4S3BA

Ispg in complex with intermediate ii
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
402
structure length
401
Chain Sequence
GMRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
total genus 135
structure length 401
sequence length 402
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s3bA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s3bA02
3VLXA 4C1NA 4S3EA 1TWSA 3MCMA 3H2FA 2V4JB 1AOPA 4S23A 2YCJA 2OGYA 4MWAB 4O1EA 2YCLB 3H22A 3OR2B 3TZNA 3MM8B 3H2NA 4D8AA 4DJFA 3H2AA 3VLZA 1Q85A 3MM7A 4D8ZA 3VKTA 3MM5B 2YCLA 4DAIA 5GEPA 6GEPA 3B0LA 1Q8JA 2H9AB 3AOPA 4DJDD 3H23A 3VKRA 3B0MA 3H21A 4G38A 4G39A 2H9AA 1Q7ZA 1TWWA 3TYBA 1EYEA 3H2MA 4C1NB 4HB7A 1TWZA 3MCOA 3MM5A 2V4JA 5JQ9A 4DJEA 3VKPA 5AOPA 2DZAA 3MM7B 4O1FA 7GEPA 3MM9A 4DJEC 3B0NA 2VP8A 3OR1A 1Q7MA 2VEGA 2Y5JA 1Q7QA 2YCKX 1F6YA 4MWAA 3OR1B 3VM1A 1AJ2A 4S3AA 4G9PA 3MMBB 3MCNA 3MM9B 3VKSA 4S3CA 3H2CA 4DAFA 3MMAA 3TYDA 3H2EA 4DJDC 3B0JA 3MMAB 3TZFA 3MMBA 1AJ0A 1ZJ9A 3GEOA 3H26A 4S39A 4O0QA 3VM0A 4S3DA 3VLYA 4NL1A 2BMBA 2XSJB 3MMCA 4NHVA 4DJFD 4DJFC 3MMCB 8GEPA 3MM8A 1TX0A 2YCIX 4MWAD 4NILA 4S3BA 1ZJ8A 2XSJA 3B0GA 3OR2A 2GEPA 3TYCA 4GEPA 1TX2A 3BOFA 3TYAA 3K13A 3TYUA 2Y0FA 3TYZA 3BOLA 3VKQA 4HTRA 4S38A 2Y5SA 4MWAE 4NIRA 2AOPA 4CCZA 4DJED 3NOYA 2AKJA 3B0HA 1AD1A 3MM6B 3TYEA 3V5OA 3TR9A 4MWAC 4D9PA 2E7FA 1AJZA 3H24A 3MM6A 2DZBA 4AOPA 1Q8AA 4DB7A 2DQWA 3H2OA 2VEFA 4DJDA 1AD4A 4S3FA 4PZVA
chains in the Genus database with same CATH superfamily
1TA3A 4AZHA 2FJUB 5I09A 1N55A 3F1QA 2W63A 2GVJA 4AB4A 1QUMA 4C6JA 5E93A 1G9HA 3IAPA 4AD3A 3FKKA 3LG3A 2IUZA 2NT0A 1FDJA 3EWDA 3CUGA 1RQHA 1MUWA 5K2ZA 3N34A 3T9PA 2X2YA 3LZ5A 2PCQA 5A6JA 4NXKA 3MM5A 1IEXA 3HPSA 4YU1A 1J6PA 3AMCA 3S2CA 4IIDA 5HR7A 3ITOA 1UBPC 2PAJA 2OT1A 4H8VA 2QF7A 1AZ1A 2J9ZA 2J25A 2F6UA 3K2GA 1LLZA 5FAJA 3W72A 1LOLA 3B4UA 1UD3A 1RPXA 1H11A 3Q37A 1EP2A 3MYOA 1EZWA 3WELA 3HOJA 2ISWA 3T0BA 3QYSA 2ZXBA 8GEPA 5FF0A 1E1FA 3R11A 4R34A 3VXGA 3MANA 2XN1A 5TD4A 3PBMA 5BOEA 1BRLB 3EB4A 3VKJA 2GPTA 4I6KA 1KC7A 3RJXA 5E9XA 1NTHA 1Q2SA 3OVGA 4W89A 3UCDA 4M82A 4KEZA 4HHLA 4QDPA 5H91A 4U5KA 5BU6A 4ZQMA 5LZLA 1X7IA 3H2FA 4MGGA 1R30A 1J0KA 1OCNA 4AZIA 4E38A 2AL1A 3NR0A 2G95A 1WZKA 1UOKA 4RL3A 1LYXA 4FOKA 3FJ4A 3NO1A 1UR3M 1DQWA 3GNOA 2RGLA 3C8FA 4FR6A 3I3BA 3GNPA 1KFJA 1JYWA 3C86A 3E1F1 1FWFC 5JVLA 3EDKA 3PPCA 1KM4A 3BLPX 3TN3A 4BA0A 1E9LA 4O1FA 4JQAA 1TVPA 4S2BA 2YA0A 3EDDA 5A94A 2CLOA 5CPLA 4HZ6A 5LNWA 1LBFA 1OT2A 3WDHA 4H04A 2P5NA 5E70A 5I3GA 4KESA 3JZEA 3TSBA 2Y4SA 5U4NA 4YYFA 4G2DA 2DUXA 1OD8A 1RBOB 2Y2WA 1QPNA 4GUHA 1BSLA 1J0YA 4DJFC 3QOMA 4RLIA 3S83A 4N6FA 3DKJA 5KMYA 4WXZA 1VFUA 5FJUA 1JCYA 1DKWA 3BOFA 3NZGA 3PN8A 4YVXA 4U28A 1HJVA 4UTLA 1XYAA 1M01A 2V0TA 2A7PA 4IM4A 2B81A 1X96A 3FW6A 1VRXA 4AD1A 5BYWA 4CU8A 1XP3A 3A47A 1RALA 4OU1A 1KM5A 1EO5A 4HMCA 3T1GA 3PZ9A 4JOMA 5T26A 1CXHA 2O4MA 4MVAA 1JDCA 3MI2A 1QCWA 3EWXA 3M5XA 4CD7A 3GM8A 3TTOA 3HMCA 1L2QA 1JQVA 2WZMA 4J28A 3BTNA 3W53A 2DSUA 1EJUC 4HTYA 1OFEA 3B0LA 1HJUA 1Q4NX 3L2MA 3UJFA 1TWWA 1XBYA 3QR3A 1E9IA 1IXQA 4D1JA 3ATZA 2XG9A 3BG3A 2YYTA 2BY0A 2ZCGA 2A1YA 4H9YA 3RPTA 3PZIA 3BMWA 3QR0A 3NGFA 2WVTA 3IJ9A 1S5VA 1TCMA 1J18A 2J9YA 1XSKA 2ZX5A 2EG6A 2VFDA 3ZJ7A 2TMDA 4DXVA 1YPFA 5K3VA 1XH1A 3AIRA 3S0CA 3QGAC 1J5SA 3WMCA 5ENLA 1GNXA 4MY8A 3TN6A 3CPUA 1M7PA 4RE0A 1RV8A 3W88A 3RITA 1BKSA 2CZ5A 1V3LA 4PMQA 3F2BA 1KRCC 3UWZA 3TDFA 1JZ4A 3GB6A 5J5RA 1J8VA 5KZ6A 4W87A 3RLGA 5FKYA 4JX4A 1OGBA 1TPWA 3GC2A 1U1UA 3DERA 1K9EA 1NELA 4MSSA 2FZBA 3MVIA 3HU7A 3N9SA 3ONBA 3W27A 2VQTA 2ZBTA 4DBUA 3UR5A 4ADUA 1QAPA 4DM2A 1XLGA 3ZFHA 1G1YA 3GH5A 3QLLA 1E6ZA 1BQGA 1LG2A 2D0GA 2HNHA 1I4NA 4ZFMA 1HG3A 1RK5A 1TJRA 1WDWA 4HB7A 4O53A 4YNGA 1G67A 4PCNA 4NZJA 1T0OA 1H09A 1PE1A 4WY0A 4WOZA 4AWTA 3CHVA 3P0WA 3TCSA 1GVQA 1NF0A 2HQAA 3S3GA 5EMLA 4GCAA 3VGDA 3AO0A 1VBHA 5GVJA 4PUDA 3ZLGA 3THQA 2J75A 3W76A 1HGWA 3RRXA 2XFRA 1R85A 4JDYA 1WXYA 3OYXA 4X61A 4XUYA 2OB3A 1TX0A 4CCCA 3W1UA 2IS7A 3VOCA 3SURA 4IX2A 3WLOA 3EXTA 3G1XA 4HJWA 2XIIA 2I9UA 4ECLA 4DUVA 1O68A 2HBXA 1W0MA 2Q71A 4LPCA 3BL3A 1PSCA 3TAKA 1D7KA 1UD6A 1XRFA 1J93A 1Q8AA 4JTFA 1KB3A 4JTDA 4KCTA 1XXXA 1V7AA 5E09A 3SI9A 4KGLA 1TO3A 3T8LA 3UESA 4LUIA 1B1YA 2IQTA 4D8AA 1S2WA 4UTMA 3N17A 1W56A 2VFEA 2DIJA 3GD6A 1FHVA 4XISA 1B57A 1XYCA 2V3FA 1RJQA 4IMGA 2WMJA 3DG6A 4Z2JA 3CUXA 4BJHA 3UWEA 5DLCA 1DE6A 1LM1A 1WZMA 4AHOA 1KGXA 4C5YA 1E4MM 2WCGA 3QY7A 4AY1A 1FRBA 2HROA 1OEPA 3CL6A 5FL1A 1DP0A 1GZGA 2Y70A 3LHVA 5AKQA 1IT8A 3UW6A 4M5PA 3GEOA 1UD8A 1KBJA 4Q6XA 2PLMA 4HCLA 3ZXWA 4F4RA 4JPGA 2CLFA 4RNJA 2CHRA 1QT1A 2BG5A 4J40A 1FCQA 1T41A 2YL5A 2C0HA 4KWSA 5A6BA 3VGHA 4A4AA 1V0KA 4QJ1A 2ZWZA 2AOPA 5LA0A 3P6LA 3NQEA 1OFQA 2CLEA 4O52A 3AS0A 3O16A 1O94A 2ACRA 4C91A 3T07A 3N4AA 1YXCA 1XIJA 4JFUA 2UY5A 2V3EA 3OLDA 2DFAA 2PDQA 5FA5A 1A3WA 3W7OA 1UKQA 3UXKA 5C9XA 2VX5A 3SUUA 4H2HA 4JCMA 1EJRC 1RCXB 2IQ0A 2Y89A 3QR1A 4AZCA 1XCXA 2I5IA 5A95A 1KBIA 1H60A 3RGTA 4YVVA 2FQIA 2PGFA 1RH9A 4RZ4A 4WX2A 3PJWA 2DZAA 4DF1A 3W7KA 4U2YA 4DBDA 2VP8A 1GGOA 