4S3BA

Ispg in complex with intermediate ii
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
402
structure length
401
Chain Sequence
b'GMRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Oxidoreductase
total genus 135
structure length 401
sequence length 402
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s3bA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s3bA02
2AKJA 4GEPA 4S39A 2Y5JA 5GEPA 3H2OA 2H9AA 3H2FA 3VM0A 5AOPA 3VLZA 2Y5SA 4MWAE 3H2NA 2YCKX 3H26A 2E7FA 3MMCB 4MWAA 2OGYA 3B0MA 4DB7A 3MM9B 3TZNA 4PZVA 4S38A 1ZJ9A 4DJDA 2DZBA 1Q7MA 4O0QA 1F6YA 3MCMA 4O1FA 4NILA 3VKRA 8GEPA 3MM7A 7GEPA 3MCOA 3OR2B 3TYUA 3B0LA 1Q7QA 3AOPA 3MMCA 3OR1B 3VKPA 3MM7B 1AJZA 3MM9A 3VKTA 1EYEA 1TWZA 4MWAD 4S3AA 3TYEA 3H2MA 2YCJA 3TYCA 4DJFC 4D9PA 4DJDD 1AJ2A 1Q7ZA 2VEFA 3B0GA 3MCNA 3TR9A 3VLYA 3B0NA 3BOLA 1TWSA 3OR2A 3B0HA 3VLXA 3OR1A 4DJEC 3MM5B 3K13A 2XSJB 3MMBB 2YCLB 1ZJ8A 2DQWA 3H2CA 6GEPA 4G39A 2VP8A 4G9PA 4D8AA 2V4JB 4S3FA 3VKQA 4S3EA 3MMAB 4HTRA 3H2EA 1AD4A 3H23A 4NIRA 4DJFA 2GEPA 4D8ZA 3MM5A 4HB7A 1AD1A 2XSJA 3MMBA 1Q85A 1Q8AA 2YCLA 2AOPA 4G38A 3TYBA 3BOFA 4DJEA 4O1EA 3H22A 2V4JA 3GEOA 5JQ9A 3MMAA 4NL1A 4S3CA 1TX2A 2VEGA 3TYAA 3MM8B 3MM6B 4C1NB 1AJ0A 3NOYA 1AOPA 2YCIX 3B0JA 1Q8JA 3H21A 1TWWA 3VM1A 4AOPA 2H9AB 4DJFD 4MWAC 4S3BA 3VKSA 4DAIA 2DZAA 4MWAB 4DJED 4DJDC 4NHVA 4CCZA 3H2AA 3TYZA 3V5OA 3MM6A 1TX0A 3MM8A 4C1NA 4S23A 3TYDA 3H24A 4DAFA 4S3DA 3TZFA 2BMBA 2Y0FA
chains in the Genus database with same CATH superfamily
