4S38A

Ispg in complex mecpp
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
401
structure length
400
Chain Sequence
b'MRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Oxidoreductase
total genus 139
structure length 400
sequence length 401
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s38A01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s38A02
1Q7ZA 1AJ0A 3VLYA 3B0HA 4DJEC 2V4JB 3H2EA 2VEFA 4DAIA 3TYBA 2YCJA 3MMCB 2XSJA 3TR9A 3VKSA 3H21A 4CCZA 3B0LA 3MM8A 1TX0A 2V4JA 4C1NA 3AOPA 4GEPA 4DJFD 4S38A 4S39A 3MMCA 2XSJB 3MM7B 1Q7MA 2Y5JA 2E7FA 3K13A 1AOPA 2Y0FA 2YCIX 3MM8B 3B0MA 4S3EA 2VP8A 3H2CA 4C1NB 1Q85A 2GEPA 8GEPA 4MWAB 3TYCA 2Y5SA 2OGYA 3MM9B 1ZJ9A 2AOPA 3VKQA 3BOFA 3MM7A 3OR1A 2YCLB 4DJFC 4DJDD 4S3CA 3MM6A 3VKPA 3V5OA 3H26A 3H2OA 4PZVA 3VLXA 5JQ9A 3MMAA 1Q8JA 4D9PA 3VM1A 3H2NA 1TWSA 4MWAA 3MM9A 3OR1B 4D8AA 3OR2B 3TYAA 2YCLA 3H24A 4O1FA 4S3BA 5AOPA 3H23A 4NIRA 4DAFA 3MM6B 4DJEA 2VEGA 2H9AB 3MCMA 6GEPA 3MM5A 4MWAE 3VKRA 3MMAB 3TYDA 4DJFA 3MMBA 3H2AA 1Q7QA 1AD1A 4O0QA 3TZFA 4AOPA 2AKJA 1EYEA 3OR2A 1TWZA 4S3DA 4S3AA 3B0GA 3MCNA 4G38A 2H9AA 4NILA 1F6YA 7GEPA 3MM5B 4O1EA 3NOYA 4DB7A 3MMBB 3VLZA 1AJ2A 1Q8AA 5GEPA 3B0JA 3TZNA 4S3FA 3H2FA 3MCOA 3GEOA 3VKTA 4DJDC 3TYZA 1TWWA 4MWAD 2DZBA 2BMBA 4G9PA 3H2MA 3H22A 4DJED 3B0NA 4G39A 4HTRA 2YCKX 4D8ZA 1AD4A 3BOLA 4HB7A 3VM0A 3TYEA 1AJZA 4S23A 1TX2A 4MWAC 1ZJ8A 2DZAA 2DQWA 4DJDA 4NL1A 4NHVA 3TYUA
chains in the Genus database with same CATH superfamily
4H9MA 2V4JB 1Z44A 4TVCA 3RITA 1U83A 4EWJA 1BTMA 2G41A 2WM1A 3CPUA 1MQPA 3M7SA 4RLIA 1J0ZA 1NSJA 3MM8A 4H1ZA 3DFHA 1KFLA 2EG6A 4W8LA 4C1NA 1XDLA 3WEMA 5AHFA 1RPXA 2Y5JA 3SGUA 4EPDC 4FOUA 2JFEX 2IPJA 2RFGA 1VR6A 2BOEX 5FAGA 4EXBA 3B8SA 3HZ3A 2P3EA 6A3HA 3Q37A 3BE7A 3B9OA 4O53A 4OUEA 1RY0A 4ZO8A 3R4IA 5CC7A 1VFFA 3P8JA 3ID7A 3HIJA 5HMFA 3HURA 2WNZA 1G69A 3LM3A 3NZGA 3HM7A 4PMXA 3RCNA 3CIXA 4ICCX 3DU0A 4XZLX 3BW4A 3EB3A 4P7OA 3FJNA 5CPMA 3GG0A 4S2CA 1J0KA 2QPUA 4J3WA 1CB2A 3T6CA 1RPKA 3BAKA 5LHEA 4S3FA 1RQBA 2ONEA 3LV5A 1KV8A 4QS6A 5JUVA 3LMYA 2C91A 3EKZA 1VFOA 3B0VC 1YRRA 1H4PA 4YPJA 1HN1A 3M44A 3G1SA 4DM2A 1WNOA 2WVTA 1W2VA 4ONVA 2GYIA 3OIXA 5FL0A 2PI6A 3UT0A 4J40A 3B0HA 4EWND 1HXJA 2P0OA 3MMCB 1XD1A 4BWLC 1EB3A 1WOAA 2RKXA 2FZDA 4K8GA 2B31A 4M80A 2XJ7A 3WBYA 4PUNA 3VCRA 3G22A 4LBRA 1OD8A 2VEKA 3UWWA 3B9DA 2EJ1A 4V33A 3KWSA 2YZ5A 4C6EA 1MXDA 4WSJA 1ZPTA 4LUYA 3IV3A 4JS3A 4UTWA 3R5EA 2WHMA 5E6ZA 4A3UA 1JPKA 3EB2A 3EWUA 1E0VA 1MW2A 1OADA 1ZP4A 1RK6A 4IGHA 2Y63A 2ABAA 3WLJA 1U30A 3JS3A 3HG4A 1KM4A 1B9BA 2E3ZA 5CGQA 2CFFA 1AD1A 2DJXA 1J12A 1UBPC 3U5YA 3C86A 3UYCA 4ADUA 2D24A 3MWAA 1XC6A 5IHSA 5CPQA 1UKSA 4IWWA 4NG3A 2NT0A 4NKCA 4IL0A 4AYSA 1Q6DA 4XKYB 1BLIA 2FMOA 3CH0A 5A6SA 3H2MA 2WSRA 4ATWA 4DHGA 4PUEA 1H61A 1WV2A 1OGBA 3PSWA 3ZOAA 2ZA1A 1KWKA 2ZTKA 1XICA 1OT2A 3GO2A 3F2CA 4MTVA 3W02A 4EXAA 2CXEA 1JXJA 2ZWZA 2R1LA 1VFSA 5E5CA 4TVUA 4XZBA 4QNEA 5G2WA 1Z9AA 4ERGA 9XIMA 2XZ7A 1W3JA 3M16A 1Q6OA 2PDLA 3KP1A 3ECQA 3MM7B 2BG5A 3VD9A 1EDTA 4OBTA 1LLOA 2QGYA 1CZ1A 2FGLA 1FDJA 3DBNA 4GKTA 2VP8A 3GG8A 1NOFA 1U33A 4AF0B 2TMDA 3LCGA 4GQRA 4WX2A 4F0LA 3CXOA 1NDZA 2IKGA 2ZADA 3Q4DA 4IPNB 1B4EA 4L1WA 3DH7A 1MUMA 3NOEA 3WQFA 4CCEA 3BMXA 4KEZA 1LBMA 1Q4WA 3FJ6A 4NNCA 1W6TA 1FXQA 1ME9A 4PUJA 4S1FA 1QCWA 2ZX5A 4G38A 2DZSA 1R0MA 3WUEA 3EXRA 3DOPA 2C3ZA 4FZIA 1FUYA 5HAOA 1DHPA 3IGUA 1DTNA 3GXTA 3QZEA 5LA0A 4FP1A 1VFUA 3B3DA 2X09A 3EWXA 3KLKA 2HROA 4UTLA 4R33A 4H2CA 4HD5A 2BX7A 3S3GA 3T07A 2PFHA 2Y7DA 2RUSA 1UYQA 3DYMA 4PH6A 1PZ2A 2WZIA 1OC5A 3N14A 4DUWA 1TVNA 2B0MA 2R1PA 3SGGA 1X1NA 2Z27A 3TTSA 2OTDA 3S1VA 4QG8A 3SCPA 3W38A 2WW5A 3NGFA 4R7OA 1TR1A 4LB3A 4PUWA 4M7SA 1FRBA 1KGUA 4KWUA 4ZOCA 4KMQA 4NZFA 5H2ZA 1A5MC 1JVNA 2XN0A 1QW7A 5HUOA 2PDQA 3OR2B 4YL2A 3ES8A 1DJNA 3W25A 2GVGA 4ZB0A 4P2VA 3S1UA 2EGZA 4K6AA 5BWAA 2WVSA 1Q6LA 4MPQA 1EJWC 4O1EA 4UNIA 2ZUSA 4AU0A 4QCFA 1BPLB 3N2XA 1QPKA 5FEPA 1VKFA 4LBUA 4CD7A 2H6RA 5BXRA 3THUA 4C91A 2C15A 3UD6A 4N02A 4ZQNA 4ROPA 1CGXA 1UWTA 5K3VA 4YWSA 2E4TA 2QAPA 1TPVA 4YTTA 1MVYA 3RLUA 2QV5A 3ORWA 4PMOA 2PURA 3WH6A 5A6BD 1AMYA 2XVPA 5EKYA 1UKQA 3GYEA 4PTNA 4NXSA 1UR4A 3UCCA 2H90A 1XBZA 3VKKA 1UR2A 3GTXA 3W1AA 4ZVJA 3HQPA 4LB4A 3ITVA 2XISA 2QMKA 2OLSA 3G77A 2W0UA 4HJWA 4HU0A 1DWFM 5CSUA 2DU2A 5FSDC 4JN7A 1ZAJA 3L0NA 1CGVA 3ITYA 1JEZA 5IBXC 2V3GA 4RXFA 3S6DA 1Q2SA 3RM8A 3WQDA 1QNOA 1R46A 2QF7A 4JX5A 4W84A 2V3FA 4KS0A 4PSPA 3TTQA 4O8RA 2AAAA 1DWAM 1DTUA 5AYBA 4C1KA 4YYCA 1MSSA 3VKAA 5CZJA 1H0GA 3NVTA 4JEJA 3OYXA 4UOQA 1LCOA 2E8ZA 3SRFA 1KR0A 4P8VA 3EB4A 4U4MA 1NEYA 2X0SA 4TO8A 3VZYA 4EAMA 5DXYA 4KRUA 3FVMA 1KNWA 5M2FX 5LXEA 3WQVA 1TELA 3GG7A 1ZUAX 3UYIA 3LG3A 4DJDA 2FZ8A 3IJ6A 2PLKA 3MV01 2QQ6A 3RO6A 2E1DA 3K1DA 4FF7A 4XAZA 3ZJKA 1WBHA 2QGHA 3CZ8A 4PTMA 2XWDA 3CWHA 2DVTA 2WJDA 3CJPA 1OINA 1CEOA 3HQ1A 1CENA 2ZRUA 5JBEA 2FZMA 4CGTA 4J1OA 3GC5A 1GT8A 4P7RA 4Q4MA 2BY0A 3MP3A 2WCSA 3FYPA 3T0DA 4JNZA 4M6VA 3ITGA 2G97A 2O56A 3UG8A 1RBOB 4DVOA 1FA2A 4HN4A 4H04A 3KS6A 1NVMA 3O15A 3I6RA 3SM0A 3WQPA 2YDQA 