1YNPA 1JR1A 3LCGA 4K37A 1TYGA 3UNTA 3OR1B 2JKAA 1H3GA 3N12A 1W9UA 3R4IA 2J24A 4AZGA 1VGAA 3OQEA 3F4NA 1XC6A 5HUPA 3B9NA 2QR6A 3PULA 1I1XA 4H8HA 3UVAA 1TZ7A 2VCBA 1BQCA 5CPMA 3HGJA 4G56A 1CXFA 1ADDA 2RGMA 4BWLA 3B9OA 3M46A 4QM1A 3OZPA 3RK8A 4DWSC 3NOEA 3LM7A 2ZA1A 3EOLA 3NQ8A 1GW1A 2QXWA 2HCVA 1GUVA 1OBAA 1QI2A 3VZYA 3W6LA 3TYUA 2CBIA 3G5EA 3U2ZA 2ZRXA 1EIXA 1TREA 3WLQA 3WJYA 4UUIA 5LNSA 1KM3A 2FH6A 4OKDA 2GOKA 1GQNA 1JI2A 3NZ1A 4XSLA 3S4TA 1MNZA 4AYGA 3CLMA 5I3JA 2C16A 5E0KA 3N9KA 4I5UA 1IWPA 4QIUA 1FKWA 2ISFA 5AYIA 3N9RA 1UR9A 4I7VA 4GCXA 2GZXA 3FAWA 1X8CA 1VH7A 5GJMA 3BQ6A 5LIYX 1LOQA 2QDEA 4F0HA 5D8WA 2OXNA 3NIYA 4PCTA 1PB0A 3PR2A 1CZ1A 2G4JA 4HHPA 5CAKA 1A5MC 1KQZA 1M5WA 1LTDA 5BROA 1O1ZA 4CNPA 3B3DA 3FX4A 4L9XA 3MP4A 1PKNA 3BSHA 3CV1A 3TW6A 1TA3B 2VDIA 4HA0A 4QXIA 4BR1A 4E8CA 3SM0A 1Z44A 1XIMA 3K4WA 1ISXA 3KHJA 4L61A 5EMKA 4S3DA 2BZNA 1SMAA 3M0KA 4LGXA 3NQ6A 1EUAA 3K1DA 1I45A 4WDWA 1EOKA 3FEQA 1UWRA 5AHNA 9RUBA 4CD8A 1MUMA 4OQVA 3DFNA 3VCNA 3USZA 3HQNA 2E40A 3ABZA 2NSOA 2HXTA 4K6AA 1HJWA 3KOXA 1VAHA 1ZHAA 2WMKA 2BBFA 2A3LA 4CNSA 3S1UA 4EACA 3MSGA 4WXYA 1NFBA 4AOPA 3O6CA 1GT8A 3JVAA 1KR0A 3VC5A 4WGHA 2J78A 3IJDA 1DWAM 3PANA 4FNUA 5D8ZA 3LPOA 3T0DA 4H2CA 4LSBA 4QCEA 2BY2A 2W92A 2Q3OA 1VFTA 3WQVA 2XIBA 2GVEA 1XISA 5I24A 1JZ5A 4JGDA 1LG1A 3W01A 5LYRA 4KFNA 2ZX6A 4V1YA 3M47A 3W75A 2P76A 3H2MA 2D0FA 4XAYA 4K38A 2I14A 1EO7A 2DZWA 2ZDRA 4Y90A 5TAOA 1OK6A 2JKPA 3RLHA 4PTDA 1FY6A 4GG9A 3TQKA 2G3JA 5CEWA 4RDZA 1IT7A 2OT0A 4MADA 4K7VA 3DC8A 2XUCA 1V3IA 2HEJA 3WQ5A 2CLHA 1NQKA 2CCRA 1XIIA 4L6OA 1C7TA 4EOUA 1HL9A 1EBGA 1I60A 4IIEA 4DYJA 2R24A 4F40A 1LLOA 4RDVA 3VGGA 1E3ZA 4H8NA 2H8XA 3M5YA 1UW9A 4M6QA 4WDTA 3G2GA 2VGBA 1NDWA 2RHGA 2EJAA 4XAGA 2AKJA 3EMZA 3PBUA 2VFIA 4DUXA 1K3UA 4RV3A 4Q8WA 2XFFA 2VUNA 3S8HA 5K4XA 2WJDA 3RU8X 5AHFA 3ZWSA 1TUFA 4C1NA 2Y85A 2V4JB 4J2PA 3LOTA 4XAPA 3O2LA 3GDLA 4H9XA 1R3QA 1UC4A 1Q63A 4DJFA 1OK4A 1VQTA 4AXKA 3WF0A 2ZZ1A 2Z1SA 3M0XA 1U83A 2GUBA 4R7OA 2VZVA 3WEZA 4WRHA 2VUYA 3VMPA 8XIAA 2P8BA 3ATYA 2QV5A 1PIIA 3UWYA 3LRKA 1JQXA 3ECQA 5EMJA 2QPSA 3E2QA 5HJYA 5K7JA 3TFCA 4O19A 1OCBA 2A2IA 4UMBA 1SFLA 5AYZA 1DXFA 4BI6A 4F0LA 3GXPA 1UH4A 3A4AA 3PSVA 4D8LA 4DLFA 4RE4A 3VM0A 3G18A 2YCEA 4R85A 4IUOA 2VEIA 3BICA 2ON3A 2V3GA 4MTVA 1WZLA 1U2YA 5FF7A 2NQ9A 1MXGA 4GIEA 3UBPC 2WSPA 1ADSA 3TA6A 2EPHA 4IWWA 3W70A 3VNMA 3S1XA 4ERGA 3A4WA 4V2XA 1US0A 1DEDA 4NSBA 4E6MA 3S1GA 3SCUA 1FP9A 2EPOA 5AC5A 4W8BA 2VX4A 4ZEPA 1XPYA 2XVPA 3OA5A 1QW8A 1UKPA 3O6DA 1KCKA 1ZPTA 4B9YA 4FI4A 2OEKA 3THUA 4QS6A 4Q8MA 1E0WA 1LQ2A 1ZRQA 2PBGA 3N1AA 1W1A1 4KETA 3K4DA 2H3BA 4HNCA 2CKRA 2Q09A 3OGVA 3C61A 2OOFA 1QOXA 2JF6A 2Q3RA 3VNIA 3L5AA 1OC6A 4CNUA 2H3DA 1FWTA 1BF6A 4K8EA 4S3AA 1UKTA 4LUSA 4PL2A 2NWRA 4XKYA 4P7OA 1W91A 3BAWA 3Q2DA 3PZGA 3UXLA 3T8QA 1T99A 4L7ZA 3W26A 3CXOA 4MKNA 3TW9A 4CGTA 2C13A 1N2VA 3QC0A 4MJ2A 3WQCA 1ISVA 4RPQA 3QV8A 4JHMA 4RUBA 3A4XA 2NQLA 2ZDSA 1PKYA 2E9MA 4O8RA 4Y9MA 1V3HA 3WLNA 4ICNA 4O54A 4CKQA 4FAMA 4O57A 2GSHA 1JZ2A 1DQUA 1XDMA 5CGTA 2YFNA 1XC4A 3KLKA 1UJPA 3WNLA 4LCQA 1UYQA 3STFA 4GA8A 5E9AA 2QDDA 2EPKX 1AQMA 1PYFA 1JD7A 3R12A 3SB0A 5EY5A 3CUIA 1KXTA 3R0UA 1W9PA 1WUEA 3EOUA 2QVNA 1LORA 1G01A 4IP7A 1GW9A 2VGGA 3HG3A 1B3ZA 3HFYA 4MUPA 3FK4A 5DRCA 1VCGA 5LHEA 3C0SA 2E28A 4QS5A 3CQHA 1L8PA 1XSIA 2QCLA 1JF5A 3WENA 3O6AA 4DUOA 3BV7A 2ZXQA 4B4FA 4W84A 4H9VA 4NT0A 2W61A 3DYPA 2DIEA 4POCA 4KCWA 2O9PA 2QZRA 2YDQA 5CZ0A 5C54A 1ZL1A 3RLUA 1H1NA 1TPH1 3AYTA 1W5OA 5EMMA 3DX5A 3B05A 3A6OA 1I1WA 3QJAA 1PX8A 2V67A 1E15A 3KE0A 2HK1A 4KW2A 3TSMA 1ZCCA 4YVPA 1W6TA 4S39A 3UJSA 4QP0A 2E5CA 3TWAA 3LX9A 1B54A 5B7YA 5CSUA 5DY2A 5A1AA 1L0PA 4GWEA 3M1ZA 3MT1A 3BLIA 3OOQA 3WLRA 4UFLA 1SMDA 4ZQOA 3TJIA 4JAWA 2X0HA 3T7VA 3NL2A 4EPEC 4PTVA 2C0AA 5HNNA 2Z28A 3EEGA 3GG7A 2PE4A 2FTPA 4ZVJA 1QK0A 1FH8A 1W1VA 1LWHA 3U8GA 3HURA 3EDFA 2V9DA 3KWXA 4UWMA 1ENUA 5LGZA 2ZA3A 1Z3NA 2VCCA 3UWUA 2VC9A 4Y9PA 2X7WA 1DE5A 4DBEA 4BS0A 4N6EA 1XLFA 4HU8A 1RLDA 4QX4A 1KM0A 3F2DA 2WK2A 3ARPA 1UC5A 3B8IA 5I5RA 1KGWA 5AZ0A 4OJYA 1FCUA 1S46A 3BLKA 3O07A 3FNDA 1UD5A 1BPLB 2ZUNA 1QW7A 1R2RA 1OY0A 3OLGA 1O6IA 5GQBA 1X8FA 4NZ4A 1BSIA 4IIHA 3LCWA 1XI3A 3MDWA 2G37A 4ZTXA 2VEPA 4Z17A 3VIGA 2XWDA 2ZZ6A 2VR4A 4N9DA 4V1XA 3SY1A 4JIIX 1SFSA 4O28A 3LXBA 1E3XA 3W7EA 1NARA 4TX8A 5EU9A 1NEYA 4EX4A 4FLOA 3BAIA 1D8WA 4FIQA 3UJRA 3W7LA 3LMZA 1Z6KA 3EAUA 1VP5A 3BAXA 2VGFA 4AD0A 3LV5A 5HK4A 3PZOA 2BODX 4MPQA 3SADA 2JEPA 2W62A 2C19A 3ITVA 2CLKA 2DGAA 1HJQA 4UTKA 5HNRA 4XK2A 3HA1A 1XLCA 3CHFA 2DZBA 1OYBA 3LBCA 4YTUA 1VEMA 3EWCA 4JFSA 3G3DA 4MB1A 1TJ2A 4MUZA 3HJEA 5LA1A 3W7CA 1HKMA 1PL9A 3KCJA 1RA5A 1BTMA 4AF0A 3GXDA 2WJEA 1D9EA 4JR5A 1XIDA 2VR2A 2GQAA 3PUOA 2A5HA 5D2YA 3W7GA 1OYAA 1B4KA 2OGJA 5HMSA 3R8GA 1QVBA 3VUPA 4ZO9A 3KBWA 4NF7A 4TXEA 3QTGA 3W7MA 1WNOA 3PBYA 3WY1A 2V5CA 1J01A 1X6LA 3SQMA 4MWAA 3TWBA 4HOZA 1GZ1A 3FYPA 4M1RA 1PS9A 5EKYA 3RUBL 5FJTA 3W83A 1Q3NA 3IRSA 3CZ8A 3VD3A 5JIWA 2CIPA 3IPWA 1JVNA 1UR1A 3GVGA 1M7XA 4J7RA 4P7NA 3BWWA 4UNKA 4LUJA 4D72A 4AISA 2GEPA 3V16A 