W5NA 2WO5A 4CCEA 4U5IA 7A3HA 4HCLA 1EEXA 1OK4A 3MMAB 1E56A 3GWQA 1RD5A 3MJYA 2WMKA 3GXPA 1EJVC 1J18A 1NDVA 3GHSA 3G6MA 4OQVA 3ABOA 3LQGA 3OYZA 5KEZA 4DI8A 2PDPA 3M7SA 4QTGA 1TTQA 3KOWA 3PB2A 4L6OA 2O92A 3R43A 4WX2A 1HL8A 3GSMA 1RJPA 1I0BA 3NIYA 2FJKA 3K8LA 4IGSA 4Q8PA 4O19A 2UY5A 3ZR5A 3KXQA 4IMCA 3GH4A 4I7WA 2ZX5A 4R88A 1H60A 3BAWA 5K3VA 3KZSA 5C8BB 2IS7A 4IJCA 1VKFA 1QPOA 1E6ZA 1A3HA 1FY6A 3ARVA 1K7XA 3DX5A 1F3WA 2EG8A 3FAWA 5JH2A 1TJ2A 2BMBA 2VEKA 2B31A 4CQAA 3AXHA 4WVXA 3Q37A 5A8GA 4ZSTA 4JZ5A 2I57A 3NEHA 4JQ3A 4HHMA 1JGMA 3ENLA 4D8LA 2VYOA 4K1WA 1V6TA 1PX3A 2PWGA 3QR0A 4U10A 2UY2A 4LNCA 2EPMX 3W71A 2I9EA 1HJWA 3VNKA 3GTIA 1DL3A 3SCTA 1BPLB 4GKLA 3EDKA 3OIHA 3AZRA 4QISA 3TW7A 3SQMA 3NQ8A 4O50A 1SFLA 3VYLA 2NT1A 2NUXA 3UXLA 3LNPA 1IXNA 3SJ3A 1RJQA 4JY9A 5AN7A 4EPKA 1HZYA 1E9LA 2REQA 2NXHA 1D2KA 3TOYA 4DZAA 5I24A 3U6WA 3FFSA 2ANUA 2GOUA 3H22A 4E4FA 1LORA 5SWUA 3S4TA 3N13A 2ASHA 1E71M 2WHLA 2PDBA 1UPMB 1LP6A 4EE9A 1W1TA 4K7VA 4OWGA 3H8AA 2FJUB 1OT1A 5AECA 2E6FA 1BVWA 5CSYA 5D03A 2C79A 2FGLA 3C2OA 2XWEA 4IG2B 1WDRA 4L9XA 5BU9A 4XIAA 1SJAA 3ZFHA 2ZZ6A 2RUSA 5DMLA 3U3HA 4FB7A 2PDNA 2ZX6A 2NX3A 1RA0A 2E8ZA 2Y2WA 1W9PA 2DZBA 4MB5A 1H7NA 2VC7A 5I3DA 1NOWA 2IQ0A 3LX9A 3TQ0A 4IMAA 3NPUA 3UJEA 3FX4A 2ABBA 1XV8A 3VCRA 4LF1A 3UZZA 3AXIA 1PKYA 4X9SA 3P2VA 4GO9A 4LCQA 1TRIA 4HTYA 3AUJA 4JCLA 4QHRA 3W73A 2DIEA 3G1AA 1AVAA 4H3DA 5AC4A 3THQA 3N4FA 4DUXA 1F61A 1EUNA 4RNHA 4FIQA 3H2MA 5FF4A 1RAKA 3F4CA 4L56A 3WDIA 5KMYA 4US6A 3U5UA 4ZZ9A 2Q3RA 2RDUA 2HDJA 2DSZA 3NZ1A 3AUOA 3IIOA 1TX2A 5KSWA 1MQQA 1REQA 4DXKA 4WGHA 2QCGA 1JCNA 3GDBA 3OQ8A 1UD8A 4JKLA 1UR1A 4H9MA 3WL1A 3GG8A 2A5HA 4C6NA 3RM9A 1BKSA 2DIKA 1CLKA 3L4VA 3W1MA 4WR3A 5IHRA 3IAPA 5DFAA 1CGTA 3PR2A 3T08A 