4S3BA

Ispg in complex with intermediate ii
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
402
structure length
401
Chain Sequence
GMRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
total genus 135
structure length 401
sequence length 402
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s3bA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s3bA02
2E7FA 3VKQA 4DB7A 2VEFA 3MM6B 3H23A 2DZBA 3VM1A 4MWAA 3TZNA 4D8ZA 3MMAB 3MMBA 4NHVA 4AOPA 4GEPA 2V4JB 4G38A 1Q8AA 3VKSA 4S3DA 4O1FA 3H2MA 4DJFA 4S3FA 3H22A 4O0QA 3MM8A 4HTRA 3TZFA 2XSJA 1AJ2A 3TYEA 3MM5A 3B0HA 3VKTA 3GEOA 2YCLA 3B0NA 4DJEC 3MCNA 4S39A 2VP8A 3VKPA 3MM6A 1TX2A 3MMCB 4PZVA 4CCZA 3MMAA 3MM9B 3TYUA 4DAFA 2V4JA 3H26A 4S3EA 4S3AA 3V5OA 1AOPA 4D8AA 1Q85A 1TWSA 4DJDC 2YCJA 3TYDA 5JQ9A 3H21A 5GEPA 3TYBA 3MM7B 4S38A 1AJ0A 2VEGA 3TYZA 1Q7ZA 3TYAA 2YCIX 3MMCA 3MM9A 4MWAC 2AOPA 7GEPA 4DJED 3B0MA 2Y5JA 3NOYA 2OGYA 3H2AA 3H2NA 4HB7A 2GEPA 3H2CA 3OR1B 2H9AB 3OR2B 5AOPA 3BOLA 1AJZA 2DQWA 3H2EA 4DJFC 3H2FA 3VM0A 3B0GA 3VLXA 4DAIA 4NL1A 3H2OA 2BMBA 3MM7A 4DJDD 4C1NB 1Q7MA 6GEPA 3K13A 3B0JA 3VLYA 1TX0A 1ZJ9A 1TWWA 1AD4A 3TR9A 3AOPA 1AD1A 4DJEA 1F6YA 1Q7QA 4NIRA 2Y5SA 2H9AA 3OR1A 4MWAD 3OR2A 3VKRA 4S23A 4S3BA 4D9PA 3VLZA 4MWAB 3MCMA 3MMBB 4MWAE 4C1NA 3H24A 4DJFD 3MCOA 4NILA 4DJDA 3B0LA 4S3CA 2AKJA 1TWZA 1Q8JA 3TYCA 4G9PA 3MM8B 1ZJ8A 2XSJB 4O1EA 3MM5B 8GEPA 2Y0FA 2YCLB 3BOFA 1EYEA 2YCKX 4G39A 2DZAA
chains in the Genus database with same CATH superfamily
4WY0F 2EQDA 3IV3A 4GVGA 4LT9A 1EO7A 1RJRA 5CG7A 4HJWA 1ZRQA 5CPLA 4JTUA 2NUXA 4YWIA 2FQIA 3COTA 3IS4A 3RM4A 1PKYA 3HPFA 2UY4A 5GJNA 1Y65A 3GNXA 1UZDA 4IL0A 4C65A 2JKAA 3GNOA 5CQ1A 4GZ7A 1GZJA 3NEHA 5L6UA 3BGAA 4AD1A 3QQ1A 3ANVA 4G2DA 3BJFA 3TYAA 3MMCA 1XDLA 4M3PA 1KTCA 3WLRA 4AH7A 5BRPA 3P84A 2ZRWA 2A7NA 4KCVA 3OR2B 1ZAIA 2HS8A 1U22A 4GRSA 2DZTA 4HPHA 3N2BA 4WDUA 1IT0A 1Z41A 3B0PA 3TROA 3P14A 1K02A 4JDYA 3NQ7A 2BDQA 2NSOA 2YX0A 4OT7A 1UPPA 4YHEA 1RQHA 3AOPA 2WLZA 1F07A 3OR1A 4XSMA 2QPSA 1XPGA 3UZ5A 1AH4A 1H5YA 3SY1A 3VVGA 1N7KA 1YIXA 3RX2A 4A29A 3DYPA 2VRJA 4HNVA 1Q3NA 5I3IA 1QBAA 1EO5A 4PYSA 1C9DA 5C9WA 4KEVA 3MI6A 2XDFA 1DP0A 4WXYA 1CBGA 3CT2A 4IJBA 4DF0A 2VQUA 5IDZA 4UNKA 5HR7A 2XSJA 4D72A 3GXTA 3EPOA 4NU7A 1CYGA 3LB0A 1EOMA 2WLYA 2WMHA 5KINA 1K9FA 2D1ZA 4D6HA 4HOXA 1MEWA 2R8WA 4GMEA 2PPGA 3UG4A 1GORA 1H7RA 5H91A 2P1FA 3UWEA 1X1ZA 1DL3A 4OUEA 2FZBA 3UR8A 1ISYA 3JR2A 4B16A 1BYCA 2NXHA 3H54A 5E09A 1ZB5A 6A3HA 1UW9A 3CMGA 2OO6A 5D02A 1IHIA 4RDYA 4GX9A 1Q63A 4XX6A 1Z89A 2NV1A 4S23A 2Z1WA 2DSWA 1GVYA 2KZHA 3LPPA 2ZRVA 3IJIA 4MGGA 1ZHAA 3VI2A 1JF6A 4GUFA 3GR7A 1XUZA 3DOPA 1MO0A 4BI7A 1OC7A 3NUKA 3BZJA 4KWSA 4Q8TA 4HJFA 3PTQA 9XIMA 1XBYA 1ZL1A 3TK7A 3B9NA 3LCLA 4GNJA 1RY0A 3C5QA 1VEOA 4V1YA 4F79A 1DHKA 1DXIA 5MHBA 2RJGA 3SCQA 2RAGA 5JBFA 4W86A 3A6OA 2HNHA 4QXIA 4PODA 1X6UA 4MY1A 3MQTA 1UR1A 5LZLA 3DKLA 2HCVA 4KGJA 3A22A 4JFUA 3CQHA 2DT2A 1PTDA 1QPKA 2V63A 4GO9A 5DBUA 1L9WA 1GEQA 3B8UA 3WUFA 2YBTA 2DSUA 3H4XA 3VGDA 7CGTA 1Q6CA 1T99A 2WC4A 1UB3A 1UMLA 3FEMA 2RJHA 4L6HA 1DQUA 1U1HA 1FOBA 3B8SA 3KM8A 2VQTA 1WBHA 5FEZA 1MVYA 4DZIA 2TODA 4EP8C 4ALDA 1ML1A 3T6CA 1TX0A 4QS5A 4JBRA 4HA4A 1VFFA 3DGBA 4XD4A 3BOXA 1YDYA 1M7PA 3PVFA 3LCXA 2J6XA 4K1WA 5BRQA 3IRDA 3PWIA 4UR7A 5FF2A 4N9DA 3LCFA 2ZDSA 5A5WA 2HV5A 3WX7A 1PXGA 3MM5B 4RDVA 4RK8A 5AVHA 3RXZA 8CGTA 1DJXA 2D0HA 6TIMA 2PFHA 3W7PA 4NAEB 4P7NA 1W3NA 5LIXX 1W5OA 3DAQA 5FF7A 4GUHA 1UA3A 3WQ5A 4FLOA 3FJLA 2XIMA 3VIIA 2DUXA 4Y8EA 4UCFA 1PE1A 5DFAA 1X7FA 4J4KA 5AECA 3VD4A 4LW7A 4M6QA 2A7RA 1CGWA 3RPTA 1XFBA 5CGMA 3G6MA 3OBKA 1OX5A 3KCOA 2F61A 3KOZA 1B30A 1WOAA 3PZVA 4R3UA 3PZMA 4B5SA 5CBIA 2VC7A 1G0CA 3O0KA 4KWWA 1QCWA 2GZXA 3WJYA 1H0GA 1JXJA 2PE4A 4H83A 4AAJA 2D2HA 1CGVA 2Q02A 2EEXA 3UG3A 4J3TA 4Q3MA 4BJHA 4GXMA 4C1NB 1H1ZA 1XYZA 3CHDA 4C6KA 1XLJA 4YTQA 4O17A 3GQYA 3U5YA 1JG9A 1L0PA 1W3JA 2GQ8A 3SN0A 3A5FA 1GW1A 4LRSA 1WA3A 4ZMGA 4RE3A 2XIBA 1W9BM 4AEOA 2O7QA 4DJDA 4HYRA 1FXPA 2CHOA 1RBLA 4MY8A 3W1NA 5HMSA 1ZJBA 1WXYA 1OQFA 2WJZA 3TXZA 3S6DA 4KIRA 1W1A1 4PBGA 1MW0A 3EPNA 1FCBA 3GHSA 1GOKA 1U1JA 1QI5A 1RQEA 1KWKA 1J0YA 2QDHA 1D3HA 1T40A 4MUPA 3C0LA 2BHZA 4F0HA 1S5NA 1OFRA 3PNUA 3HURA 3DBPA 1O94A 2OYLA 4DVOA 1AMKA 1Z44A 4MSSA 4UTMA 5I3FA 1JYXA 1XDMA 1MUWA 5GNYA 4PULA 3SECA 3BMWA 2WMGA 3V0TA 4J28A 1A0CA 3UJFA 5C9ZA 4JQ1A 3CUZA 4JFVA 3OEXA 3TKFA 4NG3A 1V02E 4R88A 4JFSA 5LHFA 5CPSA 1TSIA 4GI4A 1DOSA 2Y62A 3KBWA 2GUYA 1EIXA 3MPGA 4ICCX 1RK6A 4NL1A 3TCSA 2E25A 4IPIA 3FXYA 2E6AA 1WZMA 3BQ5A 4PMRA 3DG3A 4ACYA 3KRSA 1PIFA 5I5RA 5FA5A 1LYXA 6REQA 1WZAA 4OIFA 3S1WA 2XN2A 2HS6A 2CBIA 3QKEA 1RXOB 4V28A 3KS6A 4JS3A 4QG9A 5A8MA 3TMLA 5HJLA 4UZUA 4M8UA 5HR6A 3W0KA 4IFKB 2ASHA 4M7TA 5XIAA 1RHCA 4P8UA 2FDMA 5D2WA 3WF3A 2NVDA 2X0HA 4H6EA 1OX4B 7TAAA 3KVKA 3L0KA 4DELA 2Z1SA 2PAJA 2ZX5A 2Q01A 1XLDA 4QQ3A 3OZYA 3OZPA 4XV0A 1PDYA 4FAMA 2ZZ6A 4EPKA 5D09A 1G1YA 4WJXA 3T0DA 1EHNA 1NQ6A 4M51A 3L12A 4O57A 4Z0JA 3DFOA 1Z8AA 3G1DA 3WLQA 4S3EA 3H7UA 3B0VC 3W87A 3L5MA 3QSTA 4GXWA 1QXLA 1REQB 2XSAA 