4F79A 3ANVA 3T40A 1HF6A 1W5QA 5FSEC 1V6YA 3O9NA 4IMDA 4OT7A 2E9LA 5ABFB 2WO5A 3N2MA 5EBAA 1YTKA 3TYEA 3VZXA 3O6YX 4PCPA 1GVRA 1SW0A 4U33A 4D6HA 4Q8PA 1A0EA 1OCQA 2O56A 5JBEA 5A6BD 4IGHA 1R3TA 5BRBA 1CGWA 3IVUA 1WA3A 2OODA 4DYEA 2YOCA 3AZTA 2I5QA 2WNNA 4JFTA 5HNUA 1M1BA 4WKFA 2E6FA 3MA8A 2YXGA 2EEXA 2WAGA 3UPMA 2NX1A 4FXJA 4H6RA 1E6XM 4PUJA 4R88A 4U10A 3NQAA 4CCEA 2DVTA 3VO0A 4HNVA 3ISIX 3LUTA 4P2VA 3W22A 4ZE5A 2JIEA 4JX5A 5A6MA 4BF7A 2YDAA 4CUCA 1MQPA 1K4GA 3B97A 2E6DA 1EC9A 4ORIA 3D3FA 3LU2A 5C0QA 3WKZA 4P5UA 1ZJAA 1WCGA 1V6XA 3N3TA 4GI4A 3W25A 3WQGA 1Q13A 1ME9A 4IJRA 5AC6A 5CGMA 4QEHA 2QIIA 6XIAA 1A5KC 2F9RA 4GZIA 5JMUA 4NRSA 2XN2A 2OSWA 4GKTA 4E3VA 2QJGA 4NJHA 2VQUA 4GH3A 2XIJA 3UG4A 1UZ1A 1W3HA 3LCFA 1JNDA 3BH4A 5IDZA 1DWFM 3WG6A 5AYBA 3QQ0A 4GACA 1XM3A 4IQLA 3BOLA 1UD4A 1V0NA 4PB4A 3WQOA 4MJZA 3S5ZA 4JIQA 4GZJA 4R27A 4H19A 3ID7A 1T40A 3B0HA 1SU5A 1ZLPA 1SYTA 3BW2A 1UUMA 4GI9A 3AQUA 2VNCA 3MM6A 2PC4A 3HPXA 4WDUA 5I2UA 5G4HC 3VABA 4G8TA 3I65A 3P80A 4YJ5A 4F2BA 3LGDA 3GTXA 1W3LA 1QWKA 1K9DA 4LNYA 2ZWYA 3SAZA 2ZZ3A 4UQDA 1M7JA 2R1KA 5DCDA 2GK1A 3W1RA 6GEPA 4X0VA 2X41A 3DECA 4UQ9A 2EO7A 3R43A 3EA1A 3CV6A 1UUQA 5BRQA 5CXPA 4B5NA 1HJSA 5JQ9A 2Y61A 2A4AA 3LPFA 3WMLA 4O11A 4HVXA 3VVGA 5EFFA 3RR4A 3MC5A 2GSJA 4LH8A 3CGTA 4IH3A 4P8UA 2CEQA 3KAOA 4IPNB 2XSBA 3ZR4A 2HNEA 3KS6A 4V33A 1EZ2A 1TELA 3RO6A 1EJSC 2FGBA 3WQDA 4AIBA 3G3MA 3TXVA 1I0BA 2IXVA 5CC3A 2V69A 4IX0A 2IPGA 2XFWA 4JEJA 4NYYA 3DHFA 3ZO9A 4OFCA 4A22A 1NF7A 3TOPA 2J77A 4ICCX 3W2JA 3ABQA 2DPEA 2F38A 2V5JA 3GDRA 1PO9A 1P7TA 3AFBA 1DPMA 1UP3A 4ROQA 4IMAA 4QLLA 2H6RA 1Q6CA 3VGFA 5IOBA 2WANA 1W37A 4MLRA 4LJ3A 1UH2A 1E5JA 2WHMA 4UTFA 3VD7A 1REQB 5HXMA 3I6RA 1JPDX 4AEOA 3MCMA 3IGXA 1AODA 3Q58A 3WDJA 4C65A 1MRAA 4L1GA 4C6KA 4W8LA 4CQCA 1XRVA 4JTLA 2QUUA 1WPCA 3FHAA 4J3TA 4W8AA 4QJ4B 1A80A 2DT1A 3QY6A 2O4QA 6TAAA 3UG8A 2FB2A 4MY1A 2WOQA 5FESA 5I3IA 4HYVA 2X05A 4JKLA 4DJEC 1OG6A 2Z2UA 1RUSA 1F76A 4S1FA 4RK8A 4AIUA 4FF5A 4QLJA 4DJDC 1V79A 1E56A 3DU0A 3MY9A 4O8AA 1XICA 3GU1A 5F2MA 2GDQA 1FFQA 1E9ZB 1BLIA 5BU9A 4UOQA 1FWIC 3OHMB 1GJPA 2B0MA 3CAQA 2Y62A 3R94A 1BVZA 1VFOA 1J96A 1QU4A 5HJXA 2EPNA 3OIHA 1YTEA 2NV1A 2OLHA 4O1AA 1OGGA 4ES4A 1O12A 2ZRUA 1IF2A 3U2OA 3GZAA 1EP1A 2BVDA 3PPFA 2VRQA 2PDIA 4QG6A 1TJPA 3SZ8A 3V7PA 3L0GA 3NQBA 1C91A 4BK9A 2XZ7A 3SIMA 2J88A 2D2HA 4F66A 5BXRA 3BDKA 1NDZA 4R33A 3WNPA 1GVEA 3H2AA 3MM7A 3DYOA 2J66A 3QV9A 4NZFA 1XIFA 3RCYA 3L66A 4MHBA 2CYGA 4E2OA 2DQXA 5FJPA 1BEUA 2FZMA 3TYBA 2GVGA 4Q4PA 1SFTA 4GOAA 2YB1A 3LSCA 2WCAA 4O1CA 3APTA 5T9CE 1JCLA 2GGHA 3VIPA 3HQ1A 2GWGA 3FFSA 4EPBC 2HV5A 4DZIA 2PTXA 2Y7GA 3WBWA 1W54A 1EWDA 1IXPA 2QHAA 5BNKA 5ECVA 3RRAA 5LGXA 4IPJA 3QW3A 1GWJA 1VCVA 3I3EA 4M56A 3TCEA 4C6FA 4CU7A 4QISA 2CU0A 1DQXA 4WKAA 3GFYA 4B3ZA 3MUCA 2C1IA 3QN3A 1KTCA 5AOUA 2O9TA 2BHUA 1KA9F 3D3AA 4L64A 4JNMA 3TTSA 3EGJA 1X38A 5I3DA 3F03K 5AHMA 4PUNA 1EYWA 1EJXC 4S3FA 4QG8A 2IKGA 4IT1A 3EWZA 3W38A 3MMTA 1HX0A 1X6NA 1KRAC 4LVFA 2YCLB 3BJSA 1XLHA 3L0NA 1ZALA 1TPDA 4A3QA 4B2DD 4YLWA 4XQ6A 1F6PA 5M1TA 4PR4A 1US2A 3QEZA 2E09A 4AVFA 4PULA 2FZ8A 3OG3A 3IGSA 1GQJA 1W9DM 1MZRA 3GBEA 4FOUA 4DO6A 4Q4SA 1Z69A 1TTPA 4NQ1A 1ICPA 4GABA 2E67A 5DELA 2VCAA 4FNTA 2WMGA 2ASHA 4I7WA 3O63A 3H26A 2Z0IA 4GIRA 5FEXA 4URIA 5HQEA 3V5CA 3AIBA 3LCLA 3B8DA 3M4HA 3VIMA 1ZSXA 4W88A 3GR8A 1DIDA 4F3HA 4RDYA 5E5CA 4RNIA 3EPNA 1SUXA 4MB3A 2V2DA 3T2PA 3GYEA 3UY8A 3NZRA 3KZPA 3QMTA 3GC4A 4ERIA 1BAGA 4H9TA 2PP3A 2HWGA 1Q6RA 3PP7A 4JTEA 3G1AA 3SR7A 3NWRA 1OC7A 1KTNA 3W2NA 3SUTA 3XIMA 1KFCA 1UBSA 3OR2B 4CN6A 4IQEA 3W74A 4ZOBA 1A0DA 3PPHA 4A3HA 3HF3A 1UA7A 1QPRA 1ZFJA 4J3UA 4QGCA 3ARVA 3W3OA 3VX1A 4Y96A 2H9AA 2W0UA 3LZ3A 4QE4A 2DDXA 3ALGA 3E0WA 3NVDA 4ZR8A 3SRFA 1K8CA 6TIMA 3BANA 4GJIA 4L4OA 1BKHA 4CNTA 3RX4A 3MO4A 1O4UA 3QV7A 3WDRA 4Z42C 3TSDA 1TV2A 3QXBA 4PMUA 5MKGB 4UTTA 3MSDA 2F2KA 3PBVA 1IEIA 1MYRA 1VFHA 1FH7A 1KWKA 3PFRA 4GE8A 4O4WA 4Q4OA 3OZOA 4KGJA 3GHTA 4FLSA 3LLFA 1EX5A 3S46A 5CLWA 5BW6A 3RR1A 5BMWA 1JCXA 4HN8A 3LXAA 2CLIA 3T4WA 1E51A 3H55A 5F2LA 3EBVA 4H8UA 2HE5A 3N73A 3A3HA 4I6VA 5C6MA 2FMNA 4CNOA 5JUVA 3E2RA 3PJTA 4HZ8A 3CMJA 3QHMA 3Q94A 1EUNA 3GSMA 4FSAA 5I79A 1IGWA 3K8LA 5CPNA 5HWNA 3MMWA 2Z1VA 2E0PA 4GNVA 3TZNA 3MM8B 1YDVA 4DHGA 3VX0A 1YW1A 1TWDA 2OQYA 1R9ZA 4MDOA 4M1BA 2FHBA 3S2LA 3PUGA 4J3ZA 5LA2A 1MXSA 1AQFA 4IFOA 4B5TA 1T8QA 3N2TA 4IFKA 3UFYA 3TUUA 3LD5A 3HGSA 1AL8A 1HQTA 3PWIA 4B5SA 1KV8A 1YE4A 4B91A 1PDZA 3BV4A 4TVDA 3UGVA 2JIWA 1E72M 2QAFA 1N8IA 1NIUA 1CGYA 4GINA 3WD4A 3LI0A 3B0UX 4Y9AA 5G2HA 2D3LA 2YPIA 1FHUA 2RDUA 4NX0A 2NW0A 2PUZA 3HJZA 2TODA 1HKVA 5C9RA 3WFZA 4GZ7A 1W1PA 1TQXA 2AKZA 3LHZA 3B8UA 4B5VA 1S5WA 2POZA 3EB3A 5CG0A 3QSTA 3CB8A 1EQCA 4Z1YA 1R7AA 3BCDA 3STEA 4C6LA 4MFEA 2XN0A 2PS2A 2D73A 3PF3A 2QCCA 2EXOA 4CQBA 1BWVA 3MHGA 4AMCA 4J3XA 4LYPA 1DJHA 5FEZA 3Q4DA 4ROPA 1M7OA 4Z2HA 3VM5A 3ZR5A 1G0CA 3T81A 2VKZG 4MPKA 4UTWA 4KQNA 1BG9A 2IPJA 1EEPA 4MAVA 3VNYA 5CBBA 4JQ4A 2WPGA 3CMFA 4A2SA 1RBAA 2JGQA 3CAVA 5KINA 4G39A 3WUGA 2CFFA 1OQFA 1XIHA 3GHRA 1V6UA 