4E0CA 4QDMA 3W1TA 3LK6A 4L6DA 4AWSA 1XG4A 4GVIA 4XKYA 1WDSA 1JL8A 1OG0A 3TAKA 3AXKA 4LNCA 2WCAA 2V67A 3THCA 1AH0A 1BXBA 4CN4A 1RCQA 3LYEA 3NQCA 3WLKX 4B91A 4RNJA 4WK9A 4I6KA 4GMEA 1GOIA 1TV4A 3VUSA 1E6NA 3GBEA 4K3ZA 1LWIA 3ELFA 3KOXA 1QT1A 4NASA 1J2BA 1WA3A 3OU8A 5FL1A 4HSNA 2EPKX 1W5OA 2VVSA 1MDLA 2HXUA 3N9RA 3TNOA 1FVPA 3WMCA 2GUBA 3K4DA 3UJSA 3E3HA 5JBFA 1WZLA 1BFNA 3WX7A 3HG2A 2WANA 1SFTA 1YDOA 2WSQA 4E2BA 5AYZA 2NZLA 2OOFA 4GK8A 4AVFA 3PUGA 3EWBX 1XLMA 2XIJA 1G4EA 4AEOA 1IR2A 3ARTA 3DYOA 3LCIA 4UXDA 3C0LA 2YDSA 3EX4A 4KCVA 4W8AA 1F3WA 5EFFA 2Z7GA 4J35A 4P8WA 4KEUA 3OLEA 3MM5B 1PKLA 4DI9A 2QW5A 2ZX9A 4W86A 3SRKA 3V5CA 4RE4A 2ZZ3A 1YIXA 4H8HA 2FGZA 2PODA 3EDFA 3ZJ8A 4I3GA 3V0TA 3SCVA 2EAWA 2Z26A 3NYZA 3W7QA 1SW7A 3QGAC 4C6BA 3PG8A 5I23A 1V02E 1Q3NA 3CZGA 3RYSA 4EIVA 1X98A 2O4QA 2WSPA 2PBGA 4X0VA 1IQ8A 1EO7A 1EUAA 1XM3A 3TH6A 1LRNA 1VFHA 4I7UA 3AWOA 4C6LA 1Y65A 4Y90A 1E4LA 3TIMA 5DBUA 2I9EA 1S1RA 1JZ5A 1FP8A 4DM1A 1C3FA 1DQWA 3BCDA 4HU3A 1OC7A 3U2OA 4A05A 1MDRA 2YLAA 3NIYA 4AAJA 1XGZA 3W9ZA 1YXYA 4V1YA 5C9XA 5MHBA 2X16A 3UVIA 1RCOB 2VFGA 1XYLA 2O9RA 3L4UA 3Q94A 4GYJA 4LNYA 3GD6A 2ZOXA 4L1GA 1NFBA 3GY1A 1IYXA 1QO2A 2ZIDA 2AKJA 2CXGA 5LIWX 3AOFA 3O1NA 4CU6A 3GKAA 4HTYA 2AGTA 1ONXA 3ES7A 2I56A 2VGIA 1S3HA 2QCMA 3BW3A 5CBIA 3CL8A 3W7DA 1W0MA 2NXHA 4IQJA 2OX4A 4ML9A 2D1ZA 4MZYA 2OU4A 2J9YA 3IRSA 2V2DA 4JTCA 2BVDA 1QPNA 4QE5A 4AZ7A 4ZOBA 3O16A 4WGHA 2ABBA 4AY8A 1LORA 2NX1A 1GVOA 2V0TA 1B5TA 2Z0IA 4H6EA 2XIOA 3TLQA 1K7FA 3W0KA 1GQKA 1E40A 3CMGA 5IRPA 3WLRA 1Y8BA 3SJ3A 1IT7A 1EKOA 4FB7A 3NTYA 1XWYA 5BXTA 3P84A 4PBGA 3B0MA 3GDBA 4U33A 3R10A 2AQWA 4LX4A 4GBDA 4AY1A 3BAIA 2NXIA 5HPOA 3GAYA 3VI2A 1ALDA 1ZCOA 3KOZA 5J5DA 4AC1X 3GFZA 5AOPA 4WY0B 3EMCA 2AKMA 2NVDA 3FLUA 3B8DA 4AWEA 3B04A 3AIBA 4WSHA 4GY0A 1EA9C 4NNAA 1IHIA 1IIGA 4UC5A 5F2GA 2QJNA 3N2BA 1DXFA 1W56A 4O28A 3NL3A 2GQ3A 2VGFA 1A4MA 1TMHA 1VBUA 3H54A 3MMBB 4D6GA 1ONRA 4ZBCA 2GDUA 4GLEA 1A3WA 3EBVA 1XW8A 1HKMA 4TUFA 3Q45A 4IGNA 2PD5A 5FIPA 1ZFJA 3EKLA 2FZNA 3MUY1 1VFLA 1GOWA 2D2HA 4UTHA 4JTHA 1W3TA 1OCNA 1L8PA 4RV3A 4HTRA 3Q58A 3UU0A 1H7RA 3CTLA 5CEWA 1OSEA 1HKVA 4MF4A 1BEUA 1HL8A 1RD5A 4HCHA 1TSIA 1DKWA 5CXPA 5G1TA 1PCKA 2YCJA 5F2IA 3APTA 1UP3A 1Z6KA 1V03A 3AC0A 3JU2A 2V3EA 1XLJA 3SCUA 1JNDA 2E9BA 3IJ7A 3DUGA 5CC5A 4QG9A 3EX1A 4N4QA 2PF8A 4QIUA 1O6IA 3EDJA 4UIOA 1S46A 1PSCA 1FCVA 2ZUWA 3GHUA 4K37A 1WXYA 3TTEA 1K6WA 1QNPA 3POHA 1OYBA 4AVNA 1C29A 4W7UA 2NV9A 3B97A 5H8UA 1IXOA 2Y7GA 1SZEA 5DX7A 4IGSA 3SCNA 1EHAA 4PMUA 2BY1A 3SR7A 1GW1A 1MYRA 3QXBA 3KTXA 4MZ8A 2O7QA 3CO4A 4LCSA 1P6CA 3DG6A 3SY1A 1O66A 3PWAA 3CL6A 3VMNA 1QTWA 4CNUA 1XUUA 3O6AA 4C65A 3TC3A 1H60A 3HPFA 6ALDA 4U2YA 3SW6A 1MI3A 4IG2B 3ZR6A 2YPIA 1L0PA 1PJ9A 3MQTA 4WDUA 1RXOB 4S2BA 4FK9A 1JPIA 3I6TA 4OHQA 4PL1A 3RXZA 4RZBA 1O1HA 5DF0A 5HJYA 1CPUA 3WBXA 4DXKA 3AHZA 1M9HA 3KFTA 2NQHA 4AWUA 2XH2A 2CLEA 4XD6A 3S2CA 4JTRA 3BDKA 3E74A 3EWWA 2PDMA 1UJPA 4L4LA 1K1DA 3SI9A 1I4NA 3WLPA 3R43A 3N1AA 3TJ4A 1AZ2A 1RCXB 3M6DA 3CEPA 3PY2A 2ZRWA 1V77A 1O5QA 1W5MA 2XINA 4QEEA 4BS0A 2XSJB 3ALFA 3NR0A 1O5XA 2C14A 3RR1A 3YPIA 4ADTA 1H1YA 2YIHA 1PPIA 1QJWA 1R2RA 3F4VA 2A1YA 3QR1A 1C8QA 5E6YA 1SJBA 2XGZA 2QCDB 4D6EA 3IPWA 3OG3A 4F0SA 2ON3A 2PWFA 2Z00A 3WSUA 3L7RA 4AZHA 3KCJA 1NARA 3BG5A 4UFLA 1PXGA 1A5BA 2TSYA 1ZNNA 4MB3A 1W2PA 3CPRA 3QKEA 4MKSA 3MM5A 1A49A 3TOPA 1FWBC 1WKDA 1ZL1A 3WQ5A 2J47A 4K1GA 3WKZA 5I00A 5IHRA 1H7NA 2NQJA 1E9YB 2QDEA 2D20A 4E8DA 5BW6A 1MRAA 2YFOA 1E43A 4FNQA 4UNLA 3REQB 4H01A 3B05A 4H6KA 2DW7A 2FPVA 3P93A 3L2IA 2P3ZA 4XBKA 5HQEA 4IP5A 5J04A 4JD4A 1P6BA 1ICSA 4DN1A 5BNKA 1QUMA 3W2JA 4HHLA 4P5UA 3IUHA 3MMDA 3FYYA 2BWGA 5A6KA 4P7LA 2GSEA 4JIQA 2QS8A 1OCJA 2DUZA 5T8GA 4E3VA 1ISXA 1X8CA 1SZGA 2WWDA 3STEA 3QSRA 3H7RA 2VFEA 4Z42C 1N8WA 4U31A 4IGMA 5A6JA 4W88A 3UR8A 5A8OA 2CHRA 1LLZA 1UUMA 1X1ZA 4UQAA 3KL3A 4HYRA 3EXTA 9RUBA 2V2CA 3WQWA 4XV0A 2ZWYA 3GG1A 3NWRA 4ZQMA 2XU2A 3BJTA 5LNWA 3V5OA 1LWJA 2E8YA 3H2NA 2LLEA 3ZFHA 3PZUA 1F6KA 4DNMA 4JFWA 2OLHA 3BUVA 3FAXA 3B0XA 1BHGA 4O0KA 4WY0F 2VRKA 4M1BA 1UROA 2AKZA 3GR8A 5M1TA 1T0OA 3G1XA 2J6VA 2PCQA 4O10A 1UZDA 3NSNA 1U2YA 4XISA 2NQ9A 4U10A 3W71A 5I79A 4GA8A 1H5YA 3KLLA 1E6ZA 2XN1A 1JJKA 4ILSA 3L5LA 2BY3A 2Z6IA 3FGCA 1E5JA 3KOWA 2XZ9A 3NFUA 1FWJC 1GOXA 1X97A 3QHMA 4B5NA 2VELA 1IEQA 3UY8A 4O50A 4IX0A 1XLCA 1V51A 2D69A 3WN6A 1JDCA 3WMLA 5BXSA 2X1TA 1FBAA 4EOUA 3K4WA 2HCVA 2QJJA 3WNLA 2XWEA 2NUXA 3UNDA 1G4SA 1GZGA 3U57A 2O92A 4Y2WA 1AH3A 3A24A 3WK2A 7ODCA 2R82A 4WY0A 2G3IA 4GI6A 2G3MA 1OFEA 3WDQA 4JTKA 2MUCA 3QMRA 3B8UA 3KBJA 3CQIA 1RY8A 4NZCA 2GGGA 3PZ9A 1BG4A 3A6OA 2VO5A 3H53A 4AISA 1V6UA 4KH2A 3MMBA 5C7VA 4LTSA 3ZMRA 3VOHA 3FJ4A 4AZ6A 4UOZA 4S3AA 3B0GA 3CYJA 4ZTXA 4NRRA 3Q2DA 1GPFA 4GX8A 4DBWA 4HMNA 2JALA 3A9IA 4I5UA 3CUHA 2PMQA 3F5JA 3VC6A 1QBBA 3LXCA 4L4MA 4FR1A 1YNYA 1DWIM 4LOCA 4Q32A 1ONWA 3ZYZA 4LUSB 4GXPA 3SUTA 4NZ4A 3LQGA 1QPRA 3VM0A 2ZRXA 3WH5A 1V4YA 3QMSA 2PAJA 4CU7A 5EMMA 1VB9A 1QPOA 1OX4B 1Q6QA 3E12A 3EWDA 4FXFA 1XLGA 3N04A 4L80A 4DRSA 4X2PA 3QLLA 2E6DA 