3U7VA 3ATZA 1XFCA 3EGJA 3LRLA 1A5SA 4K68A 3MKVA 1NP2A 2BB0A 2GJLA 1J10A 1OFDA 4LUYA 4ES4A 2J79A 2NX9A 3CPRA 3R0UA 3UXIA 4LBRA 4HK7A 1E43A 3FXGA 5I79A 1TZ9A 2V8ZA 3SJ3A 4E2DA 3U9IA 5HPCA 4TX6A 4YCPA 2VR4A 3RAOA 3UCDA 1OF8A 1AD1A 2ZUWA 1SW7A 4HA1A 3UG5A 3E74A 3BVJA 2QDGA 4AZCB 3V7PA 4MWAB 4DWDA 3C8NA 2CNCA 1LORA 5FL0A 3AXIA 1JDEA 4PFMA 4AX7A 4QTGA 3G1XA 1EZ2A 4HNCA 1M5WA 4P61A 1JQXA 2W6RA 1CT5A 2BXVA 3VNIA 3VKQA 2BVTA 3BO9A 3RITA 1JZ8A 1XM3A 4MZYA 2MNRA 3PWAA 1W5NA 4JNYA 4CQCA 1FWEC 3QPEA 3F7JA 4N9EA 4XUYA 3CIVA 1W1PA 2BASA 3QMRA 1O5XA 1BQGA 1I0DA 3P82A 1UC4A 2JQXA 2DORA 4DJEC 1ZPTA 2VTFA 3F4CA 3NQ2A 2RGLA 2BY3A 2VL4A 4W7UA 4O0ZA 2Y89A 2PZNA 2NT1A 4KKXA 4A8RA 1M65A 1F61A 3NA8A 5HINA 4RPQA 4K8HA 1P1XA 3RHGA 5E6YA 1XINA 4GOAA 4W89A 1YXCA 3MHGA 4NQ1A 3CL7A 4LBUA 4IX2A 3BAWA 3NSMA 2Z1KA 3S5SA 3MV11 2ZTKA 1GKRA 1WZKA 3SFWA 1HKWA 1R9XA 2IKHA 3ID7A 3KBJA 2GGEA 4WKFA 3QM3A 4YPJA 4N6FA 5I02A 1VRDA 5RUBA 6ENLA 1H61A 1Q6RA 3EPMA 2WANA 1ME9A 4GGBA 4NXKA 4ZB0A 5T91A 3KOFA 2QLYA 2Y7GA 1NWTA 3AIEA 7REQB 4FALA 1IEXA 4YXGA 4GISA 4XISA 4GUIA 4M56A 3TNBA 1EUAA 1UC5A 3VCCA 4LEQA 2AL2A 4HOWA 2PDMA 5BU9A 2ZA2A 3HG2A 4KEZA 3NEVA 4N42A 2E7FA 4JKLA 3KTSA 1A50A 3GH7A 4QJ5B 1JCJA 1UWIA 4L1XA 4G38A 3A64A 4TIMA 2FZDA 4KRZA 3DHFA 4V33A 2J8FA 4CNTA 1JDAA 3DC0A 3IGXA 1MQQA 4XZIA 5HANA 3N3MA 1LTDA 2CLEA 5DRIA 5A6MA 3AXHA 4AXKA 4WLCA 1A3HA 2HE8A 5C6MA 1OD0A 3S1UA 3M07A 3GH4A 4LY8A 2V5KA 1W3IA 4QGCA 3K8LA 2OQLA 3ES7A 3E49A 5IRPA 1E3ZA 2I57A 3KEHA 1A5UA 5CSYA 2RH9A 1PV8A 2C18A 3DFYA 5DXXA 9CGTA 3B0JA 4ZFCA 1XLAA 3W22A 1NDZA 1JPKA 1MXGA 1JVNA 1RA5A 4FX7A 3OR2A 1UBSA 4TVCA 1OCJA 3P62A 2DZUA 4NF7A 4XKYB 1XIHA 2WZHA 4NILA 2Y4SA 3UWVA 2VI0A 3L4ZA 1ZQ5A 3WJWA 3BW2A 2CWNA 2DZAA 3IIXA 4DLMA 1UBPC 3DESA 1RD6A 3ZJKA 3L4TA 1U1UA 4D6CA 1BXBA 1P6WA 1QAPA 4LS0A 1TVPA 1K8CA 1X98A 2WMFA 3AISA 1EL3A 3AMCA 2QCMA 3KL5A 3G0UA 3HGRA 3K8MA 2YSWA 1YNYA 1DKWA 4BI6A 2HQAA 5EPDA 3R25A 9RUBA 2ZUSA 3MM9B 2X30A 2XN0A 1OK6A 4E3VA 5FJPA 4HMNA 4XQ6A 1Q85A 3E0FA 3KWSA 3S0CA 2C79A 2XM1A 1AZ2A 3A9BA 1H60A 1W3KA 2ALRA 3BV7A 4UR8A 3R10A 3HPZA 1DBTA 3OVPA 4U33A 3UZZA 1SW3A 4TVDA 1DTNA 1UUOA 3ARVA 3QHMA 4XD3A 4JTGA 1HQTA 1BD0A 2BTMA 2BGQA 4LVFA 4LX4A 1KRAC 4DUVA 4MFEA 4BQ3A 3VKJA 5HULA 4C5ZA 1RVKA 2QVHA 4DHGA 1S38A 2WW5A 4RDZA 3TFXA 3POHA 1G4SA 1CXFA 4KRUA 2VVSA 1T96A 4A3YA 2WSRA 4IGMA 1V77A 4QLLA 4S3KA 4CNNA 1RCOB 4C60A 1TJRA 3GVGA 1SZGA 2X1SA 1CI1A 1VFUA 4DO5A 1EGVA 1W5PA 2PGFA 3L7RA 3ALFA 3L21A 3E2VA 4O1BA 5AHNA 4GJ1A 3S1GA 1KB3A 4HPXA 5AKQA 3T2QA 3W82A 5M3WA 2PWUA 3PTDA 4PUUA 3OIXA 4QSHA 3BG3A 4UTTC 3I3EA 3LOTA 2VGBA 4L4OA 5G1MA 5L9FA 3S3GA 4S3FA 1X96A 1MZHA 3LCHA 1VYPX 1YHTA 4AUBA 2X41A 1TX2A 2J4GA 4AYSA 1XG3A 2PLCA 1LOLA 4DBEA 1PIIA 2G3IA 3APTA 1NH6A 4JIHA 3IUDA 5DXYA 2V6AA 1SQ7A 3PTKA 1OCQA 5DCBA 1LRTA 4ZGYA 1CGYA 1QASA 1M53A 3OHIA 4QROA 4F0MA 4GQRA 1TPC1 1W1IE 1A4LA 4Q4SA 2PUZA 4LCRA 3M5YA 3WFLA 1A5NC 1A5CA 4ZOEA 2X2YA 4TV5A 2C0AA 3TR2A 1M03A 3GU9A 1X7IA 2XGBA 3SGUA 5TD4A 1BG4A 3BL3A 1ZLPA 3LN3A 4YMZA 3NQEA 1AW2A 3UBPC 3FOKA 3KLKA 4MDPA 2G3FA 1JXKA 2GFTA 2DW6A 3GDTA 3RX3A 3W1LA 2WXDM 1NF7A 1GW9A 4FP1A 2JIWA 2WQPA 3RRAA 3DHDA 3IJ6A 3MBFA 2HTMA 4I7UA 1JAEA 3W7IA 2JEPA 2ZXDA 1KLYA 3NZ1A 3UJEA 3WQ8A 2XSXA 2PODA 3QZAA 3E2SA 3MM5A 3UR5A 3GEOA 1H7WA 4LS1A 2Y88A 4L80A 3JZUA 2J74A 1KBJA 4CCZA 4ECLA 1ADDA 3V18A 1QNQA 3OOQA 4NAEA 3VINA 2GDUA 3BLLA 3WDPP 1Z9AA 1EQCA 3WNNA 4YL2A 2BFGA 1R3RA 2BXYA 4CEXC 3LM3A 1SJCA 4ZQRA 3H53A 4TMBA 3NM3A 4AZHA 3WQOA 2L5HA 4V2XA 5EA9A 4IOTA 3V35A 3A47A 4IIGA 1H49A 4UFMA 1IGSA 4CLMA 2OOFA 3H8AA 1FQ0A 1QNVA 3EA2A 4MG4A 4PRRA 2VR2A 3C6CA 3FK4A 5DRCA 4LVAA 2WPGA 1Q7QA 3TN6A 3ZFHA 3OQ8A 2JGYA 3V4BA 4YYCA 1A0DA 4FS9A 4C1NA 2F6XA 1OG6A 5C2GA 2Y8UA 5DX7A 3ZIZA 3FCPA 1EJWC 1OYCA 1Q8JA 3W2LA 3SY5A 1QPNA 4JTJA 4Y9NA 3T7VA 3UZXA 3KOYA 5EBAA 2HDJA 2XTKA 3NQBA 4LAMA 2VEPA 3NXLA 3J7HA 3G22A 3HIJA 2DVUA 2EXOA 5FF0A 5BCAA 1TPUA 4NNAA 2O9OA 4GFSA 5FJUA 1H7OA 1LF1A 4LNCA 1V6WA 3TZFA 5FKYA 2GJNA 3GM8A 4ZOBA 2CZFA 3W7HA 3LYEA 4PA8A 4X3ZA 4DUXA 5CPTA 1RAKA 1FUYA 4FR6A 3TYDA 2GJPA 2VCBA 1DWAM 1XYLA 2WC7A 2VR5A 3EDJA 4HBKA 2GK1B 2C16A 4EAMA 2IMRA 2YA0A 5AY7A 1VD6A 4B5UA 3T4WA 3HJZA 1A5MC 5EU9A 2XIOA 4GBDA 5HBFA 1UOZA 2GYIA 1EEXA 3APYA 4QQUA 1J0ZA 1L6SA 1TV4A 1Y8BA 4Q8OA 3UETA 1ZENA 5FJOA 1CGXA 1XG4A 4Q4KA 3LG3A 2Y7EA 1XRVA 3PJWA 3R13A 2WO5A 3CNYA 1GTEA 3CYVA 1WDSA 5LGZA 1RH9A 4JQ2A 3A13A 2XGZA 3VLZA 1U5JA 1HJUA 1LUCB 4MZ1A 3MUZ1 3T78A 4FX6M 3ZJ8A 1KKOA 4TTUA 2QCHA 2CLPA 4FIRA 1GTHA 2YDAA 1GHRA 2BVWA 2PDBA 5FCZA 2VJXA 1IZKA 4LF2A 1TREA 1ZS2A 2ZZ2A 1GWJA 3G1AA 1I8JA 3AJXA 3T44A 3VGFA 2EG6A 4AMCA 4IX0A 2DQXA 3W7RA 3PAOA 3AFBA 4IFKA 4D8LA 3VIKA 5F2MA 1OX4A 4Z42C 2E6DA 4GUGA 1FTXA 3W7LA 2OT1A 8XIMA 3OLDA 1E6ZA 1UKTA 2F2HA 2DZXA 3MW7A 1HP5A 2CW6A 2W92A 4ZA0A 3PJXA 1EJRC 4FLQA 3SRFA 2J88A 5HUOA 3VC5A 2YB1A 5I6SA 1EF2A 7TIMA 4M7SA 3H7RA 1M04A 3NDZA 1REQA 1AVAA 3AS0A 2JK2A 2R1MA 1IXPA 4DJDD 1SJAA 5CPNA 3CS2A 3S9YA 3ARQA 4WSKA 2QCCA 3ARPA 2XFRA 1UWAA 1OBAA 3TV8A 3WK3A 1DEDA 1IQ8A 4ZSUA 