3PY2A 5C2XA 3VIIA 1EB3A 3WX7A 4JL2A 3CIVA 4O4VA 3W1QA 1V02A 4K36A 2Y5JA 4C7GA 1ZBWA 3CHDA 4AHQA 3WJZA 2X2GA 4K1WA 4ZSUA 1WX0A 3C0QA 4G7EA 2FHCA 5G1MA 3QBUA 4AAJA 1A5UA 7TIMA 1DJYA 1JULA 3L67A 3ZWTA 2RDWA 1KFWA 2QF8A 3SJ3A 3QC3A 2X8RA 1F3TA 2GVLA 3CT2A 2FIQA 2RKXA 3WF2A 4XZMX 2PP0A 3W6MA 2G3NA 4M80A 4EXQA 3EWUA 3WDQA 2UZ9A 3MUIA 3IJIA 2PDHA 4HK7A 1GPWA 2C6QA 3P93A 4C7DA 1MO0A 3PPGA 2PWFA 5C70A 2EKGA 4EWJA 5DFAA 3W2MA 3WBYA 2NV9A 3BW4A 4HKPA 2WM1A 3GHUA 2C1GA 2PMQA 4C90A 4IP4A 3AU6A 4DEFA 4O16A 3FEMA 3G0UA 2HPMA 2X1SA 1H7OA 1EC7A 1Q85A 1X39A 1RJPA 3SSZA 4YWSA 1RD5A 3FA3A 2X16A 1KM1A 3VPLA 3M44A 4KIRA 2OKTA 3T55A 5IFTA 4RNHA 1KTBA 4GPNA 1EX1A 4XV0A 4D6JA 3E0FA 2VOTA 1H4PA 1G4EA 3GR7A 2W6RA 3LY0A 4UMAA 2IKJA 1TE6A 1ONXA 3EXSA 3BURA 1MW0A 3GG1A 3FGCA 2XGIA 4NAFB 5FF4A 2ZUWA 4R9XA 4UBPC 4BQ3A 3S1WA 4V28A 3W9ZA 3ZOAA 3W1AA 4KF1A 1R87A 1AW5A 5C55A 5BWAA 4ML4A 1XGZA 5C2CA 1HIZA 5D4YA 3TQVA 4EWND 1ONWA 3S6DA 1H2JA 4AW7A 2J79A 1VEOA 3FVMA 1CECA 2ACUA 5L6UA 5BMXA 1LRQA 3EDJA 4AVNA 5HWJA 3PHAA 1OB0A 1RLCL 3GNRA 4AIEA 5FJRA 4P8WA 3WF4A 4US6A 1Y65A 2YL6A 2J6VA 3B0YA 1Q65A 1JPIA 4HYWA 3R0KA 1P5BA 2NLYA 3VIFA 1L6WA 2FGLA 3I7QA 2QV4A 4O0ZA 4NU7A 1JFXA 3QVQA 2A6LA 4NXSA 2SFPA 1RK6A 3G0SA 3KDNA 3H21A 4C6QA 4NAFA 5A8GA 1LQAA 3FJLA 1IWAA 4FMVA 3KZSA 3W7IA 3LI1A 5IRPA 4Y9NA 3MM9A 3I7SA 1NWSA 2Z1WA 4ZOCA 2DZVA 3ABRA 2OZ8A 5H6HA 4HNNA 4LT9A 3G77A 4TV6A 4FLQA 3GXFA 4I9JA 3W7QA 2VFFA 2ACSA 2O55A 2UBPC 5IBXA 1EJVC 5CBIA 4A8RA 4B9ZA 4HPGA 1UPMB 2JGYA 2OO0A 2BXYA 2DZTA 3JU2A 4D71A 2BGNE 3ITTA 2FTWA 3NUKA 3VC6A 4AQLA 4LW7A 3PB0A 3PB2A 1XLKA 3VU2A 3SUWA 3LM3A 2ATSA 3AS1A 3RPMA 3GR4A 2OEJA 4US5D 3C6CA 1VCFA 3GXIA 4WY0B 4MZ8A 4IMCA 4LU0A 2PDYA 5DMYA 3WFAA 4F8XA 4EAMA 3W1NA 1IIGA 3BSGA 4C6PA 2HRWA 2PWHA 3ZT5A 1ZAIA 1XLDA 1VPQA 3TV8A 1WE5A 1AUSL 4R7JA 2KAUC 3DEQA 2PP1A 4JTRA 3NDZA 1T7LA 3S6TA 3DFSA 1VBJA 4I3GA 1Q7ZA 4XUGA 4O15A 3WLMA 1UPPA 4KIEA 4DBSA 3OPSA 3NFUA 1SR9A 1TPVA 2OZ3A 3DDMA 1HFBA 1F6YA 4UQBA 4N4PA 3EMQA 1MEHA 2Y7EA 4MM1A 3BZGA 2V68A 4Z0SA 3SCVA 3KCLA 4FNQA 4IF2A 3VAVA 1L6GA 2QCFA 1L6YA 2J4GA 1KGUA 1GTHA 3S5SA 4TOQA 2ZX8A 1XLJA 2QCMA 3SIZA 3FA4A 3AUJA 3F2CA 5LKYA 5AHEA 4H6EA 1RR2A 3SJNA 5CBJA 4Q8NA 5D04C 3TYAA 1XF0A 2FPVA 1NJJA 3P8IA 2FJKA 2XVLA 3LRMA 3G6LA 4J3SA 2X1TA 1UWTA 2H8ZA 2J7BA 3LGGA 4X63A 2E9BA 1LT7A 1Y8BA 4NAEA 2D2GA 3W07A 4J5NA 5FSDC 1XYLA 1BWLA 4X2RA 4GC4A 3W84A 3EOEA 4PB3A 1RZMA 3DHDA 3P5ZA 4Q4RA 3UD6A 1L8NA 3P62A 1BGAA 3MPGA 4QLKA 3OGRA 1X1NA 1QBAA 1HL8A 2F6KA 3V1PA 2JALA 3V3WA 1E0XA 1WBJA 4HYRA 3H23A 4C6DA 3UGRA 1ZB5A 3I6TA 4NI3A 1QPQA 3BO9A 3SY8A 1XS2A 5H1WA 4LFYA 1ICQA 2VO5A 2CLPA 2VEGA 4LAUA 1UWIA 3FN9A 1HJXA 1VENA 1JIBA 3VIHA 1KBLA 1NM9A 1KFEA 4TMBA 4E4PA 2EF9A 6PTDA 4L4PA 4ADSA 2VFGA 4GI6A 1KV5A 3QGVA 3HB9A 4GLEA 1DJXA 4JIRA 4JFWA 3UWQA 3RM4A 1DJNA 3WDIA 2FPYA 1QHOA 2HVMA 5D05A 3CL7A 3NL3A 1BTCA 1Q6OA 2HSAA 1YQ2A 3TYCA 4LCSA 3PZMA 1QATA 3OEXA 3S9IA 4TO8A 5HMEA 2QS8A 2X1UA 1XLLA 3UP8A 4KCUA 1PIGA 4PEEA 2C8NA 3CMGA 3GUGA 1AJZA 1OFAA 3SFWA 3WD2A 1KCLA 1AD4A 3WD3A 4L9ZA 3OU8A 4OECA 4J2MA 1QNQA 3VDAA 4MKVA 3W73A 4WD0A 4IIFA 2PF0A 3ELFA 2Y24A 3GTIA 4PC8A 1L2UA 3R2GA 5DEZA 2B7QA 4X60A 2YCLA 2FMOA 1VFMA 3S2JA 1OHLA 1V0LA 4IP5A 3AXHA 1EKOA 1UKOA 2R82A 1PCKA 2OKOA 3CUJA 4ZQPA 3WJXA 1PJ9A 3BARA 4HMDA 3DXIA 4HOWA 4GUIA 1CGTA 1EJTC 3LTPA 4F2TA 3DN5A 4HNUA 4GVFA 1JJKA 4L9YA 3H2EA 3UZ5A 2B31A 2DZSA 1FVPA 2OZ0A 4GYJA 4H00A 3DYMA 4Q4QA 2W5FA 1HTIA 3H70A 1E43A 2A7NA 3WK0A 7PTDA 1XV8A 2WSYA 3PFMA 3MMCB 5FF3A 3OR2A 1UH3A 1WAWA 2WW5A 2VWSA 3DCPA 3KWSA 3HPAA 2PTDA 4HOXA 2Y7DA 1ZY9A 1EGZA 2BY3A 5XINA 1D7FA 2YW3A 3MUY1 2F7FA 2WVVA 2Y5SA 2OYMA 4RPPA 4XB3A 1AZ2A 2VYOA 1XHGA 1EJWC 5HMDA 1KKOA 4E8DA 1UQZA 3QY8A 3LK6A 4PODA 3BQ5A 1I2OA 4D2JA 2ISDA 4PA8A 2TPSA 3VMOA 3IWPA 1UCWA 1H0IA 3RMEA 2A3AA 3MBFA 3VKCA 1MVYA 1V4YA 1Q6EA 3SRDA 3ZZ1A 1H7WA 4PRTA 3WQ4A 3IANA 4IISA 4LAMA 2XH2A 4HZ7A 5FIPA 4RDWA 6ALDA 4FS9A 4GC3A 3TONA 4ZE4A 5DY3A 3VKTA 1VC4A 1BRLA 3AOPA 1IGSA 3POHA 5M17A 4YYCA 4JNYA 1U33A 3MI3A 1G4PA 1GKRA 4RJEA 1FWCC 4E4FA 2VMFA 1GHSA 2Z24A 4AC7C 2ZOXA 2EAWA 1TIMA 1K8XA 2HBVA 2PDWA 1B3YA 3VM1A 3O0FA 2ZXAA 4Z1AA 3LQLA 4F0MA 3ANUA 1BGGA 1HUVA 2D69A 3UJEA 2GUUA 4PN2A 2VC6A 4KRUA 4UTWC 3EYPA 2DORA 1I2NA 4PFHA 1TTJA 2J9XA 5MKGA 3ZR6A 2FKPA 3FXYA 4B92A 2PTWA 4NI8A 3EPOA 4EXBA 1XYFA 3VOHA 1TZZA 1H5VA 2GJXA 3VD9A 1OZMA 2EQDA 2CZDA 4RZ6A 4LB3A 3M64A 3L4VA 2QUTA 3P82A 4ZXOA 1VS1A 4A35A 1BXCA 2WC7A 2BS9A 2MUCA 2VDHA 4UCGA 2R1NA 4L65A 2F84A 4BHYA 3E9AA 2P0OA 1GPFA 4AY8A 2QGYA 4LTSA 4XZIA 1CLVA 2BASA 1FOBA 2OGYA 2WJFA 3HO8A 3CEPA 3WQWA 4MZ1A 2R1LA 1YE6A 3W2UA 4EPDC 1S38A 1X1OA 2INEA 1J0HA 1D8CA 4M19A 1NP2A 5REQA 3PTDA 3VK5A 1NOUA 3VKRA 1PZ1A 4NJJA 2AMGA 1JYVA 1KW1A 4UXDA 1T8XA 4WQ6A 3R8RA 2OJPA 4GQBA 1NOWA 3NQGA 4DJEA 4ZGYA 2GGGA 1XGEA 3NO5A 1ML1A 1TPEA 4Q8UA 5HPCA 4G9PA 4CQ8A 1DJIA 2BXVA 2MNRA 2WB5A 3SGGA 1K9TA 2XH7A 4XKYB 4X9SA 3GK0A 1W3NA 1TRDA 1W1YA 2PLCA 2P3EA 1X98A 4BY3A 2BOGX 3A12A 3H6OA 1OYCA 1VHCA 4FNSA 3MMUA 3DOPA 3WEOA 3SCSA 2WXDM 