5FA5A 2ZZ4A 3UD6A 4KWOA 4HQVA 5CPQA 5HINA 2Q01A 7REQA 2VC7A 3P7YA 1M65A 1I2PA 1V6VA 4RJEA 2IPWA 3DGBA 2BS9A 3O2LA 4CQ9A 1Z3NA 3NL2A 1DJQA 4CNUA 4CCEA 4HHPA 2TPSA 3LCWA 4UBPC 1N8FA 1QI5A 1NP0A 4OIFA 4UB9A 1VEPA 1GVQA 4FXFA 1RHCA 3MT1A 3WLMA 1GTHA 1WP6A 2PP1A 4UTMA 4XIMA 1G67A 1Q6CA 1XRFA 1BGGA 3N11A 3E2RA 4XD3A 1ZAJA 3SFKA 4JIEA 3I65A 5BOEA 1U1JA 1XQKA 4DJFA 3VABA 4JTIA 2TODA 3DFNA 3HQNA 4B92A 4OHQA 3GC4A 2IKHA 1UR8A 2YL8A 1FCUA 1DIOA 1BWKA 3IANA 3UJ2A 2HPMA 5F2GA 1F3TA 2YDAA 3ELFA 3NO1A 4AHQA 3VKJA 1AJ0A 4YXGA 5PTDA 3NYZA 1RA5A 4EACA 1IEQA 1BLIA 1W54A 4HMCA 3V18A 1I1WA 4MLRA 4NNBA 3T78A 4HN4A 2ON3A 3OG3A 1BKSA 2OELA 2ZUTA 1S2UA 1XYZA 3GDLA 1GEHA 3SDOA 4PUMA 3RPTA 2OTDA 1I0DA 1RVGA 4L6DA 3EAUA 5F2MA 4JNZA 4LEFA 3SW6A 1UIOA 1EXPA 3IARA 1ODZA 3JZUA 4IL2A 5F1UA 1S3HA 1M7OA 4UC5A 4MF4A 1XSKA 3W7IA 2GUBA 2OGYA 4PZVA 1XDMA 3KS6A 5K9XA 8GEPA 3W38A 1V0LA 3UNDA 5A2CA 2GDUA 3PN8A 1RQEA 3ITVA 4EXAA 3CZLA 1VPXA 3W28A 1US3A 4L4PA 3W7EA 3SSJA 4MDOA 3FKRA 3IWPA 3VNKA 1S5VA 3NYDA 4GY0A 5DELA 2HK1A 1ZLPA 4QLLA 4CVWA 1JCYA 1OGBA 2AOSA 5LA2A 4BEUA 4DY1A 4AY1A 1M9HA 5FL1A 1Z89A 1OX4A 2JBMA 2QCGA 1A5CA 2DT2A 3LLFA 2B7NA 2RH9A 3KRZA 4DZHA 1UMLA 4TTUA 4LUTA 1XLIA 3HPXA 5IHSA 1HT6A 3VFCA 1X6NA 4OOUA 2WK2A 3NM3A 3UXLA 3JRKA 4FXJA 3SJ3A 3CAQA 2TMDA 2VUYA 2CC0A 3OVRA 2EAWA 2A3BA 1B57A 1P0EA 3GXTA 2MUCA 3N15A 4MJ2A 1XG4A 1X39A 4QP0A 2D3LA 2JE8A 4JFVA 4HNOA 4WY0B 1A4LA 2PTWA 2XVGA 1F5ZA 4G7EB 3PY2A 3BGGA 4YTRA 4C5ZA 2NQZA 3G1DA 2CZFA 3CTLA 3MMWA 3SURA 3OGRA 4WIWA 2XM1A 5JIPA 4MVAA 4YIWA 4GKTA 3WEOA 2FVLA 3R10A 3POCA 1GVIA 2J25A 3GKAA 2PRMA 3H4XA 1MW1A 3S8HA 1EJRC 2ZIDA 3PK7A 4CNTA 3MV11 2GJRA 5JMUA 4GIEA 1NQKA 1EYWA 1E1FA 1C8XA 4L65A 2YBVA 2ZX6A 3ZWSA 1HP4A 2O7SA 5D37A 3WF4A 1KRAC 5C9WA 1TPFA 1I45A 3VKDA 3MP4A 3BG9A 5E70A 1P5BA 3B0PA 1BF2A 5AVHA 4UQEA 5EA9A 3PNUA 3FVDA 5I3HA 