3CBWA 2JGQA 2YBVA 3PHAA 4FHAA 4LY8A 1TMLA 2NWSA 4HK6A 4HK5A 2E1WA 5HNRA 5DXXA 1FWCC 4KFPA 1AOPA 2PU1A 3GXMA 4RNIA 3GX9A 1J79A 1IXNA 2AL2B 3OG2A 5DMLA 3SCRA 1RJQA 4I9JA 1QNVA 3W24A 5HATA 1W31A 1V5XA 3H26A 3TWAA 5CJMA 4JY8A 1T41A 1A80A 1V3HA 4Z2JA 5A2BA 1MNZA 4J28A 2H9AB 2GJRA 1GQJA 1J9YA 3UNTA 2IKIA 1KRMA 6REQB 1KFBA 3QQWA 3OW1A 1EGVA 5D9NA 2EQDA 1M3UA 2OOGA 3QFEA 1F3TA 3H70A 1PEZA 3RILA 1J0JA 1TPFA 2CWNA 1UW9A 3F1QA 4JTLA 2X05A 1OFAA 4IQEA 3CAKA 1FWRA 4TX6A 2AOSA 2BODX 1EDQA 4ACYA 2FKPA 3ZSTA 4G39A 1GHSA 1CLXA 2CEQA 8XIMA 4QSFA 3VIPA 1Q6RA 1QFEA 1GVRA 2ISSA 2QJHA 2WB5A 4GYFA 1ONEA 1DV7A 3HJZA 2XSJA 3OYZA 1JCXA 3RLGA 3CUIA 4KETA 1QO5A 1ZLPA 1UH3A 4GEPA 3KBNA 3NL5A 3C52A 1JCLA 3LI0A 1UB3A 3FXGA 4MJ4A 3WNKA 4IL2A 1XH0A 5DELA 3O8AA 3HOJA 1MXGA 4N6EA 2DSVA 3BQ6A 3VM1A 4IM4A 4GVHA 2Q3OA 3VOGA 3CQJA 3NQEA 1WKYA 1OEPA 2DEPA 3HV9A 5GPRA 2DDXA 3WLTA 4MY8A 4MJMA 2HWGA 2J9XA 3AMLA 2Z28A 3ONBA 1GW9A 4K7VA 2V5KA 1UHVA 4BK9A 2UWFA 4ERIA 3V0SA 4AFYA 4TV5A 1OFBA 4W8BA 4J3TA 3THDA 1K8XA 3VZXA 4I5XA 4BF5A 4RW5A 5F4WA 3SQLA 3PUEA 4LVDA 1ZS2A 1C7SA 4AXNA 3NEVA 4EPKA 4DZAA 2W6RA 3FX4A 5ENLA 2O4MA 4WEVX 1C9WA 1D7KA 2WO5A 4HA3A 1H5VA 1HF6A 4DZIA 4ORIA 4WCJA 4DX3A 3QKZA 1S5MA 1BAGA 1K3UA 1UPMB 1KM2A 3BICA 2R1KA 2TRSA 2XGIA 3CH9A 4MNKA 3SSZA 2WPBA 2OODA 4HMCA 1H50A 2A6NA 3U7BA 2OVLA 1M7PA 1SQ7A 1W5QA 3LBMA 4LS2A 3S46A 2XH7A 5AKQA 3WNNA 2ALRA 3NNTA 3IAPA 3UPWA 5CPTA 2TPSA 4D6HA 1GTEA 3W7KA 5I02A 4O52A 3KUMA 3W70A 3GTIA 3MS8A 5E93A 2BSLA 3KVKA 1UASA 1WZMA 2WVVB 3G5EA 5AHMA 2EPOA 4QG6A 3MM9A 2NX9A 1R2SA 2ISDA 3GE7A 5D9MA 5A6TC 3VOFA 5AZ0A 4W4QA 1CX9A 3VGDA 1EYEA 5E9AA 2YBUA 5B80A 1VZWA 4S3DA 1PDZA 4UMBA 3IVSA 2VNCA 3E5PA 3EYPA 4Q8PA 4GINA 3W72A 3CQKA 4Z1YA 1I0DA 4NAEA 3ATZA 4U2ZA 5A6BA 5KINA 4FR6A 4C5YA 4IPIA 3VIFA 2FDSA 2YJQA 3BMVA 3AYRA 3F2BA 3A3HA 3ZR4A 2V5DA 4J7RA 2ALDA 4DJED 4GCAA 5HPCA 3LD5A 1WDPA 3VNZA 5C6MA 3C2FA 5A69A 1DQXA 1ZCCA 5EU9A 3N17A 3L0KA 4MAVA 3N18A 5E0KA 4JTJA 3W6MA 4BI6A 3QV6A 2DZWA 4J3VA 3OZPA 3QH2A 3D5HA 4B3LA 1PX4A 4UTTA 1OF6A 2WNNA 2NWRA 3MT1A 1GNXA 2JKAA 4X9SA 4RPPA 1SZRA 3LMZA 2I14A 1XIJA 1YTDA 4IMGA 4XIAA 3KCOA 1BYDA 4UMCA 4IIGA 2JEPA 2HVOA 4XKMA 3VVGA 3OGRA 1CGTA 3W76A 3AFBA 3ZXWA 3GFYA 4FA3A 3QEZA 2OO6A 4RDVA 4WRHA 1E3ZA 1JIBA 2OT1A 1DXIA 1OK6A 1JI1A 2REQB 4AIEA 4JGDA 2GOUA 4XTDA 1WOBA 3LHVA 5CZ0A 4ZOAA 3DHFA 4M82A 1V02A 1REQB 4YCOA 1G67A 1JAEA 2YL8A 3W87A 2PDGA 1OX5A 3FA4A 1QAPA 4GNVA 4K36A 2ADAA 5BOEA 1K70A 4YYFA 4XIMA 1B2YA 1AJ2A 2YLLA 1UUOA 4LUSA 3BSHA 3G0XA 1E9ZB 4GE8A 5ABHA 3VKTA 4NZJA 3MANA 4J4KA 1EX1A 3VMOA 1X6NA 5FJIA 4FNRA 3MPGA 4YTUA 3MMTA 4LY4A 1OX4A 3DI0A 2NUYA 5C9ZA 2Q02A 1DYSA 1EF2A 2RDUA 4I7VA 1PL9A 2E9LA 3ONCA 3QTGA 2CLMA 5I09A 2A4AA 4AQLA 2H8XA 4ECLA 1Q7ZA 3HFTA 5L6UA 1Z89A 2W67A 3EDDA 4H9TA 6ENLA 2XH0A 3UCDA 2ZVRA 5G1YA 1Y7VA 1UA7A 1GOKA 2EEXA 1KD0A 3F4WA 2AL2A 2YW3A 2WMIB 1QXLA 2VTFA 2F6KA 3WLSA 1RJPA 1M5WA 4JIIX 2GDVA 3OTRA 1SW0A 4MB4A 4WOQA 5JH2A 5I6SA 1XLHA 2HBVA 4O1AA 2VENA 5D2WA 8GEPA 2ESCA 1WUFA 3ITLA 2VEPA 2Z2BA 1BQGA 4CQ9A 2DH3A 3O07A 4XO7A 3PM6A 2F2KA 3PZOA 3EDKA 4GVGA 4P61A 3QSTA 6REQA 2Y88A 4H19A 4PBEA 1UWUA 3C2RA 2GLKA 4YN5A 3RR4A 3UJEA 1ZTVA 4PUKA 1ZY9A 3KBVA 2J74A 1W37A 4N7QA 1C93A 1RLCL 1PZ3A 3QQ0A 4CQDA 1JAKA 4M6QA 1CCWB 2WJZA 3UXLA 3UWZA 3CUZA 5DY2A 2QCEA 3NURA 1PKYA 1XP3A 4PMJA 4YVPA 3O2LA 3CB3A 1CGUA 4LU0A 3H7VA 1IZJA 4PMZA 4WUIA 1YEYA 2ZX7A 4AIUA 3FDKA 4L56A 3TQ0A 3B06A 1GTHA 1DIOA 4MMWA 3HQNA 1E71M 4N9EA 1S2AA 2NLYA 4B4HA 4ZL1A 3T0CA 4CVUA 2NV2A 4Y7EA 3M0XA 1Q5MA 3K2GA 5C2GA 4RKAA 1G9HA 5CGMA 3TCSA 3MZNA 3TYBA 3VD7A 2NQLA 1XIFA 2ZXBA 2HBXA 2Y89A 4P8UA 2HJPA 3DFPA 1ZSXA 3CIWA 2NT1A 2DV0A 3AXHA 1F3EA 4HNOA 4H7ZA 5AVHA 3KRZA 4YWIA 2R9RA 4GI9A 4K68A 5DQPA 2H3BA 1TWIA 4AIBA 3GDKA 3NQFA 2WXDM 4FMVA 4PZVA 3MI6A 4Q7NA 1VQTA 4WIWA 3ZM8A 3BMWA 1XI3A 2OJPA 2D0GA 5E0CA 3TMLA 4LT9A 3UZYA 5HQLA 1YADA 5REQB 2HPIA 4GQBA 1K77A 4AZBA 2Z1BA 4ZFMA 4KESA 1RA0A 2GVLA 4QSHA 1E1CA 2V3DA 2Q8XA 4ASTA 1WKFA 1IWAA 1LBFA 1N82A 4JTAA 1V3KA 3II1A 3QM3A 3TLLA 5XIAA 3PK7A 1LQ0A 4Z2IA 4K8EA 3H22A 1GORA 4UFKA 5FA5A 4L64A 4FX8A 2QMJA 1THFD 3T0AA 1UG6A 2X7WA 4B4FA 4X2RA 1I2PA 1QATA 3VGBA 2WHLA 1MW0A 1N55A 1VBJA 2O9PA 1KW1A 3LB0A 3UJ2A 3DX5A 4H9ZA 3WBAA 1VYSX 3GR4A 2YZRA 5DEZA 4ACZB 4BKNA 2IPFA 9XIAA 3AHYA 4J3ZA 4UCGA 1ZHAA 2VEMA 3GH4A 4YS1A 3N2OA 4G1NA 2P53A 1LBLA 1TJ2A 4UTJA 3DFYA 4LEFA 1XSIA 3AZSA 3SURA 2PDBA 3CV1A 3FSTA 2V5LA 3QGKC 3V16A 1E1FA 4C6NA 3TX9A 4D6CA 3NM1A 2QF8A 1DBTA 1M7JA 3WJZA 3USBA 1ECEA 4D8AA 5I5RA 1OFOA 2BB0A 4XB3A 3CEUA 1U5HA 2NSXA 3KVMA 5DMMA 2GSHA 3KRBA 3PZGA 1SO4A 5CGTA 3E5BA 2PZNA 2PLJA 4CD5A 1D3HA 1HJUA 3LNMA 4XAFA 3L4XA 3C0JA 4MFEA 1GVFA 4PEKA 4TXEA 2RAGA 1UR0A 2Y24A 2OB3A 4JXCA 1P6WA 2P76A 1AUSL 3NZQA 1BRLB 4DO6A 1KM0A 3GNPA 2C79A 4MDOA 1RP8A 4OE7A 4YVXA 4A2SA 3VKJA 4D71A 1RLDA 2VEIA 3TCEA 3K46A 2PEVA 1IR1A 3WEOA 3PN8A 3QF0A 3NQ2A 5D05A 3IWPA 4IQLA 1UD6A 2FZ9A 3GNNA 3SDOA 4Z08A 1YQ2A 7TAAA 4YIWA 3O05A 4HK7A 3QOMA 4HZ7A 1BGAA 3ZQ9A 4PCTA 1EHNA 1LF1A 4RE0A 3CU2A 3E96A 