1H1YA 1TPUA 3OTRA 4JTUA 1W1ZA 3HG4A 1A5OC 7CGTA 3F5JA 5KEZA 4EAYA 3TR2A 1U22A 4IQDA 3W7PA 2NVCA 1H63A 3O1NA 2Z2AA 4N2YA 2I7GA 1JNEA 2ZFAA 3PJUA 3IIPA 2Y88A 3OVQA 2QUNA 3SCTA 1YDYA 3SCPA 2VVSA 3COTA 1KFBA 1ZGDA 3ZJ6A 1S2CA 4DNHA 2NT1A 5D2WA 1SJBA 3PBWA 2VOMA 2ZUVA 4A21A 4J35A 5DBUA 4UFKA 3CBWA 1HGYA 1WO2A 1N7KA 4AYSA 1JDAA 3IV3A 1V3JA 3HG2A 3VYLA 1ADOA 4PTNA 3LXCA 4LVBA 1KM6A 1Z8AA 1F4AA 4UIOA 4DZHA 3NQVA 3S2MA 1TSIA 4ZBCA 3TX9A 1GEHA 3ZVIA 4A3YA 4OGZA 5XIMA 1UROA 3U4AA 2NQ5A 3RDKA 3B06A 4DY1A 2JQXA 1FCVA 1LRNA 3TVAA 3SSJA 4F9JA 1T5AA 3WQPA 2XVGA 4XZHA 4BEUA 5FJIA 1Q2RA 3E12A 2PCEA 3D46A 1JXKA 3GVVA 3S9YA 1E6QM 4UZSA 1EF3A 1W9BM 3GU9A 2J8GA 3LERA 5I00A 3FVDA 4BI5A 3H7VA 1JD9A 5FF2A 3A21A 1EXBA 1S5TA 5EB8A 2XSAA 4UNLA 2BVWA 1W9XA 4B2DA 1UZDA 1VR6A 3S5NA 3C2EA 3CB3A 1DXIA 4XIAA 2O7QA 3W87A 4REQA 3NQMA 2AQOA 1GVOA 4H7CA 4KT2A 1E1EA 4REQB 1PZ2A 1X7FA 4ZXLA 1VB9A 3WIJA 2WMIB 3QLDA 3KUMA 4HNTA 1FWBC 2P1FA 3WUFA 3IIZA 1ISZA 3LTYA 4I9TA 1RY0A 1MUCA 1PHQA 4CQ9A 3N13A 5KTLA 4AD2A 1VEPA 2I56A 3TNBA 1AA1B 2CHOA 1PTDA 3LLDA 2DUAA 1U5HA 2RDTA 4S23A 4YPJA 2YCJA 3P74A 1PHWA 3FA5A 4MWAB 3E3HA 1F3XA 1S39A 3R58A 2NQJA 2O9RA 5TNVA 1GONA 5SWUA 1JAKA 3KL3A 2EJ1A 3VNZA 4IJBA 2PURA 3QZEA 1OFRA 4J3VA 3G1VA 3IVTA 3GDKA 2QPUA 4G38A 4JY9A 1SZFA 4PBEA 3SUSA 1BD0A 2O92A 1XYMA 3B03A 3V0SA 4LX4A 2G0WA 5BXPA 4WCJA 4US5A 4WOQA 3MMBB 2NUYA 1FBAA 3H12A 2NVDA 3AAMA 1IXNA 3O15A 3NSXA 4HHMA 1OCJA 4MMWA 4X0NA 5HA7A 3LHYA 1GYMA 1KFLA 1XUZA 3GXNA 1ZP4A 1OFPA 3P5YA 4B5WA 4Z1DA 1SSDA 1U5JA 2WV8A 1TV3A 4LF2A 3FV9A 4QR6A 1AW1A 1TWIA 3MV01 4RX0A 4IICA 1SR0A 2PSNA 4MWAE 4LUYA 1YRRA 3URQA 2CETA 2X1RA 1K4HA 4DNMA 3V18A 5A69A 2DV0A 2PEVA 4RXFA 1S5MA 1H5YA 1TPC1 3QTPA 2W91A 2PRMA 2CLMA 4JTQA 1V93A 4GKLA 1YLVA 5E6YA 3CTTA 4LYKA 1E1CB 3WQFA 5BWFA 5ABFA 5HR6A 3O05A 4JTHA 4QHRA 3ZYZA 1H62A 3AHYA 2H9AB 3M9YA 1W1B1 4PEKA 4LS2A 3SUVA 3QFWA 3EOSA 3PUDA 1BWKA 3CHEA 3DI1A 4PUKA 4H9MA 2C1HA 3WQEA 3ICJA 4DZ5A 4QSFA 1H61A 3MM9B 4IJCA 2OTDA 4CLMA 1ZUAX 3N4EA 4PUMA 3ARTA 2Z1KA 3DHPA 1TV4A 4TUFA 2V5DA 3BLEA 2Z4GA 5C5YA 5AVHA 3TLLA 2BV9A 1RD6A 2OVLA 1O66A 3WBXA 4S3BA 2QW5A 2Q8LA 1VYSX 2VR5A 1IWBA 3U5YA 5D9PA 1RVKA 1GVYA 4PE8A 2GL5A 4D6DA 3R8HA 1JYNA 1XLMA 4G7EB 4NJKA 3WUBA 1OIFA 4MJMA 4EKJA 5TQLA 3CU2A 3GG0A 3GFXA 3QPZA 3UZXA 3WLJA 4IIBA 1XH2A 3QGKC 4Q22A 1VBUA 2XSXA 5BZAA 1MSSA 1OD0A 3M0YA 1I6NA 1ZZMA 4OIFA 2OLAA 2G8ZA 5GJPA 1MQQA 1OX6A 3CQIA 4KWWA 4P7LA 1ITCA 1UWSA 3WMBA 5HINA 3EX4A 1XDJA 2QEZA 3PZUA 1XIBA 1V8EA 1TMQA 2QCGA 4RE2A 1LBLA 5DMNA 4ZTYA 2A6NA 1DHKA 4FPSA 1R9XA 2WSKA 3C2RA 4FX6M 1PX3A 2JE8A 3CC1A 1RBLA 3DG7A 5AOPA 1XFBA 3WNNA 6CGTA 3UCQA 4GY7A 3LCXA 1RXOB 1P48A 1C92A 4LS0A 4WSHA 2WVSA 4I8YA 1P0KA 3LGEA 3P8JA 3VKSA 3FGCB 5F2IA 2WQPA 3VD4A 4C6BA 1W2VA 3AIUA 3QKEA 1FX6A 1R5YA 5AHIA 5CPQA 4M8UA 1G6CA 5G1YA 4KEVA 2CBJA 3FY1A 1FUYA 1F8IA 2FZ9A 2BY1A 1XLBA 1EFZA 2OSYA 3E0IA 5KZDA 2PDGA 5E0CA 3AYRA 3ERPA 2J13A 3NO3A 2WKJA 3RIKA 4NUWA 3XISA 4AFYA 4HA1A 4LVGA 3R0DA 5REQB 4CN1A 5CSYA 4M6PA 3NA8A 9CGTA 5DBTA 1XKYA 4OV4A 3RO8A 1TPFA 3F4VA 5E0FA 2BNJA 2GYIA 2J47A 4FZIA 4PL1A 4K8GA 3TP4A 3LRLA 3TQ0A 1CI1A 2BHZA 1E9YB 2NXHA 2PD9A 4CEXC 3D5HA 5BOFA 4QROA 4AWSA 2V6AA 3BVJA 5ABHA 1EGVA 1QNOA 2YZRA 4BF9A 3ARQA 1RCQA 4YS1A 2QJJA 5A8OA 2ZRZA 5DXXA 1OX4A 3REQA 2IQDA 5JH2A 2IXUA 4O0KA 2A3HA 3B8WA 4ZENA 2D20A 2RH9A 1X97A 1K8YA 2WSRA 4FALA 3VKBA 4NYUA 4ZODA 3TIMA 4LC8A 5CZKA 4CCDA 3WD0A 1FHDA 1B0IA 1LL7A 3LPPA 5GNXA 3HMJG 2XTKA 1DHPA 4HU0A 3QMRA 4EVZA 1F3WA 3L65A 3WO8A 4UCFA 4TX9A 3DG3A 2NZLA 7ENLA 2NLIA 3VI2A 5ABGA 2R6OA 3VKAA 1JCTA 1KBKA 3NQ2A 5F1VA 2AGKA 3WLLA 2OG9A 1QNSA 3M0VA 1EP3A 6REQA 3VUSA 1K7FA 1XDLA 2OYLA 1HKIA 1A4MA 4HGXA 4RR4A 4YTTA 4PMYA 2P8CA 3NDYA 3WNOA 1YXYA 1YNYA 2P3ZA 1VZWA 1JG9A 3CUFA 1AQHA 3PG8A 3N2CA 4E8GA 2V63A 3F5LA 1BYDA 3R79A 4ATDA 3WLKX 1XSJA 4DVOA 5J04A 3PTMA 3IARA 3WJSA 2HS6A 2V30A 3WLTA 4EF9A 4K39A 1OSEA 1FQ0A 2GVYA 5G4EA 4TTUA 4KPLA 3O8AA 2E5BA 3CK5A 5FJOA 6XIMA 1QHPA 4UMCA 2XGZA 3P81A 1A5LC 3M6DA 3GG8A 3AWNA 3VCCA 3GXTA 3K8KA 3KOFA 4N42A 3E0VA 2C15A 1EQPA 1B90A 3C2FA 2WMHA 1PAMA 3T08A 1W31A 1FHLA 2QVHA 1DIOA 4Q7BA 5CC6A 4GIAA 4U3AA 4LXFA 3CV7A 8TIMA 1LL4A 4PTWA 3ZJKA 1R2TA 3NCOA 4CD5A 2DP3A 5FJJA 3CAKA 5A5WA 4LALA 3LEPA 3QZ6A 1F74A 4CQDA 1LT8A 3NL6A 5DCBA 4KERA 4IMEA 4PB5A 3M7WA 3MM8A 4NILA 3W7JA 3WH7A 2Y8KA 3AZSA 1VFFA 2E3ZA 2VT0A 3V4BA 4W5UA 1LF1A 3S5YA 3AC0A 1L6SA 4Q8VA 1UMLA 3AMKA 2R1PA 4Z2GA 2CLLA 3RX2A 3L0KA 1MW2A 4PSRA 3IIVA 4U3CA 3WQ6A 5KSWA 4XZLX 2OPJA 1BG4A 3AHXA 1BYCA 2ZA2A 3UJ2A 2PU0A 4XG1A 2WC3A 1ZTVA 3P0XA 2BSLA 4MF4A 1KLYA 1IYXA 5AFDA 4UR9A 1D3HA 3M0JA 3DFQA 4LAZA 1EL3A 3AALA 2QJNA 1QDSA 1IR2A 2PBOA 5EBUA 3EWWA 3L23A 3WCZA 3NPXA 3STGA 3CL8A 5CPOA 5DMMA 2VI0A 3S5OA 3MQTA 1H7PA 1QI4A 1OF8A 4HPNA 4DAFA 1CXIA 2B7NA 2HZGA 1DJQA 1DWGM 1WXZA 1Q6GA 3TOYA 4PUWA 1ALDA 1NSJA 3OBKA 3T0AA 4QRNA 1TVLA 1XBXA 4QQ3A 1GKQA 4OE7A 2AQWA 5M2FX 1BHGA 4XWUA 1YPXA 1QO5A 3HM7A 4C6OA 2I16A 4OTKA 2Y0FA 3WD1A 1PTGA 1Z9AA 1VJIA 2XYLA 2B7PA 3H7UA 4GQRA 4XZWA 1KR1A 1R47A 