1OVDA 2Z4GA 4JIHA 4EE9A 4NJGA 1NEYA 1EUNA 1NDVA 5HDRA 2HS6A 3LSCA 3R5EA 1J11A 4M0XA 4QE4A 3T2OA 2X0SA 1OK6A 4AXNA 2UY4A 1CBGA 3KOXA 3HQOA 1P0BA 4NSBA 1HO4A 3WX7A 1GVFA 3MM6B 3A12A 4C1LA 5D05A 3RO6A 3ZQ9A 5ECVA 5KZEA 3T0BA 1VP5A 2F9RA 3LD5A 1TELA 2DT3A 1XLMA 2PDLA 3GR8A 1W9DM 1NOWA 3CT7A 3FGCB 1VLWA 2NUWA 4PUKA 3DEQA 1MI3A 4RDYA 2DZWA 3KL0A 4IJRA 3DFHA 1W1YA 5FL0A 3R0KA 2D2OA 3CWHA 3GH5A 4U5IA 4REQB 1GORA 1W37A 1GG1A 3E1F1 3V16A 4WSKA 1GG0A 1WDQA 4LC8A 4F0LA 5BU6A 1BTCA 3LMZA 4HK5A 5TF0A 4H3DA 4IIBA 4GZEA 2P5NA 2DDXA 3GY1A 2Z1BA 1Q7QA 4Y90A 2E1WA 1HL2A 3WD1A 2XGZA 4E2VA 2BXZA 3MC5A 1B3ZA 3MDWA 2Y70A 3R1ZA 5F4XA 1IV8A 4IPJA 3PWIA 5KZDA 1CXLA 3GH4A 3UNTA 4AZ7A 4JQ2A 2ZRUA 5FSDC 3M6YA 4AMCA 4IPPA 4HTRA 1LQ0A 2FTYA 3H23A 4E8DA 2F6XA 3VO0A 5C9XA 4PE8A 3W1QA 2WC7A 4RE4A 4CCDA 1FKXA 2PGWA 1V3LA 4BKNA 3A4JA 4L1XA 4AF0A 1VHCA 2G41A 4L4OA 4C6IA 1XUZA 4AUBA 1CYGA 3W72A 3P3BA 4OT7A 1MUMA 4NJHA 1D2KA 1W32A 2YLLA 3DKJA 2HBVA 1XIDA 3M6DA 3M0MA 3UWVA 3WBEA 3DYOA 4IM4A 1SW0A 1M7XA 3ENLA 4LB4A 4CU7A 4KF1A 4FR6A 4BWLA 2WZIA 4NJKA 1KA9F 3M4HA 2QLYA 1DP0A 5I6SA 5C0QA 2PPGA 1MUCA 4C6NA 3SY8A 2A3CA 3A3WA 2PWUA 3E9AA 4MWAA 3NZRA 2QCNA 1G4EA 2BLEA 2GPTA 3N9KA 3CTTA 4LCRA 3C3UA 1ADSA 3QJAA 4F40A 3NQ7A 4H2HA 4LW7A 4M7SA 1DPMA 2VZUA 1J12A 1GVRA 1JJKA 8TIMA 2ISDA 5U7SA 5BMWA 1E5NA 1UC5A 3WFAA 1KCXA 3NM1A 4CQCA 3WDPP 1XRVA 1PX3A 3LUTA 3QTPA 4IJBA 4PODA 3UVAA 3LGEA 3B0NA 1UWTA 3CUHA 1KNWA 3SN0A 3LHZA 4AIUA 4PMYA 2XN1A 3VE9A 4MLJA 1XUUA 5E9AA 2GGHA 2H3DA 3B97A 3INPA 3SRDA 1ZHAA 4RCXA 4MDPA 4N2YA 1V03A 1BSIA 2PTZA 4HSOA 2ZXQA 2BXYA 3RF9A 3GR4A 2V4JA 1FQ0A 3T44A 4S2BA 1XLDA 3OBKA 3WQ6A 2OX1A 2Z1WA 3G0UA 3S0CA 4I9AA 