3B8TA 4N42A 5XIMA 1LDCA 3I3EA 2RDWA 1BSIA 1QRQA 3BOXA 3QPZA 4CCCA 1E73M 5JIWA 2INFA 3FS2A 4QLKA 3CLWA 3V1HA 3NA8A 1B3XA 3KXQA 3IIPA 3LERA 1ZJ9A 2PDKA 5HULA 5HNTA 4NJHA 4NX0A 4GRSA 4KFNA 1XKYA 3QY8A 4ZO9A 2JF7A 4MZ1A 3I68A 1XJBA 5I3DA 3PJTA 4OJYA 4FALA 1REQA 2GJLA 2DORA 4FAMA 3RNDA 4KQNA 3U7VA 2YGYA 4HT3A 3MHFA 1R7OA 3Q65A 3PF3A 4Y8EA 2J6XA 5I2UA 4CQBA 4PBFA 1EBHA 1VC4A 2WHKA 4GBUA 1V0NA 2X1UA 2NV1A 2PF0A 4NJGA 1C90A 2FGBA 3H2FA 2PWHA 1R3RA 1T6MA 5AOUA 4MLRA 4RDYA 1Z32X 2WMJA 4HNVA 1IE7C 2BHUA 4HQVA 2CKRA 4B90A 3W7RA 1SFSA 1CNVA 2UV8G 3TA9A 2Z1VA 3C3NA 1EJUC 5CPNA 3BZGA 3VDHA 3UG3A 3EX3A 1HJXA 2NQ5A 3GLCA 1H7PA 3QHNA 4N6FA 4R7WA 2XG9A 2DQWA 4E4UA 1PDYA 3AMDA 3T08A 2WMIA 4AHOA 5DCEA 1ZQ5A 3G1AA 3LGEA 1EC7A 4ZOEA 4KIRA 4G2DA 4PMVA 1WUEA 4OGZA 1UPPA 3R25A 1KCZA 1TPUA 1ZJIA 3LCWA 3B4UA 3NL6A 1X7FA 1H11A 3MMWA 4PB4A 1EJXC 3GIPA 3GU1A 1KXQA 5H91A 1DP0A 2EKCA 2PGFA 4NI3A 3ARVA 4OBSA 3P62A 3A4AA 4HOZA 3QBUA 1J2WA 1BVWA 3BOFA 3VKPA 2XM2A 1EA0A 2B81A 2A2IA 1I8JA 4O16A 3TXZA 2DSUA 2Z1XA 3BW2A 4ZO7A 1LP6A 4S3BA 1UOZA 2IXVA 4HA1A 4PFMA 2ACQA 1YXDA 3R12A 3TAOA 3MW7A 1BG9A 1PTDA 3NG3A 3BURA 4HIBA 3B40A 1W3IA 2OXNA 3E2VA 2ZUVA 3NO3A 4HHMA 1XLFA 3MCNA 2YXGA 1FWEC 4QISA 3OZOA 2CZEA 4HN8A 4XD3A 2R91A 3BG3A 4ICMA 1IT0A 4HP5A 1KRCC 4MWAD 3CPGA 2PD9A 4AD4A 4NP7A 3OGSA 3PC0A 3VDAA 1E6PA 3HN3A 2X2YA 4PB3A 4GUJA 4LF1A 2BGNE 1VFMA 3ERPA 2RDTA 4FNPA 3KBSA 1R5YA 3NO5A 3I4KA 4DWSC 4JIHA 5ABGA 4JX4A 3IAQA 1B30A 1JYVA 3K8MA 3RJYA 1S5TA 4G5DA 4CEXC 1JR1A 1I2QA 1F8IA 1GK8A 2GPTA 3W73A 4JPGA 3L5AA 3UWQA 2NVCA 2DZXA 3WFAA 4CN1A 1E0WA 3F03K 3WH9A 3FVDA 4R27A 5FJTA 4UTKA 2DZUA 1E15A 4WZHA 4RL3A 2ZUTA 3S83A 5C2CA 4PUMA 1C7TA 5REQA 3N6HA 1PWMA 2HSAA 2QXWA 3E2SA 1ITXA 2VUNA 3H23A 3E38A 3MM6B 1DVJA 2VDGA 2VEGA 2B7OA 1O12A 3SFKA 1J8VA 3FEQA 4KWSA 4IIDA 1KCKA 1TFVA 1W9XA 4LAUA 1CW2A 4LVBA 1GVEA 2B7NA 5BU6A 1KQYA 4FX6M 5I0DA 5CBBA 3LBCA 2ZICA 4GH1A 3MUIA 3B0YA 3G0SA 4E6MA 3KTSA 2VFFA 4DWDA 4NRSA 1EQCA 4XSLA 1E9IA 1XLAA 3L4WA 5DO8A 5K4XA 2YL9A 3GDTA 4H7VA 2WC4A 2OR2A 3DEQA 1VGAA 2WYSA 3HA1A 2B7QA 3W74A 1RUSA 2CLLA 3TVAA 4QBXA 3T8QA 4Q8VA 2AMGA 3OEXA 3OODA 3BCFA 3RIKA 2FTPA 4RZ6A 2VCBA 4L1XA 3H21A 1CGYA 1NF0A 1J01A 4US6A 3A4WA 1JZ6A 1EC8A 1RZMA 1W1VA 3CLMA 3FXYA 2SFPA 1TPB1 4L61A 3K13A 4AZCB 4RNFA 1XINA 2BGSA 4W5UA 3UR7A 4LVGA 2V5CA 4J2PA 3EZ4A 4XAPA 3W1LA 2VGBA 3R7MA 3A5VA 3C8FA 4TOQA 2OSYA 3UG4A 3VDGA 3OR1B 3A47A 3SIMA 3CL7A 3GUWA 2J4GA 4RDZA 4PL2A 4YLWA 3W7MA 4H41A 1YNPA 5PTDA 1BRLA 1E6RA 4S3KA 1HT6A 1J5TA 4G8TA 4F79A 2W3ZA 4JKKA 1XC4A 4HZ6A 3RLVA 3GDMA 1FH7A 1HJQA 1QI0A 2AMXA 1CT5A 1KBLA 3W7LA 4LS1A 1BTCA 3OZYA 5HANA 4C6PA 1TTPA 4P8XA 3TFCA 4E4PA 3EX2A 1EPVA 3GFXA 2EPLX 3NCOA 2Z25A 3LZ3A 4NHVA 4PR4A 8CGTA 2VHLA 2QV4A 4EK7A 3MKKA 4O12A 1I2OA 3IVTA 4L4PA 4DBSA 2QULA 4TTGA 3PPHA 2OZ8A 2V8ZA 4H6QA 1XYMA 2DSWA 4CKQA 1JPMA 1K9FA 4IXXA 1KTNA 3NQAA 2A3HA 2R1NA 2XHYA 2VD9A 1P0BA 2Z6JA 3LHZA 3VKQA 2HVNA 3PAOA 4PFHA 4PCFA 4E3TA 3W83A 1EGZA 3UZ5A 5IFTA 1Q8JA 1UWAA 2VX5A 1FQ0A 1A5OC 3VNIA 6GEPA 3EWZA 3W81A 3TYDA 4DJFA 4JTIA 4LYKA 5F1UA 1TWZA 1BSLA 4M7TA 3N15A 1R47A 2IKJA 3IGSA 2CIPA 1GKQA 3NOYA 4NT0A 5LKYA 3NQBA 4E2DA 1I9CB 5AC4A 1J10A 1P4CA 1CYGA 3R79A 3IJDA 3IIVA 1X6UA 3DERA 4G7EB 2R8WA 3V5FA 3R11A 2ZE3A 3UY7A 2E77A 3K1GA 4EF8A 3M0JA 1YE6A 2BXYA 3BC9A 3SZ8A 1F05A 3O63A 2OYKA 2C1IA 2VZVA 1B3YA 3R94A 5BZAA 1D3CA 3U48A 1DJYA 3DC8A 3PNZA 5TNVA 3S9IA 1KFCA 1YLVA 2G3FA 3O6YX 4AMAA 2VZUA 5H6HA 3HGOA 3APGA 3SN4A 4RJEA 1MW3A 4O1BA 1S2WA 1P0KA 4X22A 5K9CA 2WOQA 1Q7MA 3UWEA 5JBDA 1VIWA 1QWGA 1NDWA 2D73A 2ZXAA 4HPGA 4MHBA 3SQMA 4J9JA 1MZRA 1MEHA 1UQYA 1F7BA 4DZ5A 7PTDA 3AI0A 4MG4A 5IOBA 2BNJA 3CQHA 2B7PA 5JVLA 4NY2A 2ZA3A 5C9UA 2PC4A 3S8HA 3STGA 1TTIA 3GVWA 4UNKA 1IXPA 4AOPA 1JCJA 3ARZA 4MY1A 3XINA 4BCEA 4O19A 1ISWA 3VIGA 1Z41A 2P0IA 1SSGA 1M41A 4C6DA 1W9VA 2GQ8A 3GH5A 1C92A 2EG8A 3IANA 5EMLA 4QAIA 1TREA 2VCAA 3BLLA 4JN8A 1JCTA 4R3UA 1JQVA 1OYCA 5JXQA 3QPEA 3T9PA 1Q63A 5D2TA 3NDZA 2CWXA 2WNQA 1YDYA 3ZO9A 3VE7A 3MBFA 4DJEC 5I3IA 3CQ0A 5JU6A 2J8FA 1XLLA 3W28A 2ACSA 1PX3A 2PDYA 2V63A 2CC0A 1H1NA 5EMYA 4WD0A 4C6OA 1W3KA 3AIRA 5CJ5A 3N11A 5JH1A 2W62A 1OHLA 1ZBWA 5HMDA 1XYAA 3IJLA 1XYCA 2VDHA 1YBQB 3PAJA 4MIMA 3N3MA 3MA8A 5LIUX 4DEFA 4S3CA 4FLSA 4KFOA 1QNQA 3MM6A 1GOQA 2D2OA 1ZRQA 4XSMA 4DBEA 1UD2A 4F0KA 3GK0A 3HB9A 1WAUA 2QCNA 4LYPA 3F5KA 1EWDA 3GRIA 4I8DA 4R34A 1EXBA 3GHRA 4Y9AA 1D3GA 3VD5A 1S39A 4IPPA 2H8ZA 3L21A 3TQPA 3GM8A 1O60A 3PJXA 3EOEA 4GH3A 1W9UA 2XH4A 4Y8FA 1U1JA 1ZB5A 2VL4A 1LG2A 3AU2A 2F61A 1TKKA 2JQXA 1XLKA 1JNEA 4JFUA 2QVHA 1W3HA 1B31A 3EPNA 2NXGA 1IEWA 5HWJA 1V3IA 2YR1A 1GYNA 2HK1A 3QLDA 2ZDRA 1QU4A 3QPYA 1ITQA 2DZVA 2PS2A 1DL3A 3WLNA 2QCLA 2PWEA 3P61A 1SO5A 5E70A 1M01A 3PBVA 3H2EA 2WZEA 3NQ7A 2OSWA 5A6AA 1F5ZA 4AZCA 3AIQA 3GXNA 1KA9F 4KRZA 4X0NA 1QNRA 4UR9A 1GG1A 1TV7A 2GJXA 1AA1B 1XIHA 1V8EA 4ZSUA 1V3LA 3U4FA 5A8MA 3IARA 3D3AA 1RV8A 3TKFA 2Z1KA 4GCXA 1E0XA 2ZC8A 3T8LA 3TDFA 1CI1A 5HINA 3OR1A 3C5QA 5K4ZA 1MQRA 3VIIA 1ADOA 1C91A 3T05A 3ZT7A 1OJXA 3UVAA 3B8VA 