3FW6A 1SO5A 3SIZA 3I65A 4GHRA 4MB1A 5BW6A 4FS9A 4GZJA 2HV5A 4OT7A 1DWHM 3UA3A 3VGBA 1E40A 3VZZA 1TWWA 1AFSA 3R4IA 2BODX 4MZ8A 4Q22A 1RV8A 3V18A 2Q3OA 1XLHA 1UIPA 3BZGA 4MJ4A 1H1ZA 3WNNA 2DU2A 2A3CA 4DZIA 1UASA 4GACA 3DN5A 1GNXA 5CLWA 4IMGA 2J78A 4R7WA 3W3OA 4F9DA 2ZA2A 3U7VA 4FAMA 4HPHA 2QKFA 3UVIA 1OCNA 1ZP3A 1W1B1 3O9NA 4I8DA 4PBFA 3NR0A 4HOWA 1E4LA 1YADA 4UC5A 1F07A 4QSFA 2D0GA 4ZQPA 3LCIA 4JOMA 5IDZA 4JKKA 1QFEA 2Q09A 4K8GA 3VKCA 2E5CA 1I1WA 3G1YA 1C92A 1AQ0A 4M8UA 3MP3A 3EKZA 1CXFA 1VP5A 1FWFC 1KBBA 4WKFA 2AGTA 4UTWA 1P1XA 2OELA 1E6XM 1OB0A 5LHFA 1D3HA 2PCEA 3T40A 4AC7C 4G5DA 4FMVA 1SU5A 2J7FA 3CIXA 3QGKC 1MEWA 1FH9A 3AYTA 2R1MA 3OZOA 3M41A 1V0MA 2DZUA 3H70A 3B0GA 5CH9A 1UC4A 5LZLA 5E93A 5BRBA 1RH9A 4OJYA 3WY1A 1MFUA 2OQHA 5LYRA 1OCQA 2XGBA 3GO2A 3SFKA 4PCNA 4D72A 2X0YA 5A2CA 1WUFA 1TB3A 2VM8A 3N9SA 3VZXA 2H8ZA 1TPFA 2ZKMX 1GWJA 1X8CA 1IR2A 3LN3A 2XZ7A 1P48A 3RPMA 2OG9A 4H4IA 1AQFA 5D9OA 3EOUA 3P61A 4UTLA 1O1ZA 4QQUA 2VT0A 5ABGA 2EPKX 1M9HA 2VFHA 3A4XA 4Y8FA 2C18A 4M56A 3M47A 3IGXA 1U5JA 1QPNA 2UV8G 1RJRA 1S2UA 2OYMA 1M01A 1KM5A 1DQWA 5REQB 2XIBA 3TZFA 1B0IA 5I6SA 1AMKA 1ENUA 4FXRA 4UFIA 3CZGA 1F4HA 3C0JA 1JXKA 4A8LA 1S46A 2YR1A 3S1GA 3MS8A 4J2PA 4HU4A 1ITCA 1R47A 1BGAA 3VC5A 1KXTA 3Q45A 2I17A 2HCVA 1ZGDA 2C15A 2E0PA 1EC8A 4PUEA 4H9ZA 4O1FA 2CCRA 1OFOA 4TQTA 3KWXA 2XUCA 2ISDA 3EX4A 4HPGA 1OFPA 2QXWA 3EX3A 2YCLA 4MB4A 3KVJA 3RRXA 3F5KA 4FXJA 3RR1A 2PDHA 4GH3A 3VNMA 4TXEA 5DX7A 2QYGA 3V5OA 4IIGA 4R9OA 1E15A 3V5FA 1WDWA 4RPPA 1LL7A 4O18A 3NVDA 1OCJA 4NG3A 3LERA 4Q4PA 2QCEA 1JZ2A 3FA5A 1IGSA 3LXAA 1P4CA 4HNUA 4GCXA 1E6NA 2YCJA 3TYUA 3LD5A 2ZADA 1YBQB 2NVCA 4FF5A 3E6EA 5TAOA 3GNDA 3NXFA 1QMLA 1R9XA 3L0GA 1JZ7A 1V3HA 1GPWA 4AWSA 3WQGA 4XZ9A 