4HJFA 1AFSA 1VLWA 1YBQB 7TAAA 4MNMA 1EDQA 1QNPA 1QW9A 3CLWA 1KNWA 2HVNA 1RQBA 2Z00A 5DX7A 1UJQA 3C2VA 5I78A 2WYSA 4RW5A 1W8GA 4DWSA 4WF7A 3GNNA 3RAOA 2ZVRA 3TJXA 3BG9A 2J7EA 1N82A 4O1BA 3GDMA 1X1ZA 1DTNA 3L68A 1DYSA 3CZKA 3D47A 4BFAA 5DT7A 1ZBCA 5FI8A 1TRIA 1UIOA 2J7HA 4L1XA 4ENLA 4ZMGA 2DVXA 1V02E 2CITA 3W2LA 4LYQA 4RZ5A 1EHAA 4JY8A 1AH0A 3L5MA 4AD4A 4DLMA 4XIMA 4MNLA 1QPKA 3M0LA 2DZXA 3GIYA 2YLAA 3OJGA 3RJYA 1TUXA 5CZSA 4CEUC 1B3WA 2ZIDA 4JFVA 5HQMA 4XZNX 2XDFA 3GVQA 1JRBA 3C5QA 4MB5A 2XSJA 1E1CA 2C79A 1YMYA 5G1TA 4K1GA 2GFTA 4WJEA 3O7UA 1R7OA 2F6XA 1SM9A 3U2EA 3GLCA 5CJMA 1IE7C 3AMLA 5IFPA 4H41A 3QMSA 3NNTA 4JZ5A 3ARUA 4KFOA 1E5NA 2V5BA 4C6IA 8CGTA 1JDDA 1Z89A 1CEOA 3EEZA 5IHRA 3SW6A 1ONRA 3V5FA 3GU2A 2GJXB 3ONCA 3PNZA 1UP2A 1K8ZA 3E2VA 6REQB 2I5GA 3S47A 1O5QA 4PMJA 3RF9A 4HSHA 5FL0A 1LLWA 3NEHA 2FTYA 3B0XA 3TXZA 3C4UA 1R2SA 1FWGC 2GJNA 4O17A 2TYSA 4GHRA 4LRTA 1GOQA 4LV4A 3WN6A 3AXKA 1RP9A 2DJLA 2YBUA 4X9YA 4UTJA 1OF6A 2OMAA 2J6XA 4LY4A 3VNJA 3GTNA 3TA9A 3PM6A 3UZWA 2NVAA 3CHCA 4GXWA 1YIXA 4B3LA 2FZNA 4H7VA 3SRKA 2XU2A 1YXDA 1TB3A 4TR9A 1TKKA 2AKMA 4U31A 1E0TA 3F7JA 1R3YA 4I7UA 5AN7A 1A3HA 5BRPA 1O5KA 1WDRA 2YX0A 5A2BA 1GOWA 7A3HA 4H01A 1TR9A 3T0TA 3KRUA 3SGZA 3UYCA 1PZ0A 2QNEA 3F4CA 5F4SA 2A0NA 1UR0A 1ECEA 4PMNA 3GFZA 2EKCA 2ZX7A 4GISA 3UXIA 4IL0A 2HISA 5T8GA 5M3WA 3L5LA 1IV8A 1XPGA 3FLUA 4JTKA 3P67A 1I8JA 2F2HA 3N6QA 1PUDA 4M7TA 4Q8QA 3B0PA 4O13A 4J3WA 3GTHA 1ZS2A 4G1NA 3H22A 4BWLC 1BFNA 2NWSA 2JBMA 3E74A 3H4XA 2I1OA 3G1FA 4KCVA 1QOQA 4GBDA 1XIGA 3HV9A 3F4WA 3NSMA 4RZBA 2WHLA 3TC7A 4S3JA 2XVNA 5CZTA 1K7XA 4C1LA 2PDLA 3SCRA 3FSTA 3IS4A 4QDWA 4X2PA 4ZSTA 1AJ0A 3N6HA 1QXLA 2O0TA 2CZVA 2WWCA 3VLYA 2GDVA 4PMRA 5HOSA 1OINA 2X09A 2DSVA 3KRBA 3FJNA 4H3DA 3URBA 2ZRWA 4C6MA 4A05A 1J0IA 5BOOA 2QULA 1YKWA 4HCHA 3DFYA 1NWUA 2IMRA 5I3FA 2QJHA 4WSKA 3T6CA 1JPKA 5KITA 2OOGA 3KBJA 2YR1A 3N11A 2VM8A 3MJMA 2LLEA 4IUGA 2BP1A 3GKFA 1YPIA 5GNZA 4GRSA 3CS2A 3PSWA 3P2VA 1W17A 3VD5A 4FOJA 2XHYA 5DMLA 4F48A 3GX9A 2D3NA 3APYA 1DBTA 1FWAC 4JXCA 2DEPA 4RKAA 2E4TA 2VJXA 1RJRA 3NGJA 1C9DA 4GVIA 7GEPA 2WBKA 2OQHA 1EC8A 3P61A 1W1IE 4ZO7A 1RP8A 1PWMA 3PNUA 1TFVA 1IZCA 1TG7A 3U5UA 2GSEA 2A3CA 3NPWA 3GVRA 4GYPC 3SRHA 3FXGA 1KCXA 3L2IA 2QAPA 4CVUA 1M9HA 1P43A 4QTGA 3LQGA 4H1ZA 4NY2A 3QPEA 3MI6A 4A6GA 5CC7A 2VXNA 3AXXA 1G5AA 2AQVA 3K4AA 3GE7A 3TW7A 4LVAA 3UPWA 4YMZA 2WCSA 2W67A 3U9IA 4DO7A 3ZQ9A 3U2CA 2POTA 3MM6B 4MG4A 2VURA 5C9UA 3MMDA 1Q6DA 5CG7A 1ESWA 2E5DA 3H2OA 2YL9A 4NP7A 3NZQA 3E38A 1S2TA 2GJLA 1J2BA 3WK2A 2ZZ5A 3W24A 3P60A 3CQKA 1E4IA 5AHLA 1G69A 2GLKA 3VDCA 1KKRA 4P7RA 5TF0A 2CZEA 2X0SA 4QBXA 4OV9A 4UOJA 1UOZA 1XJBA 1JEZA 3BAYA 4FHAA 2GJRA 1AK5A 1B30A 3PC0A 3VOGA 5I7GA 1GVFA 4NVTA 4X3ZA 4CVWA 2PZNA 1KBBA 4NJIA 4HHHA 5A8NA 3XINA 3DI0A 4MYAA 1SO3A 1UASA 1MFVA 5A8MA 1V6TA 3GO2A 3NAVA 3LBOA 3N15A 4O14A 1FTXA 4KWUA 3GAYA 1UHVA 3TYDA 2WKGA 3GVWA 1PCWA 1OG0A 2ATMA 2TRSA 3GBDA 4DO5A 3NM3A 3EMCA 2WQDA 3ZVHB 1DWJM 3AXMA 4Q33A 1DVJA 3VFCA 2Z29A 4ZOAA 1SO6A 1PPIA 2AL2B 2IKHA 4MYXA 3FSUA 2XIQA 1RA0A 4HN4A 1VPXA 4GEPA 3CAWA 3LDVA 2OWCA 3U7VA 3ITGA 1VJZA 2XVKA 4AXNA 4YTQA 4GFIA 1H49A 1W2PA 4H6QA 6ENLA 4Z08A 1JRCA 1FWNA 1E6RA 4DI9A 2ZUTA 1S5NA 2NXGA 3G1SA 3KTSA 4D6EA 3W2KA 3UF9A 1ME7A 3UXDA 1B2YA 2D24A 4S3EA 3DKLA 5I3KA 4XKMA 4JYDA 1IEVA 2J62A 3ITXA 4ZL1A 1QASA 3PVFA 5M03A 3THAA 1F5ZA 4HK5A 4FA3A 4QE1A 2C91A 1JUKA 5JIPA 3M43A 4D8ZA 3M7SA 2CW6A 2ZVIA 4ZO8A 3RCNA 3KBMA 3SO7A 4Q8TA 4HNOA 4M81A 1TTIA 3E49A 3GDBA 2DIKA 3VDGA 4ML9A 1O5XA 3MVTA 1K6WA 4GGBA 1R38A 4GO9A 2IPFA 3LCHA 1R0MA 2VRKA 4W7UA 1GK8A 3HTWA 4EP8C 1HO1A 4DUWA 3AJ7A 3K30A 1SPQA 2F61A 4EANA 3RU6A 3OVPA 4UZUA 3CH0A 5RUBA 3HGRA 4TU1A 4G6CA 3NQFA 1MDRA 4ZO6A 2I57A 1MRQA 4C60A 4INFA 1UG6A 7XIMA 4DWSB 4R7WA 2ZE3A 2X40A 1FWRA 5EPDA 4MNJA 3KBVA 3HZ3A 4AF0B 2G3IA 4Y8EA 1GZJA 2GWNA 4FX8A 3PJXA 1E4NA 3MWCA 1EWEA 2OZTA 1HL2A 4HQVA 4GZEA 4IZGA 2ACQA 3UEQA 4BQ5A 1UWAA 4FNPA 1EDTA 1QI0A 2GQ8A 1FA2A 3AHVA 5D9MA 3V35A 2OWXA 4U2ZA 1F73A 1P0EA 1Q6LA 2CXEA 2A3BA 4N9EA 3RHGA 1VLIA 2YA1A 2EPLX 2O9OA 1C90A 1TWSA 1GOIA 5CZJA 2QT3A 1FWSA 2DU2A 4WLCA 2FFIA 3MYPA 5CC5A 2AGTA 3MJYA 1FP8A 3ZLHA 4MFDA 5D9OA 3MM5B 4MAZA 3UZYA 2CPUA 5FEPA 5GEPA 3CZGA 3S2NA 1NVMA 2ZZ2A 1FH9A 4DZAA 4L5ZA 1SJCA 2HJPA 1SFJA 3PWGA 1SZEA 5CAHA 3JW7A 2CZFA 2G96A 4MDPA 4LWWA 4AX6A 3FCPA 3FYOA 3DGRA 2WVVB 4BKNA 4DF0A 5A6KA 1V3MA 2ICSA 1SGJA 4IG2A 2VENA 4XTDA 1E55A 1JI1A 3MHUA 3BCJA 4BF5A 3TK7A 1FXQA 3T42A 1EBHA 2XIMA 2FGZA 2VGIA 4DIAA 4FR1A 2CWXA 4B4HA 2QQ6A 3RCMA 4OBRA 3C0LA 1I9CB 2QMKA 2VHLA 4LUSB 4HZMA 1I0DA 2Z26A 3OVRA 3PZNA 4AX7A 4MWAC 3M5ZA 4N9BA 4HTBA 3BGAA 1GJUA 3KOZA 1N8WA 4LEQA 4Z1CA 3BG5A 2A79A 1D2KA 1JUBA 3WBAA 3I6EA 3FIGA 1WP6A 1WB0A 4MB4A 3TJ4A 3DUGA 3NQDA 3ZT7A 2VDGA 3CNYA 1O5RA 4KEMA 1U1JA 4XZ9A 4GH1A 2JK2A 3WJWA 1IR1A 3MUXA 1F07A 3UPBA 1R3VA 1A0CA 1KLZA 1YDNA 3ABOA 3UR2A 1B9ZA 4TVUA 3ZVHA 4LV9A 4RNFA 4R9OA 5BXTA 1Q66A 3G8RA 4QAIA 2MANA 1DL3A 2PU1A 3OYZA 2VWTA 3R1ZA 3P3BA 3G22A 1WDSA 3AS2A 4ERAA 1ECQA 3DFPA 1W5MA 4ASTA 5JBDA 