3NQMA 4I9TA 1JULA 4DJEA 3PPFA 4C6JA 3KZPA 2GWGA 4B92A 2J13A 4O18A 4JYEA 1GG0A 4AUBA 3JR2A 3W7NA 5FACA 2BTMA 1FWTA 4G1KA 4AH7A 2BVTA 2PDCA 1VFTA 1EZWA 3G3DA 1SW3A 2PDNA 3W7PA 3GU2A 3WDJA 2TODA 1VHCA 3L67A 2OKTA 4UWMA 3DCPA 4Q4SA 4GZEA 5AECA 5D4YA 1VP5A 4FI4A 4HU8A 4LAZA 3DFNA 4D1IA 4O54A 1HP5A 4F8XA 3OHMB 3UQNA 3URBA 3LXBA 3FOKA 2WQPA 3SIZA 4A6GA 4M5PA 1EEXA 4EVZA 4F2UA 3TR2A 5HR7A 3IRDA 2VR4A 4B5XA 3FYOA 4Q4RA 4MADA 3JZEA 4BQ3A 4H2HA 2YDRA 3C0QA 1U1UA 4B15A 1R3SA 3LS9A 1V6TA 3PNUA 4GACA 4FIQA 1ESWA 4GI8A 3S1WA 3T2QA 3C8NA 2QYGA 3N6QA 4F2TA 2GGIA 4HVXA 4AD5A 1F2JA 1PS9A 4M1RA 2ODOA 3E02A 4LUJA 5HJLA 3FHAA 4NI8A 1GEHA 1XHGA 2XUCA 3PBMA 4A3QA 2NSOA 1BYAA 5CPOA 5ABEA 4DXXA 3L65A 5I03A 3R2GA 2GOKA 5D02A 1VYPX 1K8ZA 1UP0A 4QTGA 1DEDA 4LYQA 3DI1A 4NUWA 1YKWA 1R30A 3TTYA 3LTYA 3MMAB 1L6SA 1JCYA 1OZMA 2XTKA 5GNXA 3V0UA 3W1PA 3WQGA 4FPSA 4G7EA 1M7OA 3PR2A 7GEPA 1YTEA 1A47A 1AK5A 3AZTA 2A7NA 2UY4A 2ZZ4A 3CZEA 1GJWA 3GIYA 3JVAA 4JICA 5C2XA 2IW0A 4QLJA 1LROA 3WDHA 1DXEA 2RH9A 1A5NC 2PCEA 3E2QA 3SY5A 1J0IA 3MU7A 3APYA 5H8PA 3UZZA 3W2LA 4GPNA 2G5WA 3SCSA 1NWSA 4Z1BA 1Q45A 3WD4A 2BVWA 3O7UA 3TW7A 3GSMA 5G5IA 5BOFA 1E5NA 3A5FA 4IFRA 1VBHA 4GXMA 2DT2A 2QEZA 3UA3A 3TR9A 2W92A 1RBLA 3RX4A 5D09A 4PODA 1KO0A 2A7PA 1X7IA 3B8WA 3MI2A 1SZFA 1QHOA 5EYWA 5TF0A 1YTKA 3L4ZA 3W84A 2ZVIA 1FP9A 1TIWA 1TVPA 3LZ5A 2A5HA 3QC3A 3TSMA 2WJEA 4BWLA 2HXTA 2QJGA 3KOFA 3AYSA 2J66A 4EP8C 1J11A 1D2KA 4GVFA 1JF6A 2I1OA 5L9FA 3UGRA 3LENA 4IICA 4XZIA 1GWJA 1OFQA 2HPMA 4Q7BA 1VF8A 1A4LA 3KDOA 5KETA 3NPVA 1TUXA 4NF7A 1HZYA 4UR7A 2DJLA 4L9ZA 1TTJA 1DJQA 1GYLA 3FJLA 4R88A 4XQ6A 3VOIA 1BWLA 4XUYA 3QQ1A 3WQOA 3A3WA 4N9CA 5FEZA 2CLPA 3ANVA 1Q8AA 5FF4A 3IUDA 4XAYA 3KP0A 1ME8A 2DZBA 5DT7A 3AHXA 4HJFA 3AAMA 3E1F1 1AH4A 4GZJA 4HZ8A 3HG5A 4IFKB 2PGRA 1SMDA 5I24A 4ZE5A 1T5AA 2Y85A 1ODZA 3VIMA 5TBOA 1EO5A 5D38A 4XBJA 2CLIA 4CD6A 2OWWA 1EX5A 1OK4A 3F4DA 4MJZA 2OWCA 3D6NA 1YBQA 2I7GA 1XRVA 1PYFA 4D6JA 3CHEA 1JFHA 4KGJA 1NOUA 1XIMA 2R1MA 3G0UA 1DORA 1E51A 1N8FA 2YA1A 4ZE4A 4R53A 3L66A 2XPKA 1XYFA 1D7FA 4RXGA 2WAGA 2RJGA 1SUXA 3UCQA 2KAUC 2ZZ1A 5ECUA 3VM5A 1V93A 1H51A 5A1AA 4PC8A 4HSOA 2VYOA 4A3YA 2GGHA 5AC7A 2YL6A 3PUDA 2GGJA 2JE8A 4XO6A 3N4FA 4PGLA 1V3MA 4H83A 3GC2A 4GHRA 4GJJA 5F4SA 1UQZA 4Q8QA 4GZIA 3CMFA 3G18A 1A3XA 1MMFA 5RUBA 2FFCA 4UTFA 2GSJA 2DT1A 1I6NA 4A8NA 1XF0A 1UKTA 4GXWA 1WYIA 4H9YA 2QDDA 3PTDA 5A3HA 2W9MA 2OPJA 3MKCA 3ZVHA 3EWCA 3S5NA 1O5KA 1I60A 3SRDA 1JYWA 3UEQA 4BQ2A 3RN6A 2J7DA 3TW9A 1ZALA 1GKRA 1SM9A 4H9XA 3KZSA 3CB8A 1PO9A 4Q7IA 3W1UA 4PB5A 4AMCA 2BDQA 2XIMA 4YJ5A 3V36A 3U6WA 2JK2A 4PRRA 1V7AA 1OY0A 4CVWA 3DN5A 2EPMX 2VCCA 5FI8A 4JCLA 2VZTA 1IZCA 4MNMA 4US5D 5FOOA 1G01A 2J7HA 4UQEA 4MPKA 1TA3B 1PE1A 2DVXA 5M5DA 3LTPA 1LJYA 3SFWA 1KFJA 1XXXA 4UFHA 4IHCA 5BMXA 4M56A 3MY9A 4PMQA 1K7XA 1PWLA 2J27A 3HGJA 3S9ZA 1NP0A 3TV8A 2VC7A 1UD5A 5DY3A 4N9BA 2VT0A 4D6FA 5GEPA 2A6LA 3UP8A 1GVSA 5ABTA 3MZ2A 2CU0A 4KBXA 3FA5A 4J3UA 2ZA2A 1ITCA 1KFWA 3AIEA 4C90A 2QIWA 1JDFA 5F7UA 1FXPA 1GHRA 3QR0A 4A3RA 1R3QA 1T8XA 4JR5A 3DC0A 2ACUA 1KM5A 1DE5A 1MUWA 2VZSA 3F4CA 2GUUA 1XRSA 2G96A 4CU8A 4CNPA 4MWAC 2OQHA 1AL7A 2UZ9A 3CHCA 4HTBA 2E28A 5EBUA 3CHVA 2G0WA 4A21A 2IQ0A 5I06A 4UQBA 3OVQA 2OKOA 2O7SA 1CDGA 3P60A 3WK1A 4F2BA 3D0CA 4OOUA 4H7CA 4IXHA 4GUHA 1ECQA 1OYAA 4GIYA 3CO8A 3WDIA 1DOSA 1VLIA 1VPYA 1QI5A 3L23A 2WMGA 3TQVA 3SN0A 4LFYA 5EY5A 4F0MA 4N4PA 3MMAA 1UR3M 1NWUA 2OQLA 3ABSA 3LU2A 2POZA 4KKXA 2E5CA 3SQSA 5CZKA 3HGRA 1I45A 3E0WA 3EKGA 1XIEA 4O15A 7CGTA 3L68A 1EJVC 4UUIA 4H8NA 1E4NA 1D9EA 4ZZ9A 2P88A 3UFYA 3AHTA 1HNYA 1MZHA 3EDEA 4NSBA 3W82A 5IBXA 4JTUA 4IJBA 3L12A 2VX4A 1WDWA 3MCOA 6XIMA 3P3BA 1MRQA 4NZ3A 3VMPA 1H49A 1A0DA 4M6UA 4UQ9A 2C18A 4HB7A 1XRFA 3RUBL 3DKLA 3G1VA 3VGGA 3E2RA 5FCZA 3I4EA 3B9AA 1KM6A 3ARSA 4IUOA 2ACRA 3DFOA 4AHPA 1OB0A 4HPHA 3C0SA 4DZHA 1F61A 1WX0A 3GNOA 5AHIA 2WKGA 5D9PA 5FEXA 1SVDA 3AYTA 4WJXA 3KTCA 1WKEA 2Y0FA 1KLYA 1QI2A 3DZ1A 3HPZA 1X8FA 3M0ZA 3RGTA 4P7QA 2HEJA 3CV7A 3TP4A 2EXOA 4ZB5A 1Y0EA 4MWAA 3TJXA 4B3ZA 4IFOA 1IGSA 2YCLA 2E9MA 4O1FA 4QJ1A 3UJFA 4KCTA 3BG9A 1MUCA 4NZ5A 3TZFA 3R1ZA 2W4XA 4ZB2A 3W27A 3GZAA 2DIEA 1KXTA 4M81A 3M5ZA 3T81A 3RAOA 3W1XA 1R9ZA 2Y70A 1XQLA 1FKWA 3W22A 4B9ZA 4P7NA 2WPGA 3IIZA 2OELA 4IFKA 1CB7B 1NTHA 1E1EA 4F9JA 5JMUA 4XVDA 1RBAA 2D2JA 5FF0A 3BOLA 1O5RA 4QDPA 3TXVA 1JUEA 3LOTA 4ALDA 2ASHA 4RE2A 4DIAA 2AL1A 2J25A 1AQ0A 4BY3A 1IXQA 2E6YA 5LA1A 1YW1A 2IUZA 3DGRA 2WMHA 2Q09A 4JYDA 1L2UA 1NY1A 5I3JA 2V5JA 2XFYA 4DQWA 6XIAA 3MC5A 1R85A 4Q8WA 3MYPA 2PPGA 1ML1A 1XIGA 1W1YA 1NWRA 3RM4A 4E8CA 3VKCA 3QYQA 4DELA 1EF3A 1UWQA 3NJ3A 4QXIA 4UTMA 5U7SA 1GYMA 5BOOA 4X63A 1X96A 3GXPA 1ELSA 3N73A 1GVIA 5CG0A 2G50A 4YXGA 4H3DA 4Q22A 3MUCA 2D2GA 2PB1A 4AEFA 2X1IA 4Y96A 2ZBTA 3ZT5A 2F84A 1ADDA 3TU9A 5CAKA 4FOJA 1O95A 3K5XA 3VAVA 3IJQA 3NXLA 1LL7A 3BCJA 1MFVA 3ABOA 5LNSA 3I7QA 3GXFA 2ZCGA 1HQTA 2XFRA 1X6LA 2X8RA 3FGCB 5ECVA 3VILA 2WSYA 1JG9A 4EXQA 1NDVA 3M0LA 4ZXOA 1W9PA 4D1JA 5KSWA 3GU9A 3L4TA 4RZ5A 2PGEA 1TPEA 1AQFA 5TIMA 3BSMA 1DPMA 1NU5A 