1UG6A 2GLKA 3O7UA 5ENLA 3FW6A 3AHZA 3DG7A 4XZNX 1HJXA 3HG4A 3EMCA 1XIDA 1MXDA 1FDZA 3AICA 1QW7A 1KBBA 4DBDA 2QCNA 3RIKA 1SR9A 1HXJA 3UJRA 5BRBA 2P53A 2BS9A 3D47A 4AY1A 3AALA 4Q8NA 4AZCA 1EC7A 3KP1A 2NQHA 4MWAA 3LHUA 4RZBA 1CX9A 2OYMA 5CAHA 1JYWA 3V5CA 5C7HA 2Z1BA 3DFTA 3GW3A 2ZC8A 4H7VA 5PTDA 4MVAA 3TTSA 2PDIA 3WQ6A 3VKPA 4L6DA 1W1YA 2EPKX 1KXTA 1YDNA 2VX6A 4AG0A 4JEJA 3CH9A 5JH1A 3LXCA 3VZZA 5I03A 2PI6A 3PBYA 4LTSA 5JQ9A 4JIQA 1LBLA 2E4TA 1E0VA 1KBIA 3CV1A 1GOXA 3W74A 1TUFA 3CUGA 2CESA 2A7PA 4HNTA 1YTDA 1X97A 1R3YA 3Q94A 2HK1A 3O1NA 1YNQA 4G7EB 3TWAA 4P8VA 5E1QA 3H2AA 3NR0A 5GVJA 2FVKA 3UCQA 4F0LA 3CZ8A 3GBEA 1XISA 1TTIA 2AMGA 2QJMA 2X1IA 2Q71A 4MB5A 5HJYA 1OCBA 5FOOA 1Q4NX 4EOUA 1V3JA 1RZMA 3NFUA 2V5CA 5IFPA 3KCJA 2ZVIA 3G1YA 4AYGA 1PWLA 3W4RA 4ML4A 4EXQA 1S5VA 3HBLA 1L6WA 3HMCA 2E5BA 4DXXA 1EB3A 1M7XA 5F1VA 4JTCA 6CGTA 4GCXA 7REQA 4DF1A 3MP5A 3GG7A 4CU7A 1F74A 4NY2A 3I3DA 4DI9A 1Y5VA 2V5LA 3LLDA 4H2CA 1GYNA 2WOQA 3CWOX 1AG1O 1C29A 3GTFA 5AHLA 2CZ5A 3ARWA 4H3DA 4US6A 4EACA 4UTJA 1U83A 3DBNA 1NWSA 1R47A 2DT0A 1QI2A 2PP1A 1HJSA 3WDIA 5KITA 4R33A 1O6IA 1XYBA 4C7FA 3GXMA 4WQ6A 2RFGA 1W1B1 2OTDA 4HCHA 1QJWA 1XIEA 1XH2A 2UZ9A 1JPDX 2NSXA 3I4EA 3R8GA 2IPJA 4DAIA 2Y7DA 3CHVA 4Q32A 4JEQA 3HM7A 4Q8PA 4O28A 3MY9A 4DBSA 4H9TA 2C1HA 5I24A 3EWDA 4AY8A 3R89A 4R9OA 4MIMA 1MEIA 3TTOA 3WEOA 4S3BA 1I2NA 3USZA 4NI8A 3ZOAA 3N3TA 4L9YA 1KFWA 1GQJA 3QOMA 3BTNA 1JUBA 3GZAA 4C6LA 1WDWA 1UKOA 3AYRA 3MV01 2PA6A 3VDHA 2Y0FA 4B3KA 2FDSA 2ZXAA 4O14A 1Y5XA 1Z3NA 3FN9A 4B3LA 3EB3A 3GX9A 3PB0A 3NQCA 2V4JB 4XKYA 1WO2A 3VFCA 1F3EA 2BHYA 2V3FA 2CBVA 5C7VA 3EBVA 3KVLA 2VC5A 2ZOXA 5EMMA 4GQGA 3RN6A 4W5UA 2ZDRA 1OYBA 3SEPA 3AROA 4AEFA 3SCVA 2G96A 3TU9A 2VKZG 1ITQA 3SN1A 1TWSA 5LA1A 5BZAA 1RCQA 4YIWA 3MM7B 1AJ0A 3QY7A 4G7FA 4WF7A 1WKFA 1TJ0A 3WMSA 1UD2A 2ZE0A 3MM9A 1KFJA 1JUKA 1GPWA 3PM6A 1EEPA 3TSMA 4QE5A 3N11A 1PX4A 1I75A 1IIGA 1VPYA 1XCFA 3MBDA 1VC4A 4OTKA 3AYVA 1XYCA 4JY8A 3TJIA 3KRUA 3N4FA 4NIRA 2DIJA 2W63A 3K5XA 3EWCA 1W56A 4L9XA 1V93A 4A3RA 1LQ0A 3QBUA 3EX3A 1BVWA 4H9MA 1KGWA 2Y8VA 5CH9A 3CV2A 1XC6A 2DIEA 4BKNA 5IFTA 3PJTA 3AXMA 2EKCA 5EFFA 3W73A 2PWHA 4PCNA 2G41A 3WLIA 1ZUAX 4A6GA 2FPVA 3ME3A 3PUGA 3PBMA 3GH5A 1FHDA 3DN5A 3H2MA 2VFIA 3B06A 1SUXA 3V1PA 4AXNA 4Y7EA 4V1XA 4MHBA 2PBGA 3L4XA 4MB1A 1MMFA 3W7MA 4JD4A 1V3LA 1M1BA 3W2NA 1CTNA 2HRWA 1SSGA 1I4NA 5I3JA 3RFAA 3B9DA 3W1PA 1PWMA 1RK5A 4LB4A 1N82A 2QPXA 2R91A 4GYPC 1XD0A 1P43A 1W3LA 1QNPA 3UERA 1ZCOA 2VCCA 1MW2A 2D2JA 4QR6A 4ADTA 4GNVA 3S2CA 3UVIA 3QV6A 3MYPA 5CKSA 4PUDA 4I9MA 5K9CA 3S1XA 2WHKA 3UXAA 3SGZA 2VUYA 3IV8A 2CYGA 3QLLA 4X63A 1UP0A 1FWCC 3ALGA 2PBOA 4KF1A 4HN8A 1KCLA 1FWGC 4QE4A 2YL9A 3OJGA 3AXKA 1XGZA 5EMKA 2ODOA 1L6GA 2E77A 2PTZA 5HDRA 4BCEA 4AFYA 3BLFA 1B90A 2BG5A 3P93A 3OGSA 5FF4A 1KCZA 3BURA 3MJYA 3W29A 2W61A 3MCMA 1I60A 3OYZA 6XIMA 3IJQA 3QYQA 2PEVA 1R7AA 3SCTA 1BSIA 1HKJA 5E0CA 1LWHA 3CWNA 3JU2A 2FMOA 5CJNA 2B31A 3RLHA 4H00A 1TYGA 2FHFA 3ARUA 2EHHA 1P0KA 3T2OA 2Z7KA 4U5KA 3RR1A 3CB8A 4IP7A 2GQ3A 3VIOA 2FKPA 2ZXQA 1V08A 2OSYA 2OX4A 4M80A 4PEKA 5DY2A 3AIVA 5CC5A 2Z4GA 2G3NA 3M0HA 4CQ9A 2OB3A 2VGIA 4ZEPA 5BYWA 3GDRA 5H8MA 4EANA 4OFCA 3LQGA 1QW8A 5A6JA 1VP5A 4ZODA 1LJYA 1V6XA 4CNUA 1CXLA 1H1YA 1VB9A 3B9EA 3W02A 1WDDA 3SJNA 3TP4A 4N2YA 1XYFA 3AIUA 2WSPA 1IYXA 1LG2A 2OWCA 3KZSA 3WEZA 4W93A 3KE0A 1YTKA 1XLIA 1XL9A 1V6TA 3L66A 1K4HA 3WQCA 2PDNA 1WDPA 3C3NA 1SO5A 1M68A 4TV6A 3WZ0E 2LLEA 2BNJA 2YFOA 2PRMA 2YXXA 4XD6A 3NOEA 5CLTA 3HTWA 2VWTA 1A47A 4IP4A 3N2MA 1X8CA 4C6BA 1FRBA 3T55A 3L4WA 3UYCA 1R46A 2YR1A 4AOPA 5FAJA 2CLHA 1ZP3A 3GK0A 2NV9A 2ZZ7A 4TUFA 5A6BD 5HMDA 3WY1A 3I4KA 3BPWA 2XJ7A 3PG8A 4H1ZA 2OZTA 3KLLA 2GGHA 4LUSB 4S39A 5CXPA 3KOXA 3E0VA 3IPWA 4M82A 2QUMA 2ZX9A 1X6NA 4JTDA 3DGRA 3OHMB 1S2AA 3CQKA 3NAVA 5M1TA 3EWUA 4H8VA 1DJWA 4JX5A 5I0DA 3WNMA 2VX5A 2Y5JA 5DT7A 3LBMA 3H2CA 5HWMA 4XAFA 4AHPA 2W79A 1GQKA 2GDQA 3PPCA 3M0YA 1PS9A 2HROA 3CUXA 1NTHA 3BSMA 5HWNA 2GK1A 4S2BA 4E2BA 3TTEA 2QUUA 3W1XA 2CXGA 2OR2A 1N8FA 4Z2GA 3VD5A 4C6CA 4IMFA 3TFCA 4LXFA 3TR9A 1MFUA 3AMLA 5C9RA 5D8WA 3MP4A 3QTGA 4R85A 5DY3A 3K46A 4QLKA 3RM9A 4O1AA 5I07A 1JI2A 2OT0A 4HZ8A 2F2KA 3NXFA 5I3KA 5BXRA 1I6NA 4O8AA 4Z1DA 5G2HA 3IJ9A 2V3GA 3MUY1 1OGSA 3HFYA 1LUCA 4AD2A 3PSVA 4JOMA 1VYSX 3O07A 3VD9A 3GXPA 2INFA 1RP9A 3VFLA 4H9ZA 2QCGA 3EWWA 4CD5A 1DIDA 1EH9A 4ORMA 4PTVA 1TPFA 3WLTA 3MZ2A 1O4UA 1UPMB 4DQWA 4QISA 4W7VA 3PTMA 3S5YA 4BHYA 1VAHA 1DJHA 4D8AA 5JBEA 3OLIA 3AS3A 2WJFA 4L7ZA 1PCWA 3GU1A 1F4HA 4OV9A 4A21A 3LS9A 1YW1A 4MJ2A 4X9YA 1NOUA 1D2KA 3I6TA 2CZEA 1V03A 3QF0A 4H6QA 4ZFMA 3WK2A 5D2YA 1C7TA 3ARZA 5CAKA 5D9NA 1CW2A 3AYSA 1HKMA 4KWOA 1ONRA 4DO4A 3S2MA 1DWHM 1VGAA 4L64A 1JZ2A 1FWHC 1A5KC 4K8EA 1OFEA 1TMHA 1B4KA 3AI0A 4KT2A 4GIEA 3O6CA 4Y9OA 3GFXA 4ZENA 1CLKA 1M6JA 3MJMA 2V3DA 4WD0A 4RNIA 3L5LA 1PYMA 3ARXA 3IVTA 2XIJA 3VGEA 2AKZA 2PDLA 4XAGA 4LRTA 2CFFA 1W2PA 2DH2A 2WJDA 1IZCA 1O95A 3I6RA 1XR2A 3EAUA 1MZRA 4JQ3A 4X0VA 3IK2A 4AB4A 3N2CA 4GACA 2EPLX 2WPBA 3WF0A 1YBQB 1JD9A 4QDWA 3WQ4A 1J2BA 4X61A 2A79A 