1Z89A 1TX0A 3CUHA 2CZFA 4QJ4B 3VIIA 2PUZA 3W84A 4NIRA 3A4JA 5E0KA 2DZWA 3SUTA 1FCUA 3NPWA 1E9ZB 1B3YA 1B5TA 3CQHA 2BY1A 3CS2A 1YW1A 5FOOA 1CTNA 4XIMA 1QOXA 4X0VA 4EPDC 2W61A 2ONEA 4XSMA 5BU6A 2VL4A 4UQBA 3C56A 1MEIA 4XZLX 4LUSA 5E09A 5C70A 1IEVA 1DTNA 5FF7A 4RV3A 3ZM8A 4J3VA 1IWAA 3B06A 4QG6A 1OIMA 3M6YA 3U57A 5AHMA 1P6WA 3JU2A 3FJNA 4MPKA 3NDZA 3UF9A 3D46A 1D3GA 2BXYA 3SRFA 4O54A 4I8YA 4NI3A 3TH6A 1CCWB 3FA3A 2J9ZA 1B3ZA 4LALA 2D0HA 3CUFA 1BRLA 1XYCA 1XLFA 3M5ZA 3KOXA 2J7HA 3WNPA 1HT6A 4PMJA 1DQUA 3SCQA 2CU0A 4J28A 1GOMA 1NFGA 3CHDA 2D1ZA 2WNNA 3H2AA 3OA3A 3NPVA 1CLXA 1E1CB 4F9JA 2XVNA 5HATA 5CPOA 1XBVA 2B0MA 1WQ5A 4JL1A 3LY0A 1S5NA 3WO8A 3BQ6A 3M0YA 2JIWA 1JAEA 1Y8BA 3FK4A 3NYDA 1XLLA 2SFPA 4MNMA 5D9MA 3UZJA 2VGIA 3H7VA 1TE1A 2WYSA 4C5YA 2BHUA 4LOCA 3NSXA 2GJNA 5BWFA 4IQLA 1UC5A 2ISSA 4I90A 4UOJA 2BY0A 2OOGA 3GAYA 1IT0A 4DLFA 1PKLA 3VGEA 4KFOA 2ZXDA 3MVTA 5GEPA 2FLIA 4GY0A 2GK1A 1CXKA 3V5CA 3I6TA 3PPCA 1I75A 2W92A 2HVMA 3CAKA 3HMJG 2BXVA 3W1UA 1X96A 1XIIA 4NF7A 3ZWSA 4G56A 1Q6RA 2E1DA 4JAWA 3VOIA 1K70A 2UBPC 4AZCB 1ZU8A 1RY8A 2ZVIA 3RLVA 3VXGA 5A6LA 1G67A 3KX6A 5FJIA 3E0IA 2WB5A 1TRDA 3AMLA 5GNYA 1RPXA 2UY3A 2Z2AA 3GVQA 2XSAA 5L6UA 1OFRA 4AH7A 1AODA 1QNPA 4GA8A 2WZEA 3UR8A 1AZ2A 4H8VA 4KEZA 3AIWA 3GU2A 4NKCA 1O66A 1DE6A 1ZJ9A 2FTYA 1IXQA 5I06A 2ZDRA 4UR9A 4C6OA 3LXBA 4NJIA 3MMCB 1LROA 1UCWA 4LUIA 3JRKA 4DWSB 1LRNA 2XYLA 4GQ0A 1IEWA 3G22A 2E68A 1JGIA 4DF2A 1K7EA 3L0NA 1KFKA 3O6DA 4JDBA 3HGJA 4MAZA 2W27A 1ZHAA 4AZ7A 5C7HA 3NEVA 1XSKA 1FQ0A 4EVZA 5AHIA 4EXQA 5AYZA 4MYAA 1AMYA 3RN6A 4Z2HA 1JYXA 2TYSA 2DDXA 2VWSA 3N19B 3PZVA 2XGIA 4OVXA 3DYPA 3DOPA 5D4YA 3RLUA 1B3VA 2ZWYA 1JPKA 2EKGA 2PMQA 3HURA 3H54A 1X1OA 3T1GA 3UWZA 3P8IA 3MM8A 1MDRA 3UFYA 1GW9A 