4J3ZA 3EYPA 4Y9NA 1ISWA 3L4TA 4GVFA 3OTRA 1GK8A 2XH2A 3VDGA 1RUSA 2OWXA 3N29A 4CD8A 1H7WA 2QR6A 3O6DA 5A2BA 2ACUA 5A8NA 5KSWA 2WW5A 5MKGB 3RJXA 4PTMA 3CT2A 2Y5SA 1X38A 9XIMA 1LUCB 2YA1A 2CCRA 4LVBA 3FYYA 3QGKC 3GK0A 1XYAA 1TMLA 4O53A 3RPMA 1XJBA 2V5BA 3TJ4A 5HQEA 1SR0A 4POCA 2H6RA 1GZJA 2RGLA 3DX5A 4PCFA 3FKKA 4LB3A 1MXDA 3DI0A 1JCTA 2I5IA 2VHLA 2Y7EA 4U33A 5A6TC 2CIPA 4PB3A 1GVEA 1L8PA 4BF5A 5FJTA 4OGZA 3S46A 3LBOA 1PV8A 1TPH1 2OQHA 3EOOA 3CO4A 1FRBA 4I9TA 4FALA 3IEBA 4WVXA 3BW3A 4I8DA 4MZYA 3B9AA 3VMOA 5FJUA 2G0WA 3GG1A 3PANA 1NF7A 1OK4A 1QW9A 1PWMA 3GDMA 3VDHA 4A05A 4O19A 4AZCB 1Q2RA 3TU9A 3PP7A 4EAMA 2JF6A 2VGIA 2XN0A 5CG7A 1AOPA 1MVYA 1ME7A 3T9PA 4UTLA 5HR7A 1UWQA 3AOFA 1KM5A 3LMYA 1WX0A 3NIYA 5LXXA 3FXYA 3LXCA 4RDVA 1W3JA 3F2CA 2ZVIA 1JR1A 3KX6A 4D71A 4H9UA 2XVLA 4XSMA 4NJJA 1QATA 3U0HA 3CYJA 2H9AA 2UBPC 4LH8A 5C7HA 4XK2A 4PSRA 1ZP4A 4NASA 3GR7A 3T42A 1W3LA 4AZ5A 3AXKA 2OSYA 1CT5A 2PLJA 2Q8LA 3LU2A 4LRTA 1UR0A 3EEGA 1Y65A 4I9JA 2J88A 2NXHA 3RX2A 1MQRA 3C8NA 3RLUA 3HOJA 1BYBA 2G8ZA 3XINA 4HPGA 3OLEA 3TXVA 3TYCA 1TQXA 3FLUA 1S1RA 5FJRA 3RRXA 3S6DA 3LCLA 3BK0A 2XVKA 2XIJA 1JPDX 4O0KA 2RUSA 4QDWA 3OVGA 1DWIM 1CGVA 1HIZA 1QI2A 1A5SA 1LBMA 1T5AA 3M0XA 1G69A 5T9CE 1TV4A 1L8NA 4ACZB 4TXEA 2HE8A 3RPDA 4KEVA 5D9OA 4S1FA 1AL8A 1HNYA 3UU0A 3A13A 4DBSA 5AZ0A 2EKGA 2CEQA 1GVYA 3KFTA 1PIIA 4AMAA 5A95A 3VIPA 2ZUMA 2VZOA 1JUBA 3EOLA 3MSYA 1NP2A 3W2MA 2QJGA 3N04A 3K46A 4HZ8A 1I4NA 3EDFA 1GT8A 4H00A 1PYFA 3DHDA 1L2QA 4WJEA 2NVAA 4CQ8A 1R3RA 2P0IA 1VRDA 6TAAA 2V3DA 4XX6A 3MCOA 3W7JA 1JDDA 4HCHA 3AOPA 4AIBA 4PC8A 2JIEA 3SCUA 4RUBA 4XBJA 3DC0A 4LTSA 4HK7A 3B8UA 2E9MA 1YHTA 4IQLA 4GK8A 2Y7GA 4H8UA 3MM5B 