2J75A 3M0MA 2FPYA 4H04A 5A6SA 5HNRA 2H3BA 4A4AA 3B3DA 3N6QA 1WXJA 3KBSA 4YTUA 3B9AA 3IJDA 1J6OA 1EX5A 4FZIA 2X8RA 1VQTA 1YRRA 2YCEA 2F6UA 2DEPA 4JTAA 3S47A 2DIKA 3DC8A 4H7CA 3D6NA 3FFSA 3IGUA 1SM9A 1POJA 3F4VA 2RHGA 3W28A 3V5FA 3BLOA 2X16A 3SR7A 3W7CA 1V7AA 1O5RA 1GT8A 3MP3A 3OG2A 3U57A 5AOPA 4DJFC 3URAA 2ON3A 4W4QA 3MWAA 4LY4A 1UD8A 3BJSA 1CB7B 3ABXA 3ZT6A 4ONVA 1UUMA 4G7EA 1RPKA 4Z2HA 4GIRA 4CNPA 3CB3A 3VKCA 1XBVA 2CEQA 2ADAA 1KM2A 1OIFA 1TZ7A 1DYSA 3A23A 3N2XA 4CQ8A 1ME8A 1TJ1A 2Q3OA 3VYLA 3AMDA 2ZVRA 3VK5A 3T42A 3WFAA 2W4XA 3C56A 2J8TA 1FH8A 2H6RA 5BXPA 3GKFA 3HA1A 4MNJA 3HPXA 1RJQA 5HAOA 3OYXA 3W72A 2P3ZA 4ADSA 1AK5A 1KA9F 5FEPA 4B15A 2R1KA 4I8YA 1MI3A 3V75A 8RUCA 4I5XA 4QLJA 1AQFA 4UQBA 3VOIA 3K4WA 3RCMA 1GVQA 2Y8KA 4S3AA 4QDPA 2HBVA 3EEZA 3CPGA 1TMQA 1TRIA 2QAFA 1R9ZA 1VF8A 4JKKA 4MTVA 4ROPA 4J3ZA 2E0PA 4UOZA 3C2FA 5HA7A 4KFPA 2V38A 2BLEA 3TW6A 4NX0A 3ZZ1A 3THUA 4FNSA 3NVDA 3QYSA 3UR7A 3KTCA 3ONBA 1WCGA 3UWQA 3AUJA 4MPQA 5T26A 5H2ZA 1VJIA 1R30A 2FH8A 4F8XA 1PZ2A 2EJAA 4HPJA 1N8IA 2B4GA 3WH7A 5K3VA 5E9XA 4FOJA 5REQB 2GJRA 3CHFA 5GJPA 2IQTA 4MWAD 3L68A 4DM2A 1LBFA 5AN7A 3NGFA 2OMAA 2YOCA 4HYVA 2FJKA 2JE8A 3C2EA 2NX1A 3N1AA 3LCIA 4O11A 1HJVA 4LCQA 3T08A 3SIMA 1JDCA 3CQJA 3LX9A 3T8LA 1X8FA 4MADA 1K70A 3GLCA 3CAQA 4XAYA 4FIQA 3THCA 1XQLA 4IJRA 3WLOA 2GVYA 4IPJA 1J79A 4L4MA 3Q58A 1JAKA 1W1TA 3WD1A 3ZT5A 4RW3A 4HHHA 1MWOA 2D0FA 2NUYA 3G3DA 3KUMA 2IQDA 2V3EA 1ECEA 3NJ3A 3WLSA 2PRHA 1IV8A 1OFQA 3CIWA 1SGJA 4D6JA 2GGJA 3LRKA 3UWZA 1BVZA 2YDQA 1QMLA 4DWSD 3WDRA 3QV8A 2PDYA 2V4JA 4W9TA 3Q37A 2V0TA 2Y1HA 3PBUA 5CZ0A 3FVMA 3WD0A 4UTWC 5GEPA 1AQHA 3PANA 3VE7A 4XZ9A 4QE1A 3NZRA 5K9XA 3G8EA 4P8WA 5D37A 1EF3A 4CKQA 3VABA 4IISA 3WNPA 3B04A 1Y7VA 1KM6A 1TPH1 1KM4A 3SB0A 4DBUA 1MQPA 2WNQA 1F6PA 3MM7A 1XIFA 2DUAA 3BE7A 2ZX8A 3AMKA 3S5ZA 2JFEX 1EJ7L 5D03A 2ONEA 4GQBA 5AHMA 3R5EA 4AZ5A 4UMAA 1U5HA 4Z2IA 4UTIA 1E4LA 5A2BA 2G3JA 3B8WA 3CUFA 5CPOA 4AD0A 3UVAA 1JGIA 4H8HA 3MCOA 2O55A 1BKHA 4WDTA 5D9OA 2Z2AA 3WYZA 1KXVA 3L2MA 2YCLB 3MKKA 3KBVA 4NAFB 3MM6B 5DMNA 3SBFA 2HSAA 4OBSA 2W62A 2VC9A 4GEPA 2FH6A 3WQPA 4IPPA 3VNKA 4J1OA 3L2IA 4H01A 2VZSA 1XGDA 1SPQA 1W8GA 4LJ3A 2HISA 4NP7A 2JGQA 3VAVA 1SZEA 2QYGA 3VD7A 3O3RA 4KERA 5DMLA 3RDKA 3CT7A 3UZJA 2DZVA 3PZUA 3AS2A 1OT1A 1RLCL 3GSMA 1IGWA 4WJ8A 1EBGA 2R82A 4MNMA 2NW0A 1AOPA 5I3DA 4IJCA 1ITCA 1ZJAA 4GYJA 4CD6A 2CETA 1EPVA 1QI0A 1LWJA 4AF0B 2UY2A 1PO9A 3FGCB 4CD4A 3WLKX 2YB4A 3BLEA 1PHQA 3SCSA 4M24A 4CEUC 4OKDA 2OODA 1VZWA 3KZPA 1ZCCA 3B8IA 4UTFA 1K8YA 4BF9A 2I14A 4PEEA 3DHPA 4E38A 4GX8A 4DI8A 2E6YA 1ZBCA 1FWTA 2YXOA 4AZ7A 4F66A 3VDBA 1GYLA 1X38A 3TA9A 3OPSA 2PCEA 3LI0A 3M0IA 1LLZA 4TX9A 2GSHA 2BZNA 5DF0A 4Q7IA 2D23A 1S5MA 2V5JA 4AMAA 3MU7A 1G4EA 2XH7A 3GDMA 4LANA 2J9ZA 3GW0A 4PH6A 6PTDA 2Q8LA 5FF3A 1VYRA 1UYQA 4V27A 1G4TA 4C7DA 3IGHX 4PRTA 1N55A 3IIOA 4GABA 4HTRA 1E4MM 1V5XA 1W9UA 3UZYA 3LGEA 4ATDA 3B97A 2ABBA 1V6YA 3RLVA 3CPUA 1S5WA 4PUEA 3XIMA 1ADSA 5G1YA 3BSHA 4R7WA 1NOFA 1CB2A 1GOOA 1BTCA 1Q13A 2GSEA 1QVBA 4QRNA 3TYBA 1UP3A 4A3HA 3TQ0A 4WSHA 3WH5A 1NDYA 3M6YA 4HZMA 1QPOA 2HXTA 1IE7C 4NUWA 3DUGA 4J3XA 1MFVA 3LPGA 3BLPX 1UHVA 3M9YA 2H8XA 4AIOA 4A8IA 1FWFC 1YPXA 3DYMA 3MUCA 4BF5A 3HG5A 4GH1A 3URQA 1VCVA 2OJPA 3N6JA 1NVMA 4TMCA 1K7XA 2QT3A 3QH2A 4PSRA 3TN3A 4X2PA 4XTIA 2G3MA 4KW2A 1MQRA 1HL8A 2E5DA 5CSSA 4MJMA 5LHEA 4KCUA 3TN4A 4B5WA 4LGXA 2I5IA 1XH1A 1TV3A 3MA8A 2E8ZA 2AKJA 3MM8B 3ZMRA 5JIWA 4O1EA 4C6OA 2QMKA 2O9PA 1ICSA 5EBUA 5EB8A 3LZ3A 4E4FA 2PU0A 3U8GA 1VJSA 2ZZ1A 2E8YA 4BY3A 2ZUTA 3TQKA 4MFDA 3SO7A 3M7WA 1P7TB 3UZWA 3NQVA 2YDRA 5HK4A 3UFYA 1CECA 1J6PA 4ZSTA 1OFPA 3CIXA 2GWNA 4NJJA 3BGGA 3KHJA 2J77A 4AWUA 3MWCA 2R24A 5FEWA 1P0EA 1HKKA 3EB2A 3W70A 4LUSA 2WSYA 1EPXA 5J8LA 1IEVA 5AZ0A 2V2HA 3PZ9A 3IACA 3VDAA 3R1ZA 3SN4A 1EWEA 2Q8ZA 3BW3A 3NYZA 3S5NA 3GXDA 4I5UA 1DJNA 3L5AA 1K77A 4DUOA 3PZTA 2F7FA 3W3OA 4IMEA 5BOEA 4PMYA 4FNTA 1FH7A 2PCQA 3KL0A 3E5PA 3QHOA 2CIPA 4ATLA 3TC7A 1KFCA 1ZNNA 3DG6A 2X09A 1G67A 4AX6A 3CZKA 1THFD 3LY0A 1YPIA 1RBAA 4MWAE 3SSJA 1YDVA 4LBSA 2X05A 2QJNA 1TWZA 3SM0A 3ITCA 3B8TA 2IKGA 4G56A 2DU2A 2WNZA 2AQVA 3DX5A 2GWGA 1ISZA 3W23A 5ECVA 1KR0A 2VC6A 1X1NA 2RDXA 3ABSA 4I6KA 3F2DA 4N4PA 2PDGA 4BS0A 4WGXA 4S3JA 6XIAA 3SUTA 2HVMA 4RNJA 3BZGA 2OKTA 1QO2A 3D46A 4NJKA 3STFA 4O0QA 2Y2WA 2XIIA 2J7GA 1BXNA 5AB3A 5C9XA 3GDBA 3HJEA 3WO8A 1K9TA 2FZ9A 5CGQA 2OGJA 1LP6A 4IT1A 3TUUA 1E6XM 1XHGA 1UKQA 3PK7A 5ABFB 4NJHA 4DX3A 6TAAA 1XXXA 2PP0A 4JN7A 4BF7A 1TPWA 3CHEA 4RJEA 4C7GA 3VTRA 1UD3A 5EL1A 3GDLA 1QUMA 4RUBA 3L4YA 3VC6A 3ERPA 4BA0A 3W7NA 3ELFA 3GIQA 3UPBA 2DQWA 3QV7A 3T0CA 1AODA 5LXEA 2PURA 5JU6A 4A8LA 2E68A 3TQPA 4FXJA 5CLWA 5C71A 2ZWYA 4Q22A 4DJEA 2O9RA 3PN8A 1K7EA 4GC3A 2J47A 3KVMA 4Q4OA 5KMYA 3AIBA 1LRNA 3HG3A 4G5DA 4NVTA 1GNXA 1XGEA 2WVVB 4IGHA 1NJJA 4D6EA 3LEPA 4V15A 1U2YA 4LALA 1BYAA 2D73A 2Z25A 4CQDA 1O66A 2DZBA 3P61A 3WMCA 3TZNA 1YQ2A 2Q8XA 4BQ5A 4GGHA 4L61A 2PDWA 2VFFA 5C0QA 1OYAA 4HSHA 1FVPA 4GLEA 1WKYA 5IM51 3KRZA 4Z17A 3U5UA 4XVDA 3P5YA 4BWLC 1TKKA 3PSWA 