1V6VA 4AYGA 4JAWA 1TR9A 4IIFA 2XVGA 3N6JA 1FHDA 1F4AA 4WLCA 2KZHA 3VDBA 1ME7A 3W7CA 1NDYA 1XSJA 1J0YA 4JDYA 4L4OA 4D6DA 3H2CA 4PTXA 2VOMA 5BYWA 2CLHA 4DLMA 5LHFA 1L6FA 3DAQA 1EQPA 1XCFA 3QZ6A 1YX1A 4KIEA 1TA3A 1EJRC 3EEGA 3QJAA 3DENA 1JZ4A 1JRCA 2HDJA 1BYCA 3ZSSA 1BVZA 3ITOA 4INFA 2OX1A 1RVGA 2Z24A 4BZYA 4LC8A 8A3HA 1V7YA 3AMCA 3W00A 3GWQA 1EP3A 4LGXA 1G4TA 1WXJA 4JQAA 3IJ8A 3B0JA 2EKGA 1FDZA 3EOUA 3MSRA 4GI4A 4WKHA 5LZLA 2R6OA 2Z29A 3AXMA 1HJWA 4YNGA 2WLZA 4A3HA 4IT1A 2PE4A 2F6XA 1M03A 3A23A 1IT8A 3VIHA 2PP1A 1L6YA 1KGXA 4FOKA 4O0ZA 1ISYA 1XD0A 3VLYA 2C13A 1J6OA 4RK8A 4GJIA 1OGSA 1QW8A 3J7HA 1WBJA 4B2DA 1I75A 3AXIA 2Z2AA 3MHUA 3LX9A 2QR6A 3MO4A 2QAFA 2IMRA 3WQ6A 2X42A 3U2ZA 4QHRA 1V79A 1K7EA 3G1YA 4AW7A 4ADSA 3ME3A 1MQQA 1XR2A 1TB3A 2PRHA 1HVQA 2VJXA 3R89A 4R9XA 2OEMA 1UIPA 3FFSA 3U5UA 2DH2A 3HU7A 1E6QM 4ML4A 2RHGA 1F4HA 1ZAIA 2A21A 3GVVA 4QJ3B 5G4EA 4IJRA 1TCMA 1Z42A 3MB9A 4HZMA 5DLCA 1S5VA 1F76A 2Q3RA 3NQ6A 4ZO6A 4F48A 2E0PA 3AMGA 1T99A 2WC7A 4V1XA 1R9YA 3C56A 3RCYA 1Q65A 3KDNA 5BWFA 1YE4A 4MKVA 2GDQA 3WELA 1PZ0A 3A4JA 4NILA 1VD6A 2Y6ZA 1B4KA 5DN1A 3LRMA 4W9TA 3NPWA 1DJXA 1ZBVA 3S5YA 3WBWA 3WD2A 3TZNA 3ALGA 1XPYA 3ATYA 3RPDA 1WPCA 4NYUA 5MKGB 6CGTA 2EBNA 3T55A 1F8MA 1H09A 3W53A 2OCZA 1A5AA 1TG7A 1H7XA 3XISA 2ZZ5A 3AXXA 4AXKA 3M0VA 4A8IA 1CGWA 1XIBA 2OGJA 1XLDA 2IQDA 3NSMA 4EKJA 2C16A 4NL1A 1PKMA 5GNYA 3TW6A 4JDBA 2O55A 3LHUA 3AS1A 1W1IE 5AY7A 2CNCA 1PBGA 2WZMA 3CWNA 1I0BA 3AJ7A 3G6LA 4LH8A 5ABFB 2VX6A 2VRJA 1T7LA 3MBDA 1G5AA 3PUOA 1A5SA 2QUUA 2P1FA 2F8QA 4C6CA 5F2MA 1H1ZA 4HNCA 4OU1A 2DZTA 3TA6A 2GEPA 2VWSA 2GK1B 5A6LA 3NPUA 1IIHA 4LAOA 1DJHA 4GYKA 2DIKA 1H63A 2CBUA 1SU5A 3GH7A 2ZUUA 1SO6A 3GW3A 2BZNA 3RG6A 4DUVA 5LGZA 1NH6A 1DJWA 2GFTA 3TQKA 3S2NA 4KWVA 4GFIA 4AC7C 4IMDA 4UFMA 1NQKA 1R38A 5GQBA 3LGGA 3NYDA 4LYRA 3RMEA 1TMQA 1QOPA 3RPMA 3TC6A 3QYSA 3GEOA 2VQUA 1TJPA 1FFRA 1DE6A 3HGSA 1SPQA 3OBKA 4Q8NA 2VX7A 3QY6A 1FCBA 1IWPA 2PWUA 3BLPX 4RNHA 1VH7A 1CXEA 3TN4A 1VRXA 3OA5A 3W6YA 1G4PA 1QBAA 4HSHA 4Z2GA 4JFVA 4S23A 1G7UA 5IDZA 3RX2A 4DO7A 3GNRA 4F0HA 4MGGA 1A3HA 3LV6A 3N4EA 4CNSA 3VX0A 3BTNA 1RH9A 1VLWA 1LWHA 1W1PA 1TJ1A 5A94A 2XIIA 1WP6A 4AIOA 3NM3A 4AEEA 1KXVA 1H0IA 3IVUA 4LWWA 3NZRA 3LBOA 1FH8A 4RW3A 3GDRA 1VEPA 2BHZA 2E6FA 3O9NA 3EA1A 2VMFA 4RR4A 5K7JA 3N2CA 4ZGYA 3GUGA 1A0CA 3MM9B 3A12A 4EACA 4B5UA 3BV7A 1HW6A 3PTMA 5D03A 4YCPA 4W93A 1O94A 5E09A 1EPXA 2O0TA 3BXWA 4V27A 1JYNA 3ITCA 4S3JA 3E0VA 1C8VA 1B3ZA 4MUZA 5A2CA 1UD8A 4NAEB 3WLQA 4PTVA 4DWSD 3AYVA 1TQJA 4Q4OA 1K02A 2J62A 2BXZA 5XINA 1HO1A 3M6YA 5D2VA 1A53A 3W2NA 4H8UA 2YKKA 3PG9A 2OG9A 3TUUA 3I65A 2MANA 2A3EA 2ZE0A 2YDAA 1HO4A 2TYSA 1V0KA 4E2VA 4DY1A 1JCNA 3TYEA 4DXVA 4YHGA 1GGOA 1XIIA 3WF4A 3L2MA 4HHHA 4UR8A 3LCFA 3QV7A 3VYLA 4G7FA 1UP2A 4IPJA 4FF5A 3VKDA 4IIEA 2FVKA 4QRNA 2QCGA 5FF7A 4M24A 1DWGM 3BGGA 1D8CA 1R7AA 4S39A 2ZKMX 4HHPA 1VJSA 1VPXA 2ZXQA 1GJUA 3G1FA 2W61A 4S3EA 1WE5A 2PTWA 4R7JA 2BFGA 5BU9A 4UOJA 4OFCA 2PWGA 2VR5A 2V2HA 1GPWA 1EP1A 3MP5A 1HFBA 3MUZ1 3R8HA 3NQGA 4DUXA 1ZGDA 5AN7A 1W1ZA 2C8NA 4LVAA 4M3PA 1XDMA 3GTNA 3MO7A 4OECA 2E6AA 3BJFA 3BLFA 1W5PA 1CWYA 5G2IA 3TN5A 4OIFA 4Q4KA 3IIOA 5EB8A 2CERA 3L9CA 2DUXA 3SCQA 3NQVA 2CZ5A 2PP0A 2WBKA 1OIFA 3F7JA 4Q33A 3RCMA 4DLFA 2J77A 1XGDA 2BMBA 3KWXA 3G2GA 5DANA 4EE9A 3B9EA 3SCTA 4W7WA 1AJ0A 2VWTA 2IKHA 1RA5A 4AD0A 3N9SA 3QZAA 3WIJA 5F2LA 2PLCA 3VOJA 3PTQA 4U3AA 4BR1A 2FIQA 3P0WA 4H9VA 1CXLA 4GD0A 3MDWA 3CAQA 4I6VA 1C8YA 1LT7A 9CGTA 3NZPA 4REQA 3VNLA 4NAFB 3ZWTA 3UPMA 4QE4A 3VNJA 5FJJA 1BYBA 3G3MA 4PCSA 3PBWA 4B5SA 3GNXA 4WKFA 3H24A 3H4WA 1UR9A 3EOLA 2XSAA 5C54A 4QX4A 1YYAA 2WLYA 1V08A 2A3BA 3VNKA 2FVMA 1UH2A 2PZ0A 2VC9A 1H7OA 2QPXA 5MKGA 4IZGA 1LUCA 5DBTA 1KTBA 4DJDC 3OB8A 2HQAA 3CMJA 2BXVA 4FNUA 1XCWA 3B0NA 2ZUNA 3EOOA 2VFIA 2D3NA 1FWNA 2UY3A 1C8XA 3R13A 3U2CA 1DQUA 3UESA 1NELA 3LPFA 4G56A 3T0BA 3TYUA 2PTXA 1Z7AA 5ABFA 5T9CE 1EC9A 1OCQA 3TK7A 1SR9A 1XBXA 4JBRA 4GQ0A 1EZ2A 5EPDA 7XIMA 2QT3A 2V4JA 1L8NA 3S4TA 2GK1A 1UZ1A 1OM0A 4NJJA 5E0FA 5G2HA 3AS2A 2D0HA 3HFYA 5FSEC 4D72A 4O8AA 4HNLA 3AJXA 1AG1O 5LNRA 1HL9A 3W7JA 5B7YA 5K2ZA 1TV5A 3P5ZA 2ZC1A 1R3TA 1V6XA 4D9PA 1US0A 2Z7KA 1GOOA 2V81A 1FKXA 1GONA 1QI3A 5FEWA 3MSDA 1Y5VA 1JPDX 2V6AA 1E1CB 2GJPA 1E55A 4CCDA 2XVKA 4AHQA 3BGJA 4YHEA 5FESA 3RFAA 2EJAA 3DIPA 2VDIA 2ICSA 1POJA 3H55A 5CLTA 2PRLA 6TAAA 1E72M 4HOWA 5KZDA 2RGLA 5KITA 2Y7FA 4LPCA 1UA3A 5A2AA 4E5TA 3NXFA 1K4HA 2G4JA 2ZRZA 3SUVA 1TPC1 1KRAC 4M8UA 1E70M 1KCXA 4K7YA 1ZAHA 3LNPA 4GFSA 2JKPA 1UZHA 2W5FA 5KZEA 4AG0A 4PCNA 3TWBA 5HK4A 3EMQA 4JEQA 4U3CA 1AW5A 1VBGA 3FK4A 4TMBA 3OHIA 3WL0A 2HRWA 4L5ZA 3HF3A 1BF6A 1JUBA 3B0UX 1EP2A 1KKOA 3MMCA 3OO2A 2YSWA 2A3AA 4AY7A 3W1NA 3A21A 4Q8UA 3T7VA 4W85A 1LOQA 4PMDA 4RX0A 3BANA 1AMKA 3LLXA 1PYMA 4YTQA 5CQ1A 4KT2A 1MEWA 1F74A 2WBGA 3E9AA 3S5ZA 1WDQA 3RLHA 3PZIA 3ITXA 3W7HA 3AICA 3S5SA 1L2QA 1GUVA 3GB6A 3MI3A 4A8RA 3H2AA 1HTIA 2RDXA 3UR2A 4XG1A 3UXIA 4KCWA 3W2MA 3UA4A 2Q8ZA 1VYRA 3GNDA 1W91A 4LV4A 1VHNA 3VKBA 3M5VA 8RUCA 3FN9A 5HOSA 4MYXA 1CXKA 1LRQA 3MJYA 