3AISA 1B3WA 1PXGA 2CLHA 4GIAA 3HM7A 5ABFB 3MMBB 1XC4A 3OLEA 1O4UA 2E8YA 4PMXA 4OFCA 3TA9A 1FWRA 2VENA 1O7AA 2E6YA 4B3ZA 4XD6A 4GYPC 1T6MA 5CZJA 3WMSA 1DJWA 3B05A 3HPXA 1QI2A 1QVBA 3LTPA 5HWMA 4Q32A 2YYTA 2W63A 5C9XA 3THAA 2BDQA 3CQ0A 3P0XA 1N8FA 4REQA 2OPJA 2PBGA 3KUMA 4UBPC 2ZUSA 3T81A 3MDWA 1YKWA 3IEBA 1HGWA 1GKPA 1EYEA 1FUYA 4HKPA 4M0XA 3WK0A 1ZBVA 1FWIC 2BGSA 2JEPA 3U5YA 4WSJA 3RPTA 4MNKA 4U3CA 4HJFA 3WLIA 1M7JA 1MW3A 4S3KA 3L67A 4AY7A 2TAAA 3U2OA 5CBIA 4AXNA 5I5RA 4PB4A 4QCFA 3IJ6A 4DPPA 1H61A 1S5TA 2CZEA 1XISA 3BLIA 5LNWA 2OQYA 2XN2A 2GYIA 4LRTA 3S3GA 3H7UA 5I00A 4F2BA 4AEOA 4GFSA 1HJXA 1MXDA 2G50A 1FX6A 1KFLA 1CB2A 3CV6A 2DZSA 3MUIA 4HA0A 3AU2A 4FOUA 2IPGA 1IWPA 4R3UA 3PF3A 1PTGA 2QR6A 5HULA 1BYCA 2R1NA 4PMUA 3RIKA 4GVIA 3V16A 1M1BA 1E0XA 4LAOA 1CI1A 2HPIA 4LB3A 3QM3A 1S1RA 2Y85A 4IX0A 9RUBA 3ZT7A 3R94A 3SRKA 4MWAD 2PC4A 3DGBA 3G1HA 3CLWA 3W1NA 3BK0A 5EMYA 1MRQA 1EXPA 1VFSA 4JTCA 1OM0A 1KCLA 3AIVA 3ZLGA 1AH0A 1GQNA 3AZSA 3TTQA 4B5XA 2C91A 1Q6CA 1XIDA 2GQ9A 2EPHA 1EEPA 2NXIA 3N2TA 1NY1A 4C6FA 4PSRA 5A6JA 1XIBA 5I3FA 4E8CA 1M7PA 2DPEA 3AYRA 5D8ZA 2XH4A 5CPNA 1EJTC 5LHEA 4LW7A 3GTXA 2WSPA 3W1QA 4K1GA 1UJQA 3MMTA 1G0CA 5H8UA 3VOHA 3WDPP 1LQ0A 4V15A 3ECQA 8XIMA 3GM8A 1POKA 1GVRA 3UXDA 5LNSA 4Y9AA 2Y70A 3T2QA 3SCOA 2VUNA 2IXUA 4O12A 5EBAA 3V3WA 4S3CA 3KE0A 4Q3MA 4ROQA 3LV6A 3C8NA 4IZGA 5TQLA 4HOXA 3WUFA 5A3HA 5F1VA 3HBLA 1CGWA 3SN0A 3PBYA 1EGZA 2OEMA 3O05A 3GE7A 5I02A 2VVNA 3KDOA 2Z24A 3OZPA 3CYJA 2QVNA 3O7UA 3W26A 3GNXA 4GXWA 2HNHA 4UZUA 4WDXA 3KTXA 4B3KA 2PZ0A 1YTEA 3VPLA 5LNRA 2J7BA 1WA3A 3N2CA 2CERA 5GQBA 3KM8A 4HP5A 1FCVA 1BXNA 4Q8MA 4XZNX 1OBAA 3BSGA 4EF8A 2XN0A 1Z69A 3LENA 1KGXA 5TIMA 1KXQA 4UB9A 4N6EA 4NXKA 4Q4SA 1OABA 2XIOA 5BXTA 2QCMA