1OD8A 1V6VA 1ZJIA 1SO3A 2E1DA 2WK2A 2R1LA 2CLIA 1GVFA 5LNVA 1YBQA 1S2WA 3K4DA 5DO8A 3FS2A 5EKYA 1C90A 4RR4A 4DNHA 3NL6A 3MHUA 4GZEA 4K7YA 2Z2UA 2AOSA 2ISFA 1I9CB 2R1PA 2YL8A 2V2DA 2CU0A 2X0SA 1FHVA 1UR0A 1PTGA 3RUBL 1WNOA 4R27A 1PB0A 1TVNA 2XINA 3H2FA 1V0KA 1TPVA 1E0WA 3GTNA 2BVYA 4C6NA 1KO0A 3H7VA 3R7MA 7ODCA 1YLVA 3OBAA 4HCLA 1PJ9A 3KBMA 1H4PA 2GPTA 4Y8FA 1DWFM 1WYIA 4AVOA 3H4GA 1XBZA 1QWKA 1QNRA 2OOGA 4J35A 4MOZA 3NZGA 1XIBA 3M0XA 1JCXA 5C2XA 4TO8A 4UFJA 4WUIA 2J7FA 4KEUA 2E6FA 4R5EA 3T9PA 8GEPA 4AZIA 1E0UA 3PPFA 2DJXA 1KM1A 1XLCA 2W66A 2YPIA 3G1FA 2C14A 4UOQA 3GTIA 4J3UA 3S2NA 4HNOA 5CSRA 3B0HA 1T6MA 1ISWA 3KW3A 2ZZ4A 4FI4A 1W3TA 3QR3A 3W84A 4XIAA 1A49A 2WHMA 4QEHA 2QUVA 4LF1A 1NFGA 3UY8A 3ZXWA 1XKJA 3JS3A 1FCUA 1O60A 1S2CA 4INFA 3TJ4A 2PS2A 1PIGA 3C2YA 2E5CA 5JBDA 1GGOA 2VFDA 3NDYA 4D6FA 3W88A 3IJ8A 3CYJA 4UIOA 2ANUA 7GEPA 3MMWA 1WV2A 5I00A 1EUNA 3VNJA 3ZS4A 2OEJA 3E5BA 2RGMA 2GJXB 3G8RA 5ABTA 4XBKA 1LLOA 1E5JA 3BLKA 3GUGA 4YLWA 4C6PA 3UGRA 2WNWA 3UR2A 3AMGA 4G8TA 1AD4A 3LQLA 1Q6FA 4QJ3B 1Q6GA 4JKMA 3E02A 1VFLA 4Y6GA 1JYVA 3OBEA 1ALDA 1UCWA 2QUNA 4NSBA 4W5ZA 3AXXA 4PMOA 3MSRA 3WD4A 4GK8A 1XBXA 4UMBA 3HMJG 4HYWA 4M6PA 3ABOA 1V02A 4N02A 3QGVA 4GVHA 1V0NA 1JDFA 5REQA 1ZZMA 3NQ6A 1R85A 1LDCA 3BG9A 5DBTA 1L8NA 2OU4A 3VZYA 4AWTA 4J40A 4XG1A 4C5YA 4E8GA 4I7VA 4Q8WA 2AGKA 2J78A 3ZR6A 3QC3A 2TSYA 4WDXA 1QHPA 2FTWA 3STEA 2FHBA 3KXQA 7PTDA 2TAAA 4JHZA 1OF6A 2E9LA 2I5GA 1RQBA 3P0XA 2JKPA 1R2RA 3GU2A 1EJSC 1D3GA 1QR7A 4PR4A 3VX1A 1RSCA 5AHIA 3M16A 1GOWA 1QPQA 3CEUA 1MRAA 5AYIA 3C2VA 4UTTA 3U6WA 4OU1A 3WD3A 5DCEA 1HF6A 5LYRA 1OGGA 5JVLA 4P7LA 1OZQA 2G95A 1RY8A 2PGWA 4LU0A 1HGWA 4P7RA 4AHOA 2EBNA 5I2UA 1NDWA 3L67A 5BWFA 1JZ3A 3HPSA 3WL1A 1SMAA 3BAKA 2QKFA 2R9RA 2Z6JA 3WJXA 1RA0A 4HU3A 5B80A 1W31A 3CWHA 2Y7FA 1H51A 2YA2A 1UR2A 3TW7A 3GNPA 2A3BA 3OIHA 3AHVA 3SFKA 5F2GA 3M0KA 2BGNE 4IQLA 4GINA 3FA5A 2Y61A 4F9JA 1P4CA 2YCLA 4ZQMA 3RLGA 1UH4A 3LLFA 4AU0A 1QI4A 4NAFA 3IUIA 5TNVA 1JNEA 4DWSC 3MM6A 4UBPC 1WBJA 4EE9A 5H8UA 3W75A 1XIGA 5HMFA 1AW5A 1HN1A 2FLIA 3V5OA 1JF5A 4C6FA 1CCWB 3F2BA 4I9JA 4JPGA 4LUTB 3EOUA 5DANA 3E2RA 2D22A 1JDDA 3GNRA 5D33A 4GI6A 4Q8QA 2VOMA 4IPNB 3CASA 3D3AA 1AUSL 1B3WA 1EA9C 2NQZA 4AZBA 2P0OA 2DT3A 1I2PA 4A2SA 2J62A 1P6BA 1T8XA 3BG5A 3LMYA 4AF0A 1W6TA 1PHWA 1DIKA 4K8GA 5GQBA 2EO7A 4HT3A 3FGCA 2CLFA 2PDJA 3U4FA 4KWUA 1KKRA 4QM1A 2HMCA 1KLZA 2PB1A 5LA0A 1K6WA 1VEPA 1TV5A 3EZ4A 2G0WA 1NDVA 4KETA 3UXKA 3W6LA 3B03A 3LNMA 3HGJA 3BAJA 5FJRA 1TCMA 2DSZA 3R8HA 1XLBA 4KRTA 1U5VA 3WH6A 3BICA 1V3HA 1XIMA 2J7CA 1PCKA 3RX4A 3F2CA 1ZY9A 4B4FA 3LCWA 5FAGA 1V4YA 4XUGA 1TMLA 3VUSA 2WMIB 3NPXA 1AQ0A 3B8VA 4NZ1A 4CGTA 4HZ7A 1QK2A 1M7OA 2A3LA 4DUWA 1IT8A 3GC2A 3OW1A 5KZ6A 4CQAA 2R1NA 1NSJA 2B81A 2NQ9A 4HVXA 1R5YA 3WEMA 1LOQA 3FV9A 5A2CA 2QCFA 1A5OC 2YBUA 1SFTA 1PYFA 2BY2A 3G0XA 2WAGA 5LNSA 4YCOA 1ELSA 4WDWA 2OWXA 5BMXA 3N4EA 2PGEA 4HD5A 1V3IA 1F8IA 4DZAA 4N9BA 4UNLA 3BK0A 4UNIA 3CK5A 4ZE5A 2P0IA 3JRKA 4OECA 3FVDA 4OVXA 1GVOA 3GTXA 3QZ6A 2DJLA 4FF7A 2EPHA 1GJUA 4F9DA 1NY1A 3RO6A 3H24A 2VZUA 4MY9A 3G1HA 3QY8A 1VRXA 1XSJA 2P88A 4JZ5A 4M6UA 4W8AA 3EWYA 5E0KA 4F2TA 4PMZA 4C91A 3W1MA 4MJZA 1O7AA 4CQBA 2CKSA 3M0ZA 3N9SA 4H41A 4NHVA 1TFVA 1KQZA 4MKSA 4Q7NA 2DV0A 4O1FA 3CZEA 4GPNA 5AYYA 4R9XA 4WIWA 2XFYA 4JTFA 3ITLA 3MM8A 3VIMA 3OA3A 3PB2A 3P5ZA 2X1RA 1VLIA 3W83A 2Z00A 3AIQA 3A3XA 3VCNA 2ACSA 2VEMA 3MMTA 2GL5A 3LTPA 2POZA 4E8DA 2YLLA 3VA8A 4FXRA 2XVLA 4ICMA 3VM7A 3N25A 3WQVA 4P2VA 5D2TA 1P7TA 1LBMA 3EXSA 1OIMA 3OVQA 3ZJ7A 4HN4A 4O12A 3JVAA 4MMWA 3BMVA 2WV8A 4EVZA 1Z6KA 2G5WA 1FDJA 2WNNA 2QVNA 2ABAA 3T40A 3TN5A 3F5JA 3NZQA 2VD9A 3LCGA 1VFOA 3TLLA 1DV7A 3ICJA 2YFNA 4FF5A 3WH9A 3NPWA 2UY3A 5BU6A 1W32A 2PZ0A 1X39A 3W07A 1KFKA 4PBEA 4NZ3A 1F6YA 3AU2A 4JN8A 4MAZA 2IKIA 2HEJA 4GKTA 1BQCA 4QNEA 3PFMA 5CG0A 2QJGA 3MVTA 4W8BA 7A3HA 1GCYA 1I1WA 2EKGA 4DYEA 3S4TA 3B4YA 3ES8A 2EG7A 1OC6A 5T9CE 1IZJA 4AIEA 3GTHA 1GQIA 4IMGA 4HNUA 1B3YA 4AWSA 3NWRA 4U4MA 4GBUA 1A5BA 5CJMA 1JRBA 5D2XA 5CZJA 1I2RA 4DPPA 4BZYA 1TR1A 4EPEC 5U4NA 4UFHA 4PTXA 3OG3A 4PZVA 2XU2A 3RPMA 1EKOA 4QEEA 4KQNA 1A0EA 1RUSA 4O10A 3GO2A 1MRQA 3PUOA 1V79A 2DFAA 3STGA 5H8PA 2NUWA 3VOHA 4OUIA 1KM5A 3A4AA 2XVNA 2D2OA 2Z1XA 2IXVA 2TYSA 5A8NA 2A4AA 1TG7A 2O9TA 2HWGA 2QHAA 3MHFA 1PKNA 5U7SA 3LMZA 3M47A 1D7KA 4RPPA 2GEPA 1KD0A 1C7SA 3O06A 3LPFA 1AJZA 5ABFA 2YYTA 1JFHA 3NO3A 1C8XA 4Z2JA 3PUEA 4DO6A 3VLYA 3HU7A 4Q4RA 5D38A 2AMXA 2AAMA 3QGAC 3NQFA 4FLSA 2WB5A 4US5A 5F1UA 4DO7A 2Q09A 4PGLA 3WQFA 3TYCA 1UOKA 1MXSA 1MW1A 2AQOA 4E6MA 5KZMA 2E9BA 3C86A 2X7VA 3OQEA 4LAZA 2FB2A 4H8UA 3SCNA 4B5TA 5A6TC 5AOUA 2WVVA 3P60A 3MMUA 1DJZA 3LD5A 1CENA 3M4HA 2W9MA 3TAKA 4QITA 2VMFA 5FL1A 1YXDA 4HHLA 1LOSA 3M1ZA 2WJEA 4L1WA 3PP7A 4YYFA 1BTMA 4XTDA 1Q4WA 1E1CB 1XLMA 4X0NA 1JUEA 3GS6A 2FMNA 5D32A 3UU0A 4ATWA 3N73A 3U2EA 1EC9A 3QHNA 1W9XA 3H21A 5IXEA 2NXIA 3OLEA 3RG6A 3F03K 3AHTA 4FEZA 1SSDA 4YNGA 5HOSA 3SSZA 4HQVA 4IMAA 3WDQA 2E28A 4F2UA 1UWSA 2VELA 1RV8A 1E40A 2W91A 4MKVA 4EKJA 3EOLA 2FPTA 1C8VA 5A6AA 3SQMA 