4LAKA 2REQA 1HO4A 3VKDA 2WMFA 1VF8A 2I9EA 3UZJA 3UETA 3SDOA 1GQKA 4L4LA 4KWOA 4H4IA 1QOPA 2YLLA 1FFRA 2I17A 2ZYFA 2V5LA 8RUCA 1B31A 1HXJA 3VKQA 2X42A 5A8QA 2GDUA 5IHSA 1XLEA 4CU6A 3FS2A 2PTZA 1PDYA 3GWQA 1AH3A 3O3RA 4IL2A 1OT1A 4AEEA 1ELSA 5JBFA 1W1TA 3MV11 4GXMA 3TE9A 4C5ZA 2YFOA 1DV7A 2J27A 1ICSA 1ME8A 3T78A 2OR2A 1DJZA 3V0UA 4ALDA 3A64A 1B4EA 4XD5A 3VINA 2R1MA 3U7BA 5AZ1A 1V7YA 4ADTA 3WEMA 1S2AA 4JN7A 3T09A 4PUUA 2WZEA 3WUEA 1C8XA 4FEZA 1J12A 5E6ZA 1EYEA 3SECA 3G1RA 4IGNA 1KD0A 1NU5A 4CD4A 3MTWA 3T2OA 3ZM8A 4DWSD 2WZTA 3WLPA 2PC8A 1LUCB 3F4DA 1C93A 3VFLA 1TV5A 4JIEA 3FHQA 3Q65A 2VZUA 5LXXA 1ZNNA 1R3SA 4JICA 3IEBA 3GC5A 1CT5A 2PDJA 1QK2A 3BZJA 4DBWA 2AL2A 2PLJA 2WKLA 4D6FA 3QZAA 7REQA 2PD5A 3EKGA 1ISWA 1P0NA 3WQ8A 2YBTA 4MWAD 5I06A 2DH2A 4O50A 2YIHA 1CB2A 1TJ1A 1VHNA 1AVAA 4AEFA 2VVNA 2D22A 1TX2A 3WLIA 3AHZA 4UFHA 2PLKA 4MNKA 3AICA 1K9FA 4OOUA 5CSRA 3ZMRA 1MXDA 2XFYA 5T9BG 3WYZA 1PZ3A 1LRTA 4WVXA 2FDSA 1MEIA 5DXYA 3EWYA 2ZQ0A 4A3RA 3KRSA 3INPA 2HMCA 1J79A 1A5CA 1H7NA 2CKSA 2WHJA 3G24A 2XIOA 3HN3A 5KZEA 3ZLFA 1FWHC 1IEWA 4HP5A 4PSPA 3BAKA 3B0MA 4TTGA 1GOXA 3KL5A 3UYIA 3TMQA 3ZJ8A 3PTQA 1IEQA 4PMZA 2QYGA 3OP2A 4W86A 4FO4A 3MKVA 3DGBA 4XO7A 4H9ZA 3LMYA 4BI7A 1ODZA 1J6OA 1WAUA 4CNNA 1DJWA 4H7ZA 3FYYA 3W29A 5A2CA 4A29A 1RY8A 3KVLA 2OSXA 3G8EA 2QCEA 3NM1A 3L4WA 2WPBA 1WDDA 3KS5A 1JCMP 3LENA 4HPJA 1CGUA 4W93A 4JIHA 3FOKA 2WNZA 3PTKA 2D2JA 1SSGA 4PCFA 3TTYA 3WL0A 3RM9A 3AMDA 3I4EA 2PWGA 3IIOA 4OVXA 3KOYA 4TMCA 4Y2WA 1EJ7L 3T05A 1WOBA 1M68A 1YYAA 3CIWA 4FB7A 3GAKA 3KBNA 2INZA 4IOTA 3IUHA 3BJTA 4WK9A 2QMJA 2YJQA 1GOKA 1HP5A 2V4JA 4JHZA 3BMXA 3MHFA 3B9EA 1J10A 4Z1BA 3PG9A 4GYPA 4AG0A 3NJ3A 2GGEA 1HW6A 1DJGA 3ARRA 4C6EA 2PDPA 3WH8A 5C2GA 2XM1A 2VX7A 4LC6A 3OO2A 1HZYA 2FLIA 3LV6A 3B8TA 3W23A 2D2OA 4B90A 1QPOA 1VD6A 4S2CA 1W3TA 3EX6A 2DVUA 2ZZ7A 1MNSA 5EMYA 3KVKA 3VMNA 4DPPA 4E4UA 3W7HA 1JZ6A 1XINA 2ZE0A 3OZYA 3A22A 3L4UA 4FLRA 3W86A 3W1TA 4PFMA 3TJLA 4YIWA 3B0JA 2Y8UA 3EX1A 3IV8A 1NWRA 1B9BA 1R6WA 2QDGA 3W1MA 1D3CA 4DO4A 3OGSA 4D6IA 1R9YA 3E2SA 4QITA 2DJXA 1D3GA 3KM8A 1W5PA 3CJPA 2J7DA 1FWJC 1EEXA 3H54A 4HNLA 3C3NA 2DW7A 3HFTA 1TIWA 1E71M 2BX7A 1XKJA 5CGQA 5A6SA 1OX5A 5EL1A 3W1LA 3EXRA 3AWOA 4LOCA 3E5PA 4V27A 3A4JA 2XH0A 3MKKA 2OEMA 4R53A 3D6NA 3N25A 1IHIA 1GCYA 3K46A 3NXLA 1GG1A 1KRBC 3W1PA 4QNWA 2PZ0A 2FFCA 3GXMA 1OFDA 1V3KA 4GJJA 1N8FA 3SEPA 1XQLA 2XM2A 1KXHA 2CC0A 4GFSA 3VLZA 5AC7A 3TN5A 2UY4A 3A3XA 1LCOA 4IFRA 4FNRA 1KFKA 1S2VA 3TC3A 4N9CA 3CTLA 1TPB1 4W7VA 2DUZA 2YB4A 5FD0A 3K5XA 1RPKA 3CUHA 1JF6A 1NP0A 5HBFA 4KWVA 5H2ZA 3ARWA 3LNMA 5AY7A 2CESA 2ZUUA 1TE1A 3LA4A 4BQ2A 1YTDA 2J7CA 3IGHX 4IFKB 3T4CA 2PDKA 3MCNA 2PODA 4N0RA 1F4HA 3EKZA 1TTQA 2BOEX 4FIRA 5J5DA 3Q45A 4GBUA 4JCLA 3VGEA 3IJ7A 4YTSA 4LRSA 4GY0A 1XYBA 2Y5EA 2YW4A 3URNA 5C7VA 2INFA 3IK2A 1WYIA 4XTIA 4JKMA 3MDUA 4O18A 3B0GA 1QJWA 1R3RA 4UTHA 3N19B 4L1WA 4GNJA 1F9CA 4K7YA 3LYEA 4HTRA 2QIWA 3UZZA 3L2LA 4KRTA 3VNLA 1KRMA 4TV5A 1CGXA 1VRDA 2YKKA 3GZ3A 1YBQA 1EA0A 1LUCA 1W8SA 1K6AA 1SJAA 2PRHA 4NZ1A 3H4GA 4GQ0A 3VOFA 2ZRYA 5AC4A 1UZ4A 3S6OA 4UFJA 1AMYA 3I3DA 1CYGA 3TTEA 2E8ZA 3LHTA 3KP0A 4O1EA 1JGMA 1K03A 1ZU8A 2X7VA 3AHTA 3APGA 1BF2A 1CTNA 4HPHA 3BLDA 1SZRA 1OZQA 4M51A 4Q3MA 4AWUA 4NZ3A 2AOSA 4LEFA 2XISA 2Y7FA 1M6JA 3W7DA 5LIXX 2V2HA 4GIYA 3EX2A 3N3MA 3VNDA 1EH9A 2PDXA 4AD5A 3I68A 4FXRA 3UNDA 4XD6A 3OA3A 2WM0A 4EE9A 4DX3A 2BOFX 5LIKX 3MMAB 1H7RA 3GS6A 4FF7A 1EF2A 3OIXA 3GH4A 2NXIA 2PGWA 3EKLA 2VD9A 4UFIA 1DTUA 3M41A 1LP6A 4JQ2A 3K8MA 4UQAA 5A2AA 5IM51 4PYSA 3DZ1A 5DANA 3OBEA 5LNUA 1K70A 4J4KA 1IZJA 4JTTA 5D2TA 3W85A 1V6WA 3MBDA 4IG2B 1KWGA 4Y9OA 3L4ZA 2FYMA 4D9PA 4QJ5B 3PUEA 3QW4B 2JF7A 4R3UA 2PGEA 1YEYA 4DJDA 2DW6A 1ZAHA 1V03A 3RN6A 1ITUA 3QKZA 1TV7A 1CNVA 1F6KA 4NJGA 3BXWA 2VX6A 2GGIA 5HJLA 3DC0A 1GKPA 3ZSSA 1OC5A 1THFD 4L56A 1E0VA 1WDPA 3UR7A 4GO8A 3AIEA 2R9RA 3B9AA 1C8QA 1TWZA 4OOZA 2B7OA 3H4WA 2QDHA 3VE9A 2H90A 5I77A 1ZBVA 1WV2A 3AJXA 3B40A 2BWGA 4ATLA 5CJ5A 2XINA 4GX9A 4GUJA 5A3HA 5CPSA 2Y63A 3H2CA 4WJXA 4YN5A 1C9WA 1X6UA 3MWAA 3G0XA 2FVKA 3RXZA 5C7HA 1PIFA 4IXXA 3ENLA 1HT6A 1A3XA 1LJYA 2G3MA 3RMJA 4J9JA 2FZDA 3VZZA 3THCA 5AYXA 4JKKA 3CYVA 1EIBA 1PYMA 3AZRA 2WZHA 3WK1A 1QNRA 3ZS4A 1P6BA 1FWWA 5D38A 1Y7VA 4UFMA 3NDOA 3L21A 3OLIA 3IJ6A 3ITLA 3FDGA 4ICMA 5ABEA 3R5EA 4QNEA 3TROA 1NWTA 2P53A 3A24A 1LZOA 4I9AA 5LHFA 1AH4A 4D6CA 4UC5A 1DXEA 1XGDA 7ODCA 3KLLA 1J0ZA 3BPWA 4WSJA 3P84A 1IQ8A 1IT0A 4AUBA 2WLYA 8XIMA 3WBEA 1Z32X 1CXLA 1A5AA 3N04A 4LB4A 2RJHA 2OLSA 4PCSA 4WEVX 2P10A 4JHOA 5MHBA 4LAOA 1FKXA 1OIMA 4LCRA 4AZ5A 4GK8A 1A5BA 3BLFA 2CHNA 1K1DA 3W4RA 3QHNA 1A4LA 2V81A 2NUXA 3TNOA 5F4XA 4PBFA 1PVNA 3EDEA 2EGZA 5LXEA 2ABAA 1JDEA 1ZBKA 1Q6QA 1EDGA 4OZOA 1IIHA 1H7XA 1BXNA 4C7FA 5IXEA 1JFHA 3B8VA 4YL2A 3PS7A 1E6PA 3FKRA 3QQWA 2ANUA 1YHTA 4BCEA 1MMFA 3GTFA 3S1VA 2QJIA 3O0KA 1XX1A 1HKJA 1F05A 1XBVA 1JPHA 1A5SA 2WBGA 3G1DA 3N6JA 4HA4A 1WDQA 1ZQ5A 4KBXA 1S2UA 2HXUA 2DY3A 5EGRA 4W7WA 2UY2A 3JR2A 3LPGA 1CBGA 3J7HA 1WXJA 1C8VA 1K7EA 1W32A 1QO2A 1V77A 2ONEA 3LB0A 2XWEA 