1BF2A 3T2PA 3M41A 1HX0A 4PMRA 4UMAA 1LM1A 1TV8A 3PBYA 1IEXA 3VX1A 1LG1A 2JKEA 3MHGA 2V38A 1WZKA 3W7GA 2DT3A 3VINA 3AHVA 1P5BA 4US5A 1XUZA 3ZS4A 4MY9A 1XBYA 3VKSA 3HPSA 3AQUA 2TAAA 2E5BA 2WKJA 4NVTA 3CZKA 5LXXA 3T42A 1Q6EA 4QM1A 1CXFA 1EGMA 2GWNA 2J7BA 4OTKA 3SUWA 1S3TC 1BXCA 4JHOA 4WXZA 1V0MA 1H2JA 4CQAA 4A4AA 2Y5SA 4WR3A 4XUGA 2Y4SA 3MM7A 3KVJA 2MNRA 1UMLA 5EBAA 3P0XA 2DVUA 4AF0A 4LW7A 4F9DA 3TE9A 2RGMA 5CJNA 1KWGA 1J6PA 1RHCA 3LTSA 3W2KA 2C71A 3RU8X 4GC3A 3RF9A 3SCWA 4DYJA 4UFJA 1YHTA 2G3NA 1P48A 3ZVIA 3GQYA 7ENLA 4DF1A 1SFJA 1YNQA 4IPLA 1OT1A 2VVNA 1YPXA 1JZ7A 3BQ5A 3HMCA 2WM0A 1HG3A 3VNMA 4D8ZA 4LXFA 3T40A 1EJSC 1PAMA 1FY6A 4JTTA 5AYXA 3VD3A 4DYKA 3EA2A 1MFUA 5BRQA 1NQ6A 1M04A 1TZZA 3LLDA 4QCEA 5DFAA 2I5IA 4CCZA 3UJRA 5I3FA 2JIWA 3ARWA 1E9LA 3O0KA 4XX6A 4IIBA 1XLIA 2D3LA 1UWSA 5H1WA 4NYYA 4NAFA 3KRUA 3GKFA 4C6QA 6TIMA 4LBSA 1F07A 3KCLA 4MB5A 5D8WA 2DP3A 2QIIA 2YB4A 2CHNA 3CYVA 2FB3A 3TONA 1A50A 3CGTA 4F40A 5FJUA 3WL1A 2YYTA 4WJ8A 2ATMA 3TN6A 2VI0A 1HUVA 3PWGA 3VD4A 5G4WA 1UC4A 2WMKA 3DGBA 3NDOA 3WK0A 3WF1A 2I17A 2FDMA 3RDKA 3WENA 3NZ1A 1HGYA 3OR2A 4BI5A 3SECA 2VD8A 4LRTA 4Q8OA 3IS4A 1ISVA 1B57A 7TIMA 1BGGA 2Y1HA 2YX0A 3KEHA 4JIEA 4QP0A 3Q67A 2Q8LA 2F38A 3PSVA 4I9MA 2ZZ2A 3TOYA 5CPLA 4JFTA 2W27A 4B3KA 3EMZA 3NAVA 3QY7A 1U22A 1R3VA 4K38A 3SUUA 1SYTA 3S47A 2HV5A 1B3WA 2C7FA 6PTDA 4PUUA 3WDRA 2WQDA 4GIAA 1XFBA 1KFEA 3GVGA 4TX9A 4BJHA 1QK2A 4C7DA 2HS6A 2XGBA 1KCLA 4HKPA 3VABA 2BOFX 3S5OA 4JHZA 4D2JA 3POCA 3WF0A 2BV9A 5EMJA 2ZX6A 1OFDA 2UBPC 1L6GA 2HMCA 1FH9A 4N0RA 5AC6A 3VU2A 2PDJA 2E7FA 2JF6A 1O68A 1UOKA 2E40A 4HPXA 3BH4A 3B0PA 3TSBA 2QUNA 1UMYA 2OGYA 5I3HA 1MXSA 3AU6A 2Y7EA 4JY9A 4PUDA 3IEBA 3WCZA 5KZMA 1Z48A 3D3FA 3U0HA 4KWWA 1R9XA 5D2XA 5CAHA 3WDPP 1UR1A 2CITA 1OC6A 4QR6A 1Q2RA 3GVRA 4HYWA 4GQQA 3LHTA 1V6WA 3I7RA 4FLRA 4H6RA 3MTWA 4MDPA 3K8KA 2J8GA 4OOZA 2CLKA 1F6YA 3CAWA 2AAMA 2X1RA 2PA6A 1V6YA 3W85A 5I07A 4QGCA 3UXKA 3V18A 5CBJA 3GHSA 4G9PA 3W7EA 5I78A 4L6HA 3PWIA 4XD4A 4Q4PA 1QPQA 1QMLA 2C0HA 4QDWA 1CLKA 1B9ZA 1PB0A 1YPIA 4O1CA 3GBDA 3FEMA 2W66A 3E49A 4KRTA 3ARQA 3EPMA 2VXNA 3K30A 5KEZA 3MP4A 2BBFA 3VIKA 2AQVA 3QR3A 1TPDA 3HV8A 2PSNA 1UWRA 4LJ3A 4G6CA 3WK3A 3EAUA 4YTRA 5CKSA 4IMFA 1KV5A 3CK5A 4PSRA 4XWUA 3PULA 4ZXLA 4S38A 4EX4A 4FS9A 3W01A 2XSXA 1LQAA 1QASA 4KF1A 3V1PA 1LTDA 3BLDA 2INEA 5D30A 4XZWA 3H12A 2G3JA 4H00A 3VDCA 3SB0A 3VOCA 5T91A 5B7ZA 3W3OA 3MYOA 2BASA 2QUTA 4DWSB 1JI2A 3AALA 3M46A 3KE0A 1VCGA 1GZ1A 3WY1A 3QHOA 4CN6A 3ABXA 3CTTA 5D33A 4R9OA 5D9OA 3K8LA 3JRKA 3W86A 5D37A 1I1XA 4OUIA 3SY8A 2DQXA 1P0EA 1ZJAA 5MF5A 4M6PA 5J8LA 1W54A 3KM8A 1VCFA 1D8WA 3KVLA 4WGXA 1VPQA 1EJTC 4TIMA 2CKSA 1XLEA 1W3LA 2DUAA 3I3BA 1ZP3A 4XZHA 3DFQA 1NOWA 3MUAA 2BLEA 1AJZA 3WBEA 3AUOA 4LS0A 5I7GA 3AWNA 5IM51 4KERA 1CLVA 3F4NA 3ZLFA 4JTSA 4JKLA 4ZQCA 4GC4A 3THQA 3RJXA 2C1HA 1EIBA 4MOZA 3GXDA 2VC6A 1M68A 3CC1A 2G8ZA 5K9XA 1TX0A 3LA4A 3UXAA 1TZ7A 4PTDA 2UY5A 4Q6JA 3HBLA 1P7TB 1GEQA 1QVBA 4NX5A 2WK2A 1QOXA 4UBPC 4XAGA 3IIXA 1FWSA 1FFQA 1XS2A 1P43A 3V35A 1JD7A 2I57A 2IS7A 3OBAA 2IPGA 1F73A 2B4GA 2H3DA 3I6EA 4OV4A 3UPBA 3VFCA 3QVQA 4GWEA 4CNOA 3PB2A 4MYAA 3MUXA 4B5WA 4GO9A 4B9YA 4FXJA 1OQFA 3PZVA 3T4CA 4L9YA 2W79A 2FTWA 3PZMA 3WG6A 4BEUA 3RK8A 4Q6XA 1TZ9A 4F3HA 5CC6A 3BJSA 2ZFAA 1GVQA 1IZKA 2CLFA 3UBPC 4RZ4A 3LPGA 2F9RA 5AC5A 1O7AA 1JZ8A 1ICQA 2O9TA 1NIUA 2OSXA 3WQCA 1TJRA 1KBKA 3ARYA 4PE8A 3FKKA 5DRIA 1EOMA 4O4VA 2CLOA 4U5KA 4F4RA 3RHGA 4CQCA 1XV8A 3TJIA 1X1OA 3TSDA 4ZTYA 5C9WA 3OLIA 1WB0A 1UR8A 1E4IA 3B03A 1XLBA 2YW4A 5CSYA 2DW6A 2QKFA 3VCCA 3G24A 3BLOA 5C5YA 3S2MA 3OIHA 3ANYA 4RV8A 1HKKA 4ZR8A 1H3GA 5IFPA 2ZZ6A 3C2EA 4MNJA 4FLQA 1I1WA 1W32A 1P0DA 3G8RA 4I7WA 5LYRA 4LCRA 4A35A 4HA0A 3VNYA 2OT0A 1PUDA 3WQEA 4DO5A 1HVXA 2A3CA 2JBMA 1FX6A 1TIMA 4HMEA 2PU0A 2GGEA 5A5WA 4F66A 3F2DA 3XIMA 1KBIA 2X40A 1PIGA 3LM7A 4LC6A 1Q6GA 3QN3A 1FCQA 1XIDA 2DY3A 3WO8A 1XYZA 4IMCA 1CECA 1QWKA 2OLAA 3C2VA 3M4HA 4TTUA 1Q66A 2OEKA 3G1HA 3LCLA 1LRTA 4RCXA 2XM1A 2CESA 1LLWA 1W1B1 3CASA 4O17A 1US3A 3WJYA 4WDTA 3FA3A 1L9WA 3VZZA 1ZBCA 1K8YA 4IISA 2J9ZA 4C5ZA 3CUXA 2V5BA 2PGWA 1Q6CA 3QMTA 2DZPA 1US2A 3OQEA 4ICNA 4PN2A 1KB3A 4QQ3A 2VUYA 3R0KA 1QW9A 1OG6A 2PDWA 1Z3NA 4BF7A 3SSJA 2IPWA 5HNNA 1OWQA 1W3NA 1CXIA 3TMQA 3PJUA 4QE1A 2XYLA 2FLIA 3ABZA 1S5WA 4LSBA 4JIRA 4HNTA 3OLGA 4GYPC 4CNTA 2PWVA 5HUPA 3MWCA 3P82A 1VS1A 5A8PA 4DBUA 3GW0A 5FKYA 1GVYA 3WQ4A 3VGEA 3LQLA 4QFUA 4GUGA 5E9XA 5FJPA 1FCUA 3CIVA 1K6AA 3HG3A 2R14A 4WKAA 3USZA 3L4VA 4FLOA 4K8HA 3U4AA 4M19A 1HL2A 3C6CA 4JTEA 5CCZA 3C61A 4CD8A 3R8RA 3CUFA 3G1DA 3WLMA 4ZQOA 4RDWA 1HP4A 1JPHA 1VCVA 2A0NA 3W23A 3WNMA 3TN3A 1M53A 1E6SM 1ZZMA 2PTZA 3FW6A 1N2VA 3VGFA 3A64A 4F0RA 4Z1AA 1R86A 2OZTA 1TE1A 5KZ6A 1UBSA 1TTQA 3ABRA 4Z0SA 2PDIA 1S5NA 1QDSA 3O0FA 1UZ4A 3VPLA 1AL8A 3EPOA 3GR7A 4FNTA 3BARA 4MAZA 4K1WA 5HA7A 4HOXA 5C71A 3U9IA 2PDUA 1VENA 3GS6A 4LVFA 3DFTA 3PZNA 1NFPA 5D2YA 4JYFA 3WUBA 2HE8A 2GJXB 3GHTA 4V2XA 4AD3A 4OV9A 2GVJA 3IV8A 4GISA 1JZ3A 2OZ0A 1RR2A 3LGDA 3AOPA 4DJFD 2XVLA 4W7VA 5BMWA 4Z2KA 4DWSA 