4FNPA 3IAPA 3ANYA 2QF7A 3F4DA 3GFYA 5IHSA 2QGYA 3SUSA 5D9MA 4DXVA 1EJTC 3IIZA 4MLRA 2J7HA 3TIMA 3VE9A 3E0WA 2HBXA 1BRLB 2XSBA 3ISIX 4OV4A 3TCEA 4HIBA 1QOQA 1Q2SA 4CD8A 3BOFA 3N12A 2YCKX 5FSEC 2CLOA 2EF9A 2J66A 3VM1A 5K4ZA 2DZSA 2ZYFA 2GVGA 3N2TA 3P81A 1R6WA 4M5PA 4UOJA 4L1GA 1UWQA 4X2RA 1NOWA 2EG8A 1JRCA 4AC7C 3M41A 4TQTA 3W37A 1KM0A 3CH0A 1NIUA 4WSJA 4Q7BA 1C91A 5JXQA 1JGMA 1JPIA 3QQWA 3GD6A 4FO4A 4NNBA 2C1GA 3Q2DA 2TPSA 2F6KA 1IIHA 1OINA 1HGYA 4K37A 3GG8A 1DJQA 3EX6A 3MANA 4DJED 2C71A 3DKJA 1JEZA 3GKAA 3GNNA 5A8GA 4G1NA 4R34A 2BXZA 1KBLA 3TDFA 4JL1A 5AYXA 1C8QA 1KGUA 2WCGA 3TAOA 4LOCA 3ITXA 1J12A 4I8DA 1I1XA 2VRKA 4P8XA 2XWDA 1VR6A 3W7DA 3NQGA 2GJXA 1ADOA 4EXAA 3QZEA 4AD4A 1JD7A 3R11A 4S3CA 9XIAA 1OK4A 4WKHA 2CXEA 1F3TA 3DFNA 1HL2A 2FVMA 1A80A 4H4IA 1BPLB 3G0SA 3LGDA 5KEZA 1S3TC 1Q2RA 4LSBA 3M0VA 4OBTA 4RXGA 2VRQA 2UY5A 1E1EA 4JFTA 2QJJA 3E96A 3OTRA 4JIEA 1G4PA 4NXSA 2PP3A 4FNUA 3BXWA 4JAWA 3RYSA 3RK8A 2QUTA 4J27A 4ZOAA 3QFWA 4PMUA 1EOKA 3HN3A 1P1MA 5CC6A 1FH9A 4W84A 1XRTA 5AC5A 3N17A 3VOFA 3BJTA 4ERGA 1SZFA 4S38A 2VFGA 1Q7ZA 4C6IA 4PL1A 4LAKA 1NF0A 3IEBA 3AQUA 4EF8A 2QZRA 5EGRA 2I16A 4PTNA 4YU1A 3N13A 3N29A 3S9IA 3D0CA 1PL9A 3DEQA 3O6DA 3TTQA 1E6RA 1ZJ9A 4K7VA 2CERA 2FTPA 3ITGA 5G2WA 3ZSSA 3I7QA 3C52A 1CLVA 1XWYA 2E1WA 1KTBA 3D3FA 3EDEA 3FA4A 2E09A 1TQXA 1DXFA 1TA3B 1H09A 3W1UA 1W1ZA 1WX0A 1FWBC 1WDRA 4IZGA 3UG8A 1HIZA 1R38A 2Z26A 4GYPA 3RR4A 2X0YA 5IOBA 4JTHA 3DFPA 3ONCA 3C2RA 3LDVA 4RKAA 4G39A 1XLHA 4O15A 3R79A 4KPLA 2J7EA 2G8ZA 1XF0A 2PF0A 2OELA 3VKKA 1ZBWA 1H2JA 3VCRA 4PB4A 1H0IA 2C3ZA 3WN6A 4IF2A 4O16A 1UH2A 2XIQA 3PZQA 3WLMA 2H90A 2E40A 3W81A 3TA6A 1QW9A 4GY0A 5DN1A 1PBGA 1LT8A 3UA3A 4NZFA 2OFJA 2ZXBA 3PZNA 5HNUA 2RDUA 3R0DA 2CLKA 4PTDA 4Z08A 1GK8A 3E12A 1XCXA 1V3MA 1J2WA 2IPWA 3WLJA 1YADA 3PWGA 4WR3A 2C7FA 2JEQA 1ZAJA 4Q33A 3WL0A 3SADA 2PDQA 4HCDA 3CL8A 4LUTA 1NM9A 4AW7A 4K3ZA 1M9HA 2BGSA 4J9JA 2XVKA 1E6PA 2Q3RA 2AGTA 1HO1A 3SZ8A 4QNWA 3CV7A 3QY6A 4KMQA 3HV9A 4PCSA 1NARA 3RMEA 2GOKA 2Z24A 3QMSA 2IPGA 2GQAA 2SFPA 2ZCGA 3DYOA 1EYEA 3E0IA 1CLXA 1B54A 3CZLA 3P67A 2VEFA 1DXEA 4MNLA 3N4AA 5HPOA 1E55A 1E9IA 3FHAA 2DZPA 1TJPA 2YXGA 2CBUA 3BARA 4HZ6A 3SIZA 1CGTA 3DFHA 3RJXA 3CU2A 3TWBA 4CN1A 2ZX6A 4RV3A 4YS1A 3EB4A 3B9OA 1WUFA 3FAXA 4UQ9A 2QCEA 3O63A 2VCAA 1V7YA 3EKGA 3TYUA 4I90A 2ZKMX 4Q8MA 2BV9A 4UWMA 3UJ2A 3N9RA 1S46A 3OP2A 5HNTA 4URIA 3PAJA 2OVLA 3IVUA 1Z69A 4E3TA 3BC9A 3ABRA 1UASA 2WMIA 2YYUA 4B5XA 3AOFA 1MSSA 2G4JA 3KAOA 1HJWA 4W7WA 3ITOA 1AZ1A 1KRMA 2FVLA 4WVXA 2NZLA 1TCDA 1TIMA 1BSLA 3B0GA 3APGA 1ZBVA 4UZSA 2ISDA 3RGTA 2BOFX 5AYZA 1P0NA 5GJMA 5MKGB 3OZOA 1JCMP 2Y24A 2D24A 1UH3A 4E4PA 1CDGA 1AQMA 1M7JA 5A8OA 1ZGDA 4P7OA 3W27A 3NGJA 4XZMX 1GZ1A 3S6OA 4DIAA 2ZRUA 1POKA 3GC5A 3OLGA 1TTQA 3EX4A 1EDGA 1CEOA 4RE0A 3WJSA 3WF4A 3KVJA 4HGXA 1XX1A 3HQOA 5HUPA 5A2AA 1XYAA 1KTNA 2EJ1A 3S83A 1BG9A 1ONWA 4CN4A 2GGIA 4D71A 4D8ZA 1R2SA 3CV6A 2FHCA 2ZUNA 2O56A 2FTYA 1DWGM 1KRCC 5F4XA 1XIJA 1V51A 4MKNA 4AD3A 1R9YA 4HHPA 3IIPA 1GHSA 3NQ8A 1QOXA 3WBWA 2FB3A 3VGBA 4JYFA 2ZIDA 4JX6A 5CZKA 4JDBA 5IBXC 1VCFA 2G97A 3EXTA 3NIYA 1TPEA 4JX4A 3H6OA 2YCIX 4OOZA 3HGSA 1PKMA 3U2CA 5HNNA 3IWPA 1KCXA 4MAVA 4FNRA 3GG0A 5D8ZA 4GFIA 5AC4A 1GVSA 3CXOA 3W9ZA 3PC0A 2A3HA 3T09A 2PF8A 3R8RA 1EQPA 4HK5A 4ZZ9A 2HK0A 1IEWA 1YX1A 3VPLA 3B8DA 1MW3A 3EOOA 3T2PA 3HPAA 4FOKA 4RX0A 2O0TA 2BY1A 1ODUA 2CHRA 3E6EA 4JXCA 3GR4A 4D9PA 2PDFA 1SO6A 3LHVA 4CD7A 5A3HA 3ABZA 3WNKA 1SZNA 2F84A 3VD3A 4QJ1A 3W2MA 4C1LA 4ENLA 3M44A 3FSTA 3H4WA 4QFUA 3T1GA 1UQYA 2HVOA 3ZR4A 5TF0A 2X1UA 4PFHA 4H2HA 2XVPA 3ARSA 3VIJA 1DHPA 1WE5A 3LSBA 1Q45A 1GYMA 4HPNA 3AAMA 1HT6A 3MTWA 2OEKA 1F3XA 2QV4A 3VKTA 3VNLA 1WXZA 1B3VA 1Q6LA 4H9UA 1OFBA 4ZB5A 4PN2A 2O4MA 1SVDA 3WK1A 4GH3A 3ZJ6A 4O1DA 1ONXA 3MI2A 3ORWA 2ACUA 5AHEA 1Z48A 4PE8A 4O52A 4WGHA 5FEXA 4IXXA 1KNWA 3O2LA 3A5VA 3BAIA 2WQDA 3OODA 3K30A 3A24A 4FHAA 3P2VA 2FIQA 2B7OA 1EWDA 4JYEA 3YPIA 2MANA 4JTSA 3G6LA 2X40A 1WPCA 2CLMA 2HNEA 1JJKA 3M6DA 7ENLA 4GG9A 3LLXA 1EFZA 4FR1A 1HVXA 4LUJA 5E5CA 1KFEA 3ZO9A 4WHBA 1YDOA 4JTTA 1OCNA 1VFMA 4XZLX 1FFQA 1MEHA 3NYDA 1TWDA 3AS1A 1MNZA 1OVDA 1OX6A 5C70A 1EDQA 4PMXA 1JZ6A 1W9PA 5F4WA 1ZJHA 1ONEA 1K4GA 1W9DM 3WD2A 4L6OA 5DCDA 1L2UA 3SUWA 4XD5A 4Z1AA 2WVUA 4PMNA 3BLIA 4DJFA 4GJJA 2VX4A 1YE6A 5G4EA 4NJIA 3A12A 3BSGA 3WJZA 1VFHA 3FNDA 1P5BA 1GJPA 3K8KA 3R0KA 1ICQA 3WENA 1LWIA 1BGGA 4XAPA 1US3A 3PULA 4GWEA 1KV8A 4LEFA 1RPXA 1P48A 1GOMA 1R8LA 3LXBA 3TYZA 4K36A 5F2LA 3LHYA 1XC4A 3W00A 4EWND 1L6YA 3RF9A 3VKDA 4N6EA 1GQNA 1E1CA 3BWWA 4HP5A 3N34A 2VENA 3TSBA 3VM0A 2GUBA 1LQAA 3B0XA 5I23A 1F7BA 4JTEA 1TV7A 1Z42A 1DPMA 2WCAA 3GXIA 4JHOA 3RCNA 3LA4A 2HZGA 4JYDA 4RZ5A 4UC5A 1AW1A 2QAPA 3OB8A 2Y5SA 4M1RA 3RRXA 2Y5EA 1V8EA 1KXHA 1TO3A 1TV8A 4R7OA 4O8RA 5CGTA 2X2GA 3BLDA 3NNTA 3MMDA 4GKLA 1VEMA 1EHAA 5EMJA 4NX5A 2Y85A 4WXZA 3Q45A 5AC7A 3RNDA 1ESWA 4P5UA 1BRLA 4Y9MA 1D8WA 1E15A 1F73A 3FYOA 4XO6A 1P0BA 5I3HA 2VURA 4HTBA 2ZQ0A 3VU2A 1QK0A 4GI9A 3LU2A 3QV9A 4GD0A 4IWWA 1Q6QA 3VZXA 1FWWA 1KQYA 1JPHA 4EPBC 5CEWA 