4TX6A 1Q13A 2VOMA 3JU2A 2F7FA 5AY7A 1PYMA 2QCCA 3W25A 1VBUA 4H9ZA 1BF6A 4NP7A 1J2BA 4R33A 4CVUA 4UOZA 4GHRA 3H70A 4IICA 4WZHA 3GEOA 4OUEA 1ONRA 4DUXA 2PU1A 2XHYA 1V93A 4MNLA 4XAZA 1U5HA 2ZUVA 1UD2A 3C5QA 3LHYA 1KGUA 4PCNA 1QHPA 2WZEA 1X8CA 2W67A 5LNSA 4DAIA 2EG7A 1D3HA 1EDGA 4B90A 4AVFA 1ICSA 3IJLA 2HPIA 2REQA 2XIOA 1E6NA 4JTRA 5AYXA 3VZZA 4AEOA 3FA4A 2VI0A 2X1TA 3STGA 3C2EA 2PMQA 3HV8A 1AQFA 1MYRA 3BGJA 1IQ8A 3APTA 3F5KA 5KITA 4IPNB 4M51A 1NWUA 2XWDA 4F0HA 2QDDA 4EPEC 2VFIA 3V0TA 3TQVA 4OBTA 1V51A 3KCOA 2Z28A 4DYEA 1G4TA 4EWND 5E1QA 3VM5A 3O15A 4I6VA 1O95A 1EGMA 1D9EA 2J7BA 1FCBA 1KLYA 3WJSA 3GDBA 3I4EA 4LYPA 4P8WA 3W1RA 3PTMA 5FD0A 4CU8A 3NL3A 3GXDA 1GW1A 3DFQA 3DDMA 4LVAA 1A50A 4QTGA 4IIGA 1DQXA 1XH1A 2BP1A 3PZIA 5CZTA 3ARPA 3G2GA 5LSMA 1Y5XA 1V7YA 1GPFA 3N9SA 1ITXA 1KXHA 2XH7A 5CC7A 1W56A 3UWZA 5IFPA 4P7NA 3W53A 4CKQA 3ORWA 1AMKA 5G2HA 2BBFA 3SRKA 4QDMA 1PIFA 2D20A 1RY8A 4JEQA 3W6MA 5C2GA 2WCGA 2MNRA 2OO0A 3RCNA 5DQPA 5C2CA 1YQ2A 4ATWA 4B9YA 4WSJA 1IEWA 3B9NA 1E6XM 1VPYA 5IOBA 1LCOA 5M03A 2EBNA 3AU2A 4JTTA 1XGEA 2ZTKA 3NA8A 4Q8PA 3M0VA 4EOUA 4O0QA 4PEEA 3M9YA 1V3KA 3H53A 3W26A 1JZ7A 3UBPC 3UR2A 4G1NA 1N82A 4HP5A 1JFHA 3LG3A 1M01A 3GXNA 1SFLA 9RUBA 1RVKA 3AUOA 1Q3NA 4IFRA 3W1LA 5A94A 2G4FA 3ARQA 5FOOA 3H55A 2Z25A 2AAMA 3G18A 6A3HA 1XXXA 4LF1A 1WOBA 1PS9A 2ZXAA 3AS3A 4E3TA 3QQ0A 3AI0A 2ZA1A 1EQCA 1VYSX 2G4JA 1P6WA 3CAWA 3B0UX 3TCEA 4TIMA 2QV5A 3A47A 5JH1A 2QF7A 2QJNA 1PDYA 2C13A 2C0AA 3KOWA 3HV9A 1GUVA 3GS6A 4TX9A 2FZMA 4N4QA 1EC7A 4UMCA 1CECA 5DT5A 1OM0A 4Y9MA 3LB0A 3TTYA 4I7UA 4JAWA 3MO7A 1DKWA 1FWRA 4G6CA 5I23A 1DEDA 4QJ1A 4DIAA 3SCSA 3RIKA 1R3SA 2VURA 3CH0A 4TMCA 3MY9A 4O50A 2NWSA 