3PFRA 1UC5A 3EEZA 3LSCA 5CH9A 1TYGA 4Y6GA 2X7VA 2JEQA 2YBTA 1E3XA 1FWDC 4JQ1A 5CLWA 3BZJA 2GZXA 3NPXA 3H4GA 3ABQA 5CC3A 2R24A 3GZ3A 3E0IA 3M7WA 3P2VA 4MWAE 3S1XA 1XISA 2YL5A 2CZFA 1Y5WA 3QGVA 2XIQA 2BHYA 5DMYA 3PANA 3VXGA 3URAA 4O57A 1EIXA 4JN6A 1KM3A 1UKPA 5LIXX 2X1SA 4QROA 1G7VA 1S2CA 1G94A 2Z2UA 3LRKA 1XH1A 1ZBKA 5A8NA 1N7KA 1X39A 1W8SA 3BL3A 4DF2A 1KGWA 2FPYA 1K4GA 4GYPA 5HNUA 3DG7A 3N19B 5A6MA 3DKJA 1JDEA 2GVEA 4IG2A 1AD4A 4LALA 1ICPA 1EDGA 3BAXA 3PBGA 5BRBA 3G8EA 4ORMA 1J96A 4AZIA 2IXUA 1LL4A 3QFWA 2QVNA 3N12A 4MFDA 7A3HA 3RU6A 4TVDA 4KPLA 4H9UA 4DNHA 1K03A 4TQTA 1P7TA 3WZ0E 1EH9A 1EYWA 2E25A 4NNBA 2GJNA 4M51A 5AC8A 5C7HA 1FWFC 2HVMA 1XH2A 3N13A 3V7PA 5C0QA 3CV2A 1Q85A 4Y9NA 4N9DA 3KL0A 2PRMA 1FHLA 4HYVA 1E6XM 3O6DA 4WOZA 5G4HC 3BAJA 3LHWA 3P5YA 3QV9A 1W5NA 3PB0A 2QCDA 2ZYFA 4OKDA 5LA2A 5LIYX 2D22A 3W4RA 3T78A 1Y5XA 3C4UA 4K2SA 1SSDA 2I5QA 1GJPA 2DT0A 3LI1A 1M65A 1XDJA 2RJHA 5FJOA 4GGHA 3ARPA 2V69A 1BD0A 3RRAA 3GTHA 4Q8TA 3WD1A 3OOQA 3ARRA 4BQ4A 4GKLA 3RMJA 3TYZA 5CSSA 1ZJBA 1T40A 3FDGA 4OT7A 4JOMA 5EGRA 4DO4A 4KWOA 4IJCA 3VC5A 1JYXA 1TV2A 4JQ2A 3NQDA 4UTTC 3REQA 1PHQA 1WZAA 1S38A 4MM1A 4NXKA 3GYCA 1JUKA 2CCRA 3R0DA 3EX6A 1M7XA 1KQZA 2VEFA 3H7UA 3ISIX 3A13A 1N8IA 4RUBA 3QW3A 3HQOA 2DIJA 3CZJA 3LCHA 2WSKA 3P14A 1JQXA 5A8QA 3PBUA 3T2OA 4J3SA 3GDLA 3T0TA 3AMKA 3M5YA 4HPJA 4MKNA 2AQOA 1T8QA 4WXYA 1XGEA 4X60A 2QHAA 3DHDA 4AWTA 3A22A 3R58A 3ZR5A 3KRSA 3C3UA 1B90A 1J4EA 4LUIA 4GABA 2GQ9A 4UQCA 3LDVA 3WLOA 1UD3A 3WF2A 2Z1SA 1S2UA 4C6MA 4Z2LA 3DXIA 1Q4NX 1J18A 2YA0A 5HXMA 5CSRA 1AQMA 4C7GA 1XBVA 4QITA 3UWVA 3OP2A 3GAKA 5AYIA 3VO0A 4A2RA 4D8LA 2J8TA 3PVFA 5GJNA 4NJIA 3IGHX 4LUTB 3CAVA 3LHYA 2G95A 3KS5A 5EL1A 1O1ZA 1RD6A 2GUYA 4UQDA 5TD4A 3W1QA 2QCHA 1TVLA 1XKJA 3UETA 5BROA 2Q71A 3KAOA 1RVKA 1OGGA 4C6IA 1F6PA 3MKVA 1AW1A 1XG3A 3HMJG 3S9YA 1JF5A 2VFDA 3VIOA 4DAIA 5KTLA 3W1RA 3M9YA 2BY2A 4URIA 4LCQA 2WCGA 1C9DA 2AGKA 1HKWA 2PDFA 5GVJA 8XIAA 3M0MA 3PFMA 3BPWA 4ZODA 1JFXA 3FAWA 4DPPA 4L6OA 1OFPA 4GO8A 1E56A 1LOSA 2J78A 3ZLHA 5DRCA 1UUQA 3HPXA 1EJ7L 1NM9A 2XFWA 4QJ4B 3PS7A 4PEEA 4H4IA 1I2RA 4BI7A 2ZX8A 1A5UA 5H8MA 3SJNA 3MMUA 2J7GA 3M07A 3M5XA 1R87A 1V0LA 3WLHA 2ISWA 1LT8A 3VKRA 2PP3A 3ARXA 5EMUA 2NX3A 4FSAA 4HA4A 2Y61A 2NQZA 4L7ZA 1RQHA 1BKSA 3W07A 2F7FA 4JCMA 1YDNA 1A5LC 3HTWA 1RK5A 1PIIA 4PMNA 4FX7A 1RSCA 4NQ1A 5G1MA 1KBJA 4Z2HA 1OX6A 5HBFA 3ZVHB 3SN1A 4ERAA 4OVXA 4TV6A 3LPPA 4O1DA 1YPFA 1B54A 3K4AA 1DIDA 4AD1A 1BVNP 2J7EA 4AX7A 3T09A 1EFZA 1WDDA 1L6WA 2W63A 4QNWA 3WNOA 3OZMA 1H62A 2X0YA 3OVPA 2KX9A 3AROA 4E38A 1P1MA 2A7RA 2VKZG 5C8BB 2HE5A 3OA3A 5D8ZA 3DDMA 2FJKA 1DIEA 2QLYA 2I5GA 2BP1A 1TV3A 1JGIA 1TRIA 4IF2A 5A95A 1DJIA 3TC7A 1HKIA 3E6EA 3SBFA 2FHBA 1PHWA 1DWHM 4E2OA 2GL5A 5GJMA 5CG7A 3ZT6A 2J88A 3H2OA 2QJIA 4W87A 2EPHA 4PCPA 7REQB 1EWEA 3ZIZA 3TJLA 2ZUMA 3CWOX 4UFIA 5HMEA 3LEPA 1Z8AA 4BFAA 2VFHA 3AS3A 4JFSA 3AS0A 1Z69A 4ZFCA 4RE3A 3QC0A 3BWWA 4CQ8A 3L0GA 3WYZA 2H9AA 3GC4A 3UZJA 1H7WA 2DPEA 2I9UA 3BAYA 3N34A 3MSGA 3BK0A 4GY7A 3U2EA 2CHOA 1QI4A 2P5NA 3NGJA 2CPUA 4HBKA 2BGQA 1W1A1 3N25A 2QNEA 1K9TA 4ZENA 3KBWA 4HNUA 4MSSA 1VEOA 1TX2A 2EG7A 4ROQA 1EUNA 3AIUA 4IMEA 3UZWA 4IX2A 2OEJA 1IWBA 3W75A 2PLMA 3QV8A 3HPAA 3TTOA 3A9BA 4L65A 3R6IA 2E09A 3B9NA 3W88A 4QS5A 1E4MM 4JZ5A 3H6OA 4KCUA 4O4WA 3AIVA 1W8GA 2Y2WA 4IIHA 4LV9A 4L9XA 2BS9A 1VEMA 1ZU8A 1AW2A 2FB2A 3EGJA 3UXDA 4GIRA 1LQ2A 2ATSA 1TPWA 3PZQA 4XD5A 3E0FA 1TUFA 3P67A 4LF2A 4W5ZA 1V3JA 5JQ9A 2YYUA 3DECA 1SMAA 4IMAA 4MLJA 1FWHC 1OF8A 5BXPA 4IUGA 1F3XA 1SJCA 4AB4A 3SCOA 1Q7QA 3W7OA 3CUGA 4B5VA 2NVAA 4J27A 4Q3MA 3OVGA 3AUJA 2XIBA 1PCWA 3D47A 3SEPA 2XVNA 3BGAA 2VZOA 2VR2A 3G6MA 1LOLA 3NL2A 4JL1A 3L5MA 4OBRA 1R3YA 2FPTA 5T26A 3WH7A 3QW4B 4HCDA 2IQTA 5DT5A 3BV4A 3CZLA 3IGXA 3I3DA 4GQGA 4WDXA 4V15A 2FH8A 4BA0A 3P81A 1QR7A 2YXOA 4JL2A 2Q6ZA 4I90A 1QHPA 2CW6A 1ZJ8A 1PTAA 3U8GA 2P8CA 5J5RA 4IOTA 4N2YA 4GUIA 1K8CA 4GUFA 2OYMA 3RM9A 2QCFA 4GOAA 3URQA 1NJJA 3T4WA 3KOYA 1S2VA 1QHZA 1CTNA 3R8GA 1LL6A 1I2NA 2VGGA 3N2TA 4ATLA 3W2UA 4UTIA 3BLIA 1IEIA 1TPH1 4XZ9A 3IACA 1HIZA 1VBRA 4X61A 3DFSA 2YCIX 1RP9A 4MWAB 2A3LA 4XTIA 2HISA 2YCLB 1OABA 3S42A 3O6CA 3W26A 3VCNA 4Z1CA 1UCWA 4YTSA 4E4FA 3RPTA 3VM7A 1GQNA 4MNLA 3RRXA 4JQ4A 4J2MA 1JDAA 4NIRA 3WD3A 4KW2A 2ZDSA 1KM1A 2J7CA 1UH4A 2WVVA 3S0CA 4KGLA 1W9DM 2QUVA 1XQKA 1TE6A 2PC8A 3OVRA 2C0AA 3DESA 3T1GA 2ZRVA 4LUTA 4J3XA 1OVDA 4Y9PA 3NQ8A 1SFLA 4XZNX 4C6FA 2Y5EA 2ISFA 2JIEA 1SO3A 3W29A 1FWWA 1IGWA 2FHFA 5TQLA 2C6QA 5IXEA 3WMSA 5CZTA 1CXHA 1DIKA 3GTFA 1AFSA 2E67A 4R5EA 2QZRA 3WF3A 3DBPA 4DUOA 4AX6A 1GCYA 1S1PA 2F2HA 3IJ9A 5LGXA 2A79A 4ZEPA 1PIFA 3L4YA 3INPA 1R8LA 1MW1A 1KR1A 2X0HA 4C60A 4EANA 1KLZA 5M17A 3VA8A 1TRDA 3LCXA 3TYCA 4AVOA 2V68A 4MJ2A 5K9DA 2CBIA 5AB3A 4DJDD 4BF9A 3F5LA 1KKRA 1XFCA 1NWTA 3SUSA 3U3HA 2PTYA 3JUGA 3A4XA 1KBBA 3OQ8A 1UKOA 3KBMA 5BRPA 1LYXA 1EEPA 3MCMA 5CZSA 2ZRYA 3ITTA 2DFAA 4O14A 1T96A 4H8VA 1OIMA 4UZSA 1F9CA 4Q8MA 2YFNA 2F6UA 3R0UA 1WO2A 2OYLA 2REQA 1BKHA 1HGWA 3FHQA 1NAL1 3CM4A 4RPQA 1W1TA 2L5HA 1QK0A 1GZJA 1Q13A