1ZSXA 4L9ZA 2YDSA 4RV8A 4LB3A 2WHJA 3QR1A 2WMJA 3WUBA 1IXOA 4GY1A 4IIHA 5CZSA 3EEGA 3W76A 2HPMA 2VEGA 1J93A 5CBJA 1R86A 5ECUA 1OB0A 3QKZA 4EXBA 1XW8A 3FJ6A 4F3HA 4D6IA 1OEPA 4H8NA 1WP6A 4UTKA 2HPIA 2P50A 2VVNA 5XIMA 1YE4A 3WQDA 2ZA3A 4RCXA 4US5D 5M5DA 3D5HA 4ZQPA 1W37A 3AUOA 3PR2A 5C8BB 3N15A 3A21A 2V5DA 2A3AA 1SJBA 1W0MA 1OWQA 3GWQA 1U30A 1QHZA 1NEYA 3EDKA 3VNYA 1W8SA 2PTWA 4ERAA 2QW5A 2OWWA 1B57A 1HFBA 4TTGA 3LXAA 4IMDA 1UKSA 3RJYA 4G1KA 4JIPA 2E67A 2XGIA 5FJJA 3MT1A 3FKKA 4UTWA 2A85A 4POCA 2O92A 3SUVA 4WY0B 4AHQA 4MLJA 4I5RA 2J24A 2FYMA 3TEVA 4E4UA 5DELA 3NZPA 3ZR5A 3B05A 4YVVA 3INPA 4D6DA 4L65A 3L2LA 1FP9A 2CITA 1XKYA 4YWSA 1EBHA 2V2CA 5HATA 3R58A 3GVRA 3SCUA 4H6KA 4HA0A 2NWRA 2UWFA 4GO8A 3VUPA 4KEMA 5K9DA 2ZWZA 1PUDA 3EKZA 3H26A 1UZ4A 2PWVA 2VGGA 4C6EA 5AC8A 4LYPA 1RBOB 3ARTA 3AC0A 3KX6A 1B3OA 3UGVA 1FA2A 4ZQNA 2VM8A 1F6KA 1EGMA 2O4QA 4IUGA 3W7QA 1FX6A 4DWSB 1AH3A 2JIEA 1C92A 1SMDA 4GQ0A 4HK6A 4PUJA 2BMBA 2W67A 1DQXA 3NL3A 3UESA 4KFNA 1B31A 1E4IA 4K39A 4NZJA 4HHMA 2YA1A 1JYNA 1MDLA 3MO7A 2DDXA 3WLPA 3FY1A 4G6CA 4FB7A 3QXBA 3CLMA 3W1AA 4LV4A 3WELA 5K7JA 3EWBX 4O4VA 3JZEA 1E71M 1TWIA 3TX9A 3QTPA 3QLDA 4OQVA 4MDOA 1KV5A 1QO5A 1RP8A 3U3HA 1QFEA 4MF4A 3HO8A 3WLNA 4A8NA 1TA3A 3L4VA 2ZRYA 1MNSA 3VKSA 2PDXA 4PMDA 2P8BA 2DUZA 1LL6A 2V82A 2QIWA 1RJPA 4ILSA 3UXDA 4O18A 5AC6A 4N7QA 4Y9AA 3QQ0A 5I06A 5EMLA 4EK7A 1XLEA 1O1ZA 4TX8A 3GY1A 1ISVA 2VNCA 2WBKA 2IKJA 1Y0EA 1W2VA 3WDJA 1XS2A 4CCEA 4U3CA 2XM2A 1T8QA 3M46A 1GVIA 3AYTA 1AA1B 1XUUA 1QBBA 3GAYA 3GRIA 3IANA 2Z29A 2I17A 3EDFA 4XO7A 1X6LA 3W6YA 1K8XA 1IXNA 3QR0A 3SURA 5BNKA 4JCLA 1ITUA 1WKEA 4JTQA 1T5AA 3NPVA 1OJXA 1W91A 4UXDA 1S1PA 4JN6A 3CBWA 4Z0SA 4L56A 3SQSA 1CXHA 3WBYA 2C1IA 5BWAA 3R94A 2OX1A 3NQAA 1O12A 4IXHA 1RR2A 4DF2A 2WZIA 3UWWA 1CXIA 2R94A 1LQ2A 1KM3A 3PS7A 5LNUA 2D20A 1JCLA 2WKLA 1YEYA 2I9UA 4LVDA 3W6MA 4ACZB 5LIYX 4FLRA 4PUNA 1E56A 3F4WA 5LIUX 1K03A 3SGGA 5TBOA 1TQJA 2DP3A 4ZOCA 3TH6A 3K1GA 3NSNA 2BY0A 2GVLA 1XIIA 3SRKA 2A5HA 4EF9A 1RALA 3LTYA 2J7BA 2VZTA 3RM8A 2PWEA 2OPJA 3KFTA 3TYEA 4GI8A 4E2VA 4LCSA 2QQ6A 1G69A 3CC1A 4R7JA 4ASTA 2QJHA 2J8GA 1YPFA 3E9AA 1E3XA 4ZQCA 4JTLA 2INEA 1GPFA 3BQ6A 2FFCA 3ITTA 4QCEA 1UQZA 3KL3A 4GZIA 2VZOA 2VDIA 2XFWA 2YJQA 4PTMA 5M17A 5HWJA 3W1QA 3AIWA 4HU4A 1PPIA 3BUVA 3QFEA 2WVSA 1MUMA 1H63A 1IT7A 1EJVC 3C0QA 1EP3A 3TC6A 3L23A 3Q65A 2DSVA 2CWXA 2DVTA 3FJ4A 4LV9A 1E1FA 3WBAA 3PHAA 4IHCA 3FSUA 1WZLA 3ZVIA 3HB9A 1F2JA 2OZ3A 2ZFAA 3E1F1 4LS2A 3VIHA 4MJ4A 3IIVA 3G18A 2NLIA 5ABEA 1ICPA 2I56A 4PSPA 3QVQA 1BAGA 1H1NA 3M5ZA 1NP0A 2BWGA 4ROQA 2TRSA 1JQVA 3W7EA 4Y2WA 2A0NA 4J3SA 5MKGA 4O54A 1ISXA 4QAIA 3WKZA 1E72M 1F9CA 1E4NA 4MYXA 1T0OA 5KETA 2EPNA 3ZLHA 3WMBA 3EA1A 4H9XA 1XPYA 5F7UA 3AIRA 3TW9A 4Z1YA 2ATMA 1B4EA 2X7WA 3M5XA 3PG9A 4YVPA 1J0IA 1X1OA 4RZ6A 4ZB2A 5D2VA 2WHLA 3STCA 1W1VA 3DZ1A 5FESA 1EC8A 4F0SA 3JUGA 1JZ5A 3ZVHB 5K2ZA 1AL7A 4AEEA 4JNZA 1VKFA 2YCJA 4IIBA 1I45A 3GVQA 2ATSA 3ARRA 4KESA 1EIBA 3HGOA 4R53A 5GNXA 2XH0A 5E9AA 3F1QA 2GVEA 3POCA 1QDSA 3H55A 1PX3A 4IM4A 1R87A 2JKEA 1CXKA 2BBFA 1SR0A 3K1DA 3QJAA 3W7JA 4F0KA 3QMTA 4XZBA 4AZGA 4CNSA 3QPYA 1YKWA 1DVJA 1ZTVA 3CZJA 5A6BA 2AKMA 3GXFA 4ZCWA 4E2OA 2WKGA 3TMQA 3T07A 4PUMA 4FA3A 4S3GA 5T9BG 3E38A 2PDUA 2ZC1A 3FIGA 5HXMA 3PZOA 4M81A 3ANUA 4PMJA 2NQ5A 3NL2A 2Z0IA 3TOYA 3K4AA 4CN6A 3LNPA 2Z6IA 3M7SA 5EFDA 4WZHA 3V0UA 3UPMA 1I2OA 2ZUVA 4OGZA 5ABGA 4GNKB 3WUGA 4ZTXA 1G94A 3SCRA 4WKAA 5FI8A 1G6CA 1K9EA 3CZGA 2VDGA 2OG9A 4QJ4B 3WIJA 4GIAA 3G1RA 1MDRA 1TPB1 4J2MA 3UWYA 4IG2B 3B0UX 1E6SM 3EXRA 1IXQA 3WDHA 4KH2A 2PMQA 1JIBA 2WVTA 2RUSA 1AH0A 5E6ZA 4QG6A 2A2IA 1BWKA 2INZA 4ICNA 4NNCA 4DJDC 1PEZA 3AU6A 1RLDA 4OHQA 3A9IA 1J18A 2B0MA 1FWJC 2QJIA 2ACQA 1GKPA 3A4XA 2BX7A 3RU6A 4NRSA 3RLUA 1XP3A 1J5TA 1GVRA 1R3TA 4QSFA 4U2ZA 1HJQA 1EXPA 1UR8A 4RL3A 4DZHA 1GG0A 3H2EA 3G24A 2NXGA 1QNOA 1KWGA 5LGXA 2RDTA 5FJTA 5SWUA 1G01A 3U4AA 3O15A 3WF1A 3W26A 5G2IA 2WCSA 4ZO8A 4BWLA 4NZ4A 5E70A 3LHZA 1FCVA 4LWWA 5T8GA 4QP0A 1R0MA 4WCJA 3E3HA 2AAAA 5K4XA 2PDPA 3BCFA 3I6EA 1MUCA 1ZJ8A 3V36A 2VO5A 1C3FA 4NYYA 3V16A 2EPOA 4DB7A 3DHUA 1E9LA 3VO0A 4HSNA 3AHXA 1SU5A 5D05A 5DMMA 4AWEA 2IPFA 3SAZA 4CU6A 1KFBA 5I78A 4PUKA 2IS7A 1DORA 3GB6A 4XZWA 1S2TA 5A6LA 2O7SA 4PMVA 3MUXA 1VBGA 4HPGA 3M0JA 4MB3A 3VX0A 1EA0A 4FK9A 4X22A 4IGSA 1K7FA 3VXGA 3M43A 2VXNA 1EXBA 1A4MA 4O1CA 3RO8A 2V69A 5TAOA 2XZ7A 3LZ5A 2CZVA 4MUZA 3RPDA 1V3KA 4EIVA 1H62A 3T4CA 4B3ZA 2AOPA 3G77A 2OGYA 3EA3A 3S46A 3UNTA 1PX8A 8A3HA 4K2SA 3GYEA 2DVXA 4FX8A 2XG9A 5C2CA 1Q7MA 3V0SA 1BF2A 2VEKA 4IL2A 3L65A 4AQLA 3UXLA 3T0AA 5D4YA 1HKVA 1I0BA 1UR4A 4W88A 2PU1A 1OZMA 4O4WA 3G1VA 2IUZA 5A8PA 3VIPA 4Z2LA 2C19A 1EJUC 2B7PA 4E8CA 4OE7A 3VKAA 4LUIA 1B9ZA 3EDDA 2PRLA 1V0MA 1GJWA 3NPUA 4ZO7A 3BCJA 1CXEA 1SW0A 1PZ3A 4JHMA 1LLWA 2VFHA 4RNHA 3W2JA 3O6AA 5LNWA 3H22A 3WFZA 3ARYA 3WBXA 1DIEA 1TVLA 4UQCA 1IWAA 1I2QA 5F4SA 3UQNA 1DTUA 4M29A 4LFYA 3CMFA 4FPSA 1LL4A 2UBPC 2QMJA 4HU8A 4A05A 1G5AA 4UMCA 3UW6A 1Q6EA 1BEUA 1HNYA 4W8LA 3PPGA 5J04A 4ML9A 1XYMA 3QW4B 4XKMA 1EX1A 1G9HA 