4UCFA 5M5DA 4O1AA 1JZ3A 4P8UA 1DXFA 1E3XA 3BCJA 3LXAA 5BZAA 3SQMA 3KEHA 2D2GA 3WDQA 4OZOA 3UPWA 2DH2A 2XYLA 4AY7A 1E4NA 1VEOA 1VLIA 1WZLA 5BOOA 3MCNA 4O12A 4XKYA 1KC7A 3TONA 1X6UA 3QF0A 2QUNA 1OWQA 3T2PA 1E1EA 1FDJA 2A7PA 1CLVA 3FA5A 4LOCA 1VFLA 5G2WA 3LRMA 1XICA 2V5CA 3PZTA 1C3FA 1PEZA 5I2UA 5D32A 3VDBA 1T96A 2RHGA 1PZ2A 3N2TA 1IXQA 1TVNA 1PL9A 1S5WA 3ZJ8A 3A4WA 4HA0A 4GXWA 3WL0A 2DJXA 4IFKA 1A5LC 1LWIA 4NX5A 3BWWA 2O9PA 2TSYA 1UZDA 1WZAA 4PL1A 3W7GA 4UTJA 1A4MA 5G1TA 2X16A 3W76A 4N0RA 5LKYA 2CBUA 2G3IA 4I5UA 1FFQA 3DERA 2YFNA 1YLVA 2VRQA 3VINA 5I7GA 1DHPA 1LLWA 4LQ1A 5AHIA 4HZMA 1I8JA 1MEIA 4JN6A 3FNDA 2YPIA 1GCYA 3WQGA 2RKXA 2HEJA 4ZCWA 2G37A 4B3ZA 2PWVA 4Q4KA 3M0JA 1EGZA 1VC4A 3T2QA 4IMDA 3PAOA 5REQB 3UXKA 1WDRA 4KETA 1E40A 3SB0A 1BWVA 2QT3A 3HQPA 1Z69A 2FZBA 3REQB 3THCA 1L0PA 1Q6EA 2WPGA 1QT1A 3VLXA 1AG1O 3S9YA 3N19B 2B31A 3POHA 4L9YA 1OSEA 3P0WA 3VMNA 3M46A 4S3EA 3U57A 4N9EA 4QLJA 1K7FA 1A0CA 1FP8A 2WJZA 5BXRA 1S2WA 7PTDA 3PJXA 3QYSA 1ITCA 3LRKA 3A4XA 2ABAA 3L65A 3DBNA 5MHBA 4L6HA 4NL1A 1QPQA 4MPQA 4YHGA 2GJPA 1DV7A 3MM8B 2W66A 1RAKA 5FJPA 3CK5A 4GC3A 1VIZA 1HQTA 2GGIA 3KDOA 2P53A 2WBKA 2NQ9A 3PPFA 4HPXA 4LUSB 2UY3A 4ADUA 3QMTA 2GSEA 4S2CA 4LAUA 2WVUA 3G3MA 4DI8A 4A3YA 4TOQA 2OX4A 1VPQA 2CLHA 3WDHA 1H62A 2QJIA 3GUWA 2Q09A 3KUMA 4WGHA 5FIPA 5D02A 4DWDA 1ZCCA 2RDUA 4ATDA 3QM3A 1FXPA 3VNJA 3VUSA 3W29A 3QV8A 2HQAA 3AROA 4L4MA 5FJIA 3SI9A 1Q45A 3MBDA 1JPIA 2CKSA 1E6PA 3WH9A 1E71M 1FWFC 4DJFC 1LOLA 1HJWA 3LTSA 4CNSA 2FJUB 3QYQA 5LIUX 4C60A 1J0YA 3TWAA 3OQ8A 4MGGA 1QNRA 3PG8A 2PURA 2OZ0A 3OB8A 2F61A 5A8OA 3W02A 1K9EA 1KO0A 3AO0A 3NQVA 3MWCA 2E1DA 4KW2A 2Q6ZA 1PKLA 4R7OA 1YDNA 2HROA 4ZSUA 4RZ4A 2FYMA 1GQIA 1JAEA 3V7PA 5AFDA 3USZA 5IBXA 2OSWA 1MZRA 4I5RA 1R3TA 4UQBA 3C0SA 4E2BA 4Q8NA 2E40A 2NQHA 3TLQA 4QCFA 2VFDA 3M41A 3N73A 5FEXA 4B5UA 2YCEA 3UG5A 3ANVA 1FHLA 1V3HA 4NXSA 1SMDA 4D1JA 1M04A 4Y8EA 3T7VA 3WNLA 1XFCA 1VFUA 1J18A 3AUJA 4LV4A 1X7FA 1PZ3A 1QPKA 4D8LA 3TTEA 1XKYA 2VMFA 2D3NA 3NQEA 2YJQA 2ASHA 3CUFA 1GTEA 4IH3A 1TIWA 3BW4A 2XZ9A 2VGBA 3UPMA 3EDDA 2DSKA 2F84A 4QCEA 1QK0A 1U83A 4F79A 1HJUA 2FGBA 5A8PA 1HXJA 1HJVA 3CASA 1I9CB 3C2VA 3ALGA 2NW0A 5C70A 4XWUA 4FOUA 2OLSA 2C16A 3HGOA 3BAJA 3W7KA 3QSTA 4ZQNA 1OCNA 4LFYA 3P8JA 1P7TA 1YXDA 4DF2A 1KKOA 2OSXA 3DN5A 1V7AA 2O9RA 4HNLA 1RPXA 1MEWA 1RR2A 3LV6A 2IQDA 1OT2A 3O0KA 3FYPA 3QPEA 3MUAA 3B05A 1UKOA 4WK9A 3GWQA 3GHTA 5DRIA 3AHTA 1TWDA 2E68A 4IJCA 2DZSA 3O9NA 3P67A 3WUGA 1HKVA 1GNXA 1AMYA 2PLMA 2GZXA 3AHZA 4ZO6A 3S83A 4ZQOA 4M7TA 4D6HA 4NRSA 3D5HA 1X1ZA 4FLRA 4GYJA 4IZGA 4C90A 2EEXA 3BOFA 2VFGA 3SAZA 3TSDA 3W2JA 5H8MA 1UH3A 3C8FA 3ITLA 3CZGA 4AZ6A 3HPZA 1RBOB 1AW2A 1P4CA 4QJ3B 4DELA 2IXUA 3TOPA 4XZLX 4MB3A 1VENA 4M19A 2INFA 1V6YA 2WQDA 5A8MA 1KCZA 3BLKA 1F7BA 2XPKA 4NNAA 3U9IA 3V5FA 3FN9A 3L5LA 1JPKA 1SJBA 4J4KA 1SPQA 4ROQA 5HANA 1OFRA 3V4BA 3WDIA 4P8VA 2X1UA 2ZICA 2BVDA 1SZRA 2UY2A 3P81A 3WK0A 4H8VA 5XIAA 1DJNA 1YEYA 1LJYA 2OFJA 4YLWA 3GB6A 4DBDA 1YE4A 3W7MA 1XYFA 1H4PA 3B9OA 2QEZA 1JULA 1F76A 3QR3A 3N9RA 1XGZA 1LT7A 3VKQA 3I6EA 2FPVA 4B16A 4XUGA 1F6PA 1E70M 1L6SA 3R43A 1N7KA 1VF8A 3KRUA 3EKZA 2Y63A 2BXVA 3RAOA 2WC4A 3PB2A 1PTDA 3G1FA 5D8ZA 2OXNA 1IIHA 1QRQA 3ID7A 4DJFD 3VCCA 3KBWA 3W2UA 3P74A 4GGHA 2OOFA 4DPPA 1J9YA 1W9UA 3NQBA 3KM8A 3AU6A 1IT7A 2VCAA 1M68A 3NQ8A 4W93A 5K4ZA 4JTJA 1CXIA 1EHNA 3OBAA 3U8GA 1IGSA 3CC1A 4