4HSOA 3II1A 2OELA 2QKFA 5T91A 3ES8A 2PA6A 4AHPA 4KRZA 1O95A 2IKIA 2YL8A 5JXQA 4JTIA 1Y5VA 1OFBA 5BXSA 5PTDA 3WLSA 4JTJA 4PUEA 1FCBA 2WJZA 2CBVA 4XZBA 4RW3A 3GKAA 3CPRA 3HG5A 4G1KA 1KXVA 3UA4A 1ITQA 9XIAA 1J9YA 4PGLA 3WMSA 1UQYA 6A3HA 1I2RA 1MEWA 4B5XA 3URAA 5A6LA 4AWEA 2BLEA 5AECA 5H8MA 3L4XA 3UY7A 3PBGA 2A85A 3CEUA 5D30A 2Q02A 4QDMA 1BVWA 3CWHA 3AYVA 1J0JA 3MMAA 2V38A 4LUTB 5HAOA 4MY9A 4UTUA 1T6MA 3W28A 3O06A 1H51A 4GI8A 1P0BA 3DHUA 3R7MA 2C7FA 3LBMA 3M0MA 3I4KA 2DZUA 2D0HA 4ACYA 2QPXA 2IW0A 3BGJA 3EPMA 3A5FA 2BB0A 1J2WA 2AAMA 3K13A 3IJQA 1PTAA 3USBA 4AZCB 4XD3A 2HPIA 3TN4A 3UQNA 3QQ1A 4Q8OA 2GUYA 4DJED 3KX6A 1C7SA 2C14A 5I23A 3S9ZA 2ISVA 2DSZA 1QNVA 3D0CA 2Q8ZA 3ALFA 1KCZA 1POJA 4DB7A 3QSRA 1QFEA 4L6DA 1VFSA 2DSWA 5CCZA 4RXGA 3EZ4A 4NNBA 2Y8VA 4E3TA 1NFPA 3RYSA 1V08A 3VIJA 3AIQA 5GJNA 1GQLA 3OB8A 4MIMA 3SCNA 1NQ6A 2ZKMX 4M6UA 4A3UA 3WNKA 3M0HA 5L9FA 1GVIA 3GH7A 3MO7A 4FXFA 2AAAA 2WWDA 1EA9C 3C8NA 5E1QA 4DF2A 3ANYA 4G5DA 1QHZA 5LSMA 3KHDA 5U7SA 1SO4A 1LWIA 4P8XA 4DPQA 4KEUA 3SN0A 3OW1A 4WY0F 4YWIA 4HBKA 2WMIA 1XH0A 4H83A 4LBRA 3T0CA 3A3WA 3MZ2A 1ZJ9A 3T44A 1MFUA 2YYUA 3A13A 4CQAA 4JEQA 3M0ZA 4LVDA 2Z1XA 3MMCA 3LS9A 2PB1A 5C71A 5I6SA 2Y6ZA 5G2WA 3CO4A 5K9XA 2PDFA 1EPVA 2FPTA 1TV8A 4GY1A 2NX9A 4GVHA 1TQJA 5K9CA 3TC6A 3BOXA 4GYFA 1PXGA 3H53A 4R5EA 1E4LA 4HSNA 3B9DA 1XR2A 1PEZA 3KVMA 1CPUA 3V5OA 5A8PA 1PKMA 4LF1A 1DIEA 5HDRA 3BSMA 3SQSA 4IHCA 4ZOEA 4PMVA 1TR1A 2VEFA 1US3A 1XG4A 8A3HA 2PPGA 5CJNA 3TQPA 3GY1A 1G7UA 3VILA 2OFJA 1F7BA 1AOPA 5HPOA 2VC5A 4I5XA 2E25A 4FK9A 3FDKA 1EGMA 4F0KA 1C8YA 4Z2LA 2FVMA 3CO8A 5D32A 3QH2A 5XIAA 4JN8A 1CLXA 3A23A 4M0XA 2HE8A 2GJPA 4QQUA 2CBUA 4DAIA 3QYQA 3QHOA 1TMHA 3AISA 4Z2IA 3GUWA 2R91A 1NY1A 4S3KA 1Q7MA 4UTIA 3CIXA 2BXZA 1Q7QA 4MOZA 2B4GA 4HD5A 4QFUA 2YXOA 3AIWA 5ECUA 4ZCWA 4DRSA 3LSBA 3F5KA 2BDQA 3RG6A 3M16A 4GJ1A 3R10A 1GHRA 4XBKA 3V75A 3MMBA 4EK7A 3KW3A 1ZCOA 4NKCA 2JKEA 2VD8A 4YTRA 3C52A 1R3WA 2Z25A 4QJ3B 1H1ZA 3DFOA 1EXPA 5I3HA 3LLXA 4UNIA 4PRRA 4HPXA 2FB3A 3H24A 1LL6A 4I5RA 4LBSA 1VPYA 3ZIZA 2QLYA 1MDLA 2ABBA 4Z0JA 4TX6A 1XYZA 1ZAJA 3L4YA 1JZ8A 4RE3A 4C6CA 3GIPA 2NQHA 4YHEA 4AH7A 3BUVA 4J27A 4B3KA 2WLZA 2TSYA 2ZTJA 3W1XA 1FXPA 5AVNA 4J1OA 3WSUA 2E77A 4EPKA 4ZQRA 1SW7A 1B5TA 2ZC1A 4E0CA 4K8HA 5G5IA 4LQ1A 3H7RA 1LROA 5HWMA 4TVCA 1UB3A 1R8LA 4MZYA 2WC4A 1DIKA 5D02A 3STCA 3UWVA 1JXJA 4B5UA 5F2GA 2XZ9A 2YCKX 2PFHA 1G4TA 1ITXA 3N14A 4LS1A 1SW3A 1BYBA 4AC1X 2OYKA 3R89A 3N4FA 1B3XA 1V51A 2CNCA 2X1IA 1TVNA 4IPPA 1SO5A 4I8DA 3TZFA 1Y0EA 2BFGA 4ONVA 3KP1A 1SVDA 1XIEA 3NURA 4N4QA 2VZTA 2FH8A 2ALRA 3WNMA 1UA3A 2NX3A 5CLTA 3M6YA 2Q01A 2X0YA 2YA2A 2IPWA 3IACA 3LHWA 4Q4KA 4AIOA 2DH3A 1S1PA 3IRDA 3IJ8A 4W4QA 3QM3A 3HIJA 2PRLA 4AZ6A 4XAZA 1I2PA 2XPKA 1AW2A 1WBHA 3N2BA 1WZAA 1EOMA 1REQA 4O1DA 1M41A 5LIWX 4UTTC 3DAQA 1QWGA 2PGRA 3BC9A 4JTCA 2EPMX 1H50A 3E5BA 1UP0A 3M5VA 3RNDA 3DFHA 3MKCA 3GIQA 3CWNA 3BLOA 2Z6JA 4A2RA 1XBZA 2OX1A 4JTGA 4NNCA 3MUZ1 3AOFA 4K3ZA 2W9MA 4QCFA 3BMVA 1DOSA 3MM7B 2DT0A 3HGOA 1M03A 3PK7A 4JQ3A 4WZHA 1AJ2A 1UUOA 4W85A 3GW3A 5HULA 2E68A 3RILA 1PKLA 3PZVA 4S3GA 5EMUA 3GDTA 3IVSA 5DO8A 3UG3A 4F0RA 1J5TA 5CSSA 2RDXA 2PDNA 4O0QA 2PDMA 4DJFD 3N29A 1VFLA 3NQ7A 3OLEA 2TAAA 1EPXA 4JNZA 5I02A 4P7QA 5FEWA 2BGQA 3BW3A 5CKSA 3TYZA 1TZ9A 1G4SA 4JN6A 5I0DA 3AI0A 1L9WA 3W00A 3NOYA 5HUOA 3GNXA 4WKHA 3JUGA 1W3JA 3TR9A 2E1DA 4NX5A 2GQ3A 3SFKA 1LQ0A 1Y5XA 1P1MA 1XWYA 3OG2A 5F1UA 3U4FA 3C56A 3H8AA 3RX3A 5D2VA 1M3UA 1U30A 4FP1A 4ZQNA 3SCQA 3WLHA 2VELA 2DZPA 4N7QA 1WKYA 3H2NA 2E8YA 2VC7A 3PZTA 5H8UA 4RV8A 1ZP3A 4CN4A 3ARYA 4AU0A 1HNYA 1HKWA 3DBNA 3JS3A 4PRWA 5IDIA 4B16A 2UWFA 2D1ZA 5B7ZA 4M24A 3R25A 3G1HA 2EG8A 3UWWA 3STPA 2G97A 3SY5A 4WUIA 4KKXA 3W82A 3OQ8A 2JFEX 1JL8A 1CIUA 3CZLA 1XCFA 3VOIA 4D1IA 4Y6GA 4E5TA 3ARSA 2A3EA 3KL0A 4V15A 3VIOA 1SQ7A 2J7FA 2QCDA 1NOFA 4NL1A 2P88A 4UQCA 1K77A 4IMFA 2GGJA 1P7TB 4P61A 5G2IA 2PDUA 1R86A 5AYYA 3CUZA 4HMNA 1AG1O 3CM4A 3MSYA 3W6YA 4LUTA 1E40A 4XO6A 4CCZA 7REQB 2YXXA 1I2QA 1AD1A 3NVTA 1GORA 4JTAA 2E7FA 4KS0A 1HVXA 3AXIA 3HQPA 4C6NA 3NEVA 5HMFA 1CCWB 3C3UA 2DT2A 1LWJA 2QCNA 1GOOA 4LNCA 1H41A 4PZVA 3IIXA 3W0KA 3W71A 1F2JA 3RM8A 1A47A 1XCWA 3THDA 4HT3A 1T96A 2DT3A 1G7VA 2WZIA 1U5VA 3AROA 5C8BB 2V5KA 4K68A 2W66A 1WKFA 1AQ0A 1Q8JA 4ZB2A 2DSKA 2WHKA 4C1NB 3ZSTA 5A6TC 4K2SA 1MI3A 1P6WA 4OHQA 4GUFA 4CD6A 3B4YA 4NAEB 3S42A 1QI3A 3I10A 4M6VA 1JUEA 3BLLA 3LN3A 5DF0A 2PI6A 1J11A 2D23A 1MW1A 3U48A 2BVYA 2BHYA 5MF5A 3DESA 3IJLA 1S3HA 1JZ7A 2ZXDA 3PAOA 1A50A 1XG3A 4OBTA 1QTWA 2OO6A 2EBNA 4QAWA 4IPLA 4AMAA 4XVDA 3Q67A 2ZICA 3KFTA 4BEQA 1PWLA 2O7SA 3L7RA 2REQB 1DORA 3OBAA 3IK4A 2HS8A 1OFOA 4JD4A 4MJ4A 4AVOA 4Q32A 4UR7A 1CXEA 3U57A 2UY3A 5EYWA 2NSXA 2J74A 3SN1A 3K1GA 2W3ZA 1VKFA 3VDBA 3W37A 1WKDA 1CW2A 1AL7A 4QSHA 5FCZA 1PV8A 4FX7A 1QR7A 4IPIA 2RAGA 5LNRA 3DENA 5ABTA 3SCWA 1DWHM 3QRHA 4JDBA 1O7AA 4ZA0A 1UWUA 1GYLA 1KO0A 3BJFA 3BGGA 1P4CA 2QUVA 2PTYA 5IBXC 3KTXA 5LIUX 2VZSA 2Z7GA 4GUGA 3KOWA 1GQIA 3E02A 3WH6A 1O1HA 4KH2A 1KM2A 2VTFA 4JBRA 9XIMA 1MW3A 2Q6ZA 4U4MA 4XBSA