3T81A 4HOZA 4Q6XA 4GHRA 4J7RA 4IFOA 4YTSA 1PZ1A 4XAZA 2WSKA 1P6CA 1R3SA 2NQLA 1J0JA 1VFSA 3THDA 1KBKA 2A3CA 1VS1A 1EYWA 4QIUA 4Q4QA 2OQYA 5JIPA 1DWIM 3MUIA 1F5ZA 2J9XA 4O0KA 1HTIA 4DJFD 1JZ7A 3BV4A 3B0LA 3GNDA 1XI3A 2NVAA 3W38A 3V1HA 4PCFA 3N2OA 2OCZA 2PGRA 2YW3A 4W87A 3CL6A 4CVUA 1BVNP 5BXSA 3GXNA 5D30A 4NZCA 2KAUC 5AVNA 4Q8UA 3N19B 3MZNA 1ODZA 1QPRA 1TZZA 2I7GA 2ISSA 5AYBA 2VHLA 2VUNA 2W5FA 2Y63A 3T0BA 4WY0A 4ZTYA 1FDYA 3ABQA 3G3MA 3E0LA 3W01A 3A4JA 4YN5A 3GBDA 7XIMA 2QR6A 1PVNA 3P74A 2WZMA 3UNDA 1RVGA 5JUVA 5EYWA 1VLWA 1TE6A 1O5QA 1CIUA 1QWGA 3I10A 1BYBA 5CC3A 1OSEA 2X42A 3B40A 3GDKA 3GFZA 1US2A 1UP2A 3CGTA 3LV5A 2PD5A 3GIPA 2FFIA 5EMUA 4XBJA 8XIAA 4J3WA 3AZTA 2ZUUA 4WEVX 1TB3A 3W2KA 3P6LA 2XYLA 4JQ4A 3HQ1A 3W53A 2POTA 4DNMA 1E0TA 2PDCA 2QDEA 3B4UA 4UTLA 4TVUA 4DWSA 1CGUA 3VKRA 2CC0A 4TOQA 3L0GA 3SCOA 4GCAA 2V81A 1Q65A 2ZRXA 1E5NA 2IXUA 1SFSA 1VCGA 3BDKA 1E0XA 1OABA 1TTJA 1WKDA 3HF3A 5IHRA 4UFKA 5CPMA 3VOJA 2J27A 1LT7A 3W7OA 3WSUA 5E0FA 4Z1BA 4KCTA 1JFXA 4JIRA 1J8VA 4N9CA 2ISWA 3S2LA 1F76A 1JR1A 3W85A 4ZL1A 5DEZA 3ZSTA 4OZOA 1K3UA 2ZBTA 3K2GA 3SI9A 3TNOA 4H19A 3CO8A 1B3XA 3B0NA 1AFSA 2W3ZA 1SFLA 3PBGA 4DM1A 4JY9A 2ZADA 2Z7GA 1E9ZB 1DJGA 2V30A 3FLUA 4FMVA 3OVGA 3JW7A 3O9NA 4UQAA 1UZ1A 2VYOA 1DQWA 3VMNA 3UY7A 1C8YA 4M0XA 3N04A 5DMYA 3KDOA 1JPMA 5BW6A 2PWGA 4N4QA 1NFPA 3NTYA 1XLGA 1W5MA 3BCDA 3GVWA 4U5IA 1GQLA 1HX0A 3OO2A 1W9VA 2R6OA 1QOPA 4GYKA 3UCCA 4QAWA 1FWIC 1SZRA 4P7QA 1VJZA 1XSKA 4B90A 3KHDA 1FBAA 5ABHA 5IDIA 4S2CA 5HMEA 3VNDA 3PPHA 4CCDA 1QHOA 4GVIA 2DPEA 4JTIA 2G4FA 4AVFA 4HKPA 3LHTA 4I9AA 4F0RA 4U3AA 2V9DA 3SW6A 4LC6A 3MMAB 3LTSA 3V3WA 4LC8A 1R3QA 3U2ZA 4ACZA 3CMJA 3ZLFA 3FX4A 3EWXA 4UR9A 3DDMA 4IIFA 4L5ZA 4UQDA 1ENUA 2F8QA 3MS8A 3KDNA 1K8ZA 1M3UA 3WK0A 1E73M 2QIIA 1M01A 2YW4A 4GC4A 4XBSA 4DYJA 4K6AA 1S1RA 2PWDA 1GEHA 1PTAA 2FGLA 1H11A 2PTYA 1UR3M 1D8CA 1VFTA 4NYUA 4UTHA 2VDHA 4WX2A 4IIDA 3ITYA 3WQEA 1GKQA 2C91A 2H9AB 2PDKA 1DE5A 2XH2A 1S5TA 3P0WA 5J5RA 4I6VA 4QG8A 4Y96A 3C61A 4DBWA 2NT0A 4XK2A 3DI1A 5CSUA 4O19A 3B0YA 2PTXA 2YGYA 4OWGA 4J3VA 2DY3A 5FIPA 1IWBA 4N0RA 3UJSA 3MSGA 2WWDA 3MMBB 3TJXA 2C13A 4C6MA 4F40A 3LV6A 1G7UA 5KSWA 3MSDA 1DE6A 3XISA 1R3WA 2QULA 4M19A 3W25A 3WQWA 4K38A 1NELA 1Q5MA 2RKXA 2DW7A 4HNNA 2XWEA 4JIIX 5A94A 2BODX 3W24A 1Q8AA 2C6QA 3GC4A 2XPKA 5B7ZA 2P76A 3LBCA 3GHRA 4BQ4A 3CHCA 2YZ5A 2PSNA 4C90A 2D2GA 5DT5A 1A5AA 3HFTA 3CAVA 4HSOA 3Q4DA 3VMPA 1TELA 4JCMA 4Q8VA 3NM1A 4LAUA 1C9WA 3R12A 2BSLA 4QX4A 3AJ7A 4CVWA 3SUUA 1P0DA 2XHYA 1MYRA 5MF5A 4ZXLA 4Z1CA 5KTLA 1UD5A 3GAKA 4BEUA 2OZ0A 3A4WA 4AIUA 4A35A 3ZVHA 2J7DA 5I77A 2A6NA 1HL9A 1N2VA 1OFAA 3AHYA 2A1YA 3MYOA 1YXYA 1XSIA 2VGFA 3C2OA 1TWWA 2REQB 1VPXA 4JTRA 1UROA 1TPDA 3BH4A 2WM1A 2BHUA 3KWXA 4GXPA 3TONA 4PMQA 4FOUA 2ZX7A 1BYDA 2CHNA 1H50A 1YMYA 1ZBKA 4JNMA 4MYAA 1GZGA 2QXWA 3PUDA 2D3LA 2NWSA 3RMJA 2NV2A 2C0HA 4ZXOA 1AL8A 2CPUA 4AISA 4AY7A 2PC4A 3BGJA 1L8PA 2CBJA 4KFOA 4B5NA 4DPQA 4HMEA 3EMQA 3BANA 1IR1A 2UV8G 2OSXA 4B9ZA 3UEQA 1UKPA 5BMWA 1H5VA 1ECQA 2BOGX 2CKRA 1CNVA 3L9CA 1IR2A 1FFRA 4JQAA 3GHUA 1NQKA 3USBA 4QDMA 2JALA 2Z28A 4O13A 3VIFA 1RD5A 1CWYA 4B2DA 2P3EA 3GG1A 4L4LA 5M03A 3UP8A 3VKBA 3IJ7A 4IG2A 3VNMA 1VIWA 4BQ2A 2CLLA 3C0JA 3O05A 4TXEA 4W85A 1R7OA 1BGAA 2W0UA 5C5YA 5C9UA 2TMDA 2AL1A 4NZ5A 1F4AA 4NT0A 3VDGA 1OT2A 4OBRA 1VHNA 3EX1A 2C8NA 1VBHA 2CCRA 3OZMA 1K1DA 1NWRA 1VENA 3S42A 1GVEA 4LQ1A 2WYSA 6GEPA 2ZE3A 3CEPA 2DSKA 4PB5A 1BFNA 1BHGA 4UUIA 1KGXA 4U28A 1J9YA 1PDZA 1IEIA 5GPRA 3DFQA 3TE9A 3AWOA 3PJUA 4A3QA 4LVBA 2JF6A 4L4PA 1J0KA 3QN3A 3MVIA 3ZM8A 3ZT7A 2HXUA 1PZ0A 2WC3A 1BKSA 4ZVJA 1WDQA 1LRQA 3WF2A 2QF8A 1V6UA 3UT0A 1HW6A 3NVTA 3EKLA 4HTYA 3MDWA 2YL5A 2XH4A 2C15A 3KBNA 1A53A 2WM0A 3QC0A 4XSLA 1J01A 4B9YA 2Y70A 2I9EA 4AIBA 2VP8A 1UWRA 3W2UA 4CCCA 4H9YA 3C4UA 4Q4PA 4ZBCA 1SFJA 1J4EA 1B2YA 1W17A 4ZO6A 4JL2A 4MZ8A 2QV5A 5B7YA 1N8WA 1ZU8A 4BR1A 4JTKA 4WRHA 1FXQA 4F48A 4YTTA 5G5IA 1CZ1A 5G4WA 3UA4A 5A6KA 1OY0A 3VLXA 2EAWA 1B5TA 3H2OA 2YLAA 1H3GA 4YJ5A 1M41A 2VD8A 2ZICA 4DN1A 1O1HA 3PNZA 5BROA 1Q6DA 1KRBC 1HVQA 4O50A 2PD9A 3KS5A 2OLHA 3C0SA 3U2OA 1S2VA 3ZQ9A 4NI3A 2JF7A 5J5DA 4O53A 1EP1A 3WH8A 5E93A 1XJBA 1B9BA 2YZRA 5I7GA 3WMLA 4F2BA 4MPKA 3NL5A 4H6RA 3LENA 3LM7A 3FJNA 2WBGA 1XCWA 4REQB 1GOQA 2NVCA 3CQIA 5G4HC 1OFOA 4S3DA 3MKCA 4B92A 2QS8A 3SRHA 3FDKA 6ALDA 2VZVA 2F38A 3M0LA 4LVGA 3TJLA 2ESCA 1K9DA 1TV2A 3I65A 1UIOA 4DAFA 3CUIA 4HU0A 1D3CA 2NX3A 1KFLA 3STPA 3NDOA 1LROA 1YTEA 4U2YA 2HVNA 2ALDA 4RE4A 3IARA 4Y9PA 4UQEA 4MWAC 2XFFA 2OQHA 3B0MA 4FXSA 5HQEA 3H2NA 4HB7A 4D2JA 1GONA 2R14A 3GYCA 1JZ4A 4H9VA 4E5TA 1OHLA 2A21A 2GQ9A 3REQB 1XRSA 4IQDA 1A3WA 1IWPA 3CM4A 3CQ0A 3EYPA 4C6QA 4Q4MA 1CPUA 2QCDB 2VWSA 3SRDA 1HG3A 4IGNA 3GR8A 3EOSA 1Q66A 3DXIA 1WUEA 3VGHA 2X1TA 5HQLA 2EGZA 3MO4A 1KCKA 1WAWA 1KW1A 5HJXA 4PBFA 1U33A 3ZLGA 3H23A 4LNYA 3EWZA 5LIKX 1UA7A 3OGRA 3R2GA 1FWNA 4IIEA 3PZIA 4RLIA 4BK9A 3AWNA 1JNDA 4JGDA 4KIEA 2F9RA 2ZZ5A 3I7SA 5CC7A 3TC3A 3LK6A 4NRRA 3VDCA 5KZDA 3MMCB 2ZUMA 1XLLA 2WWCA 3VNZA 4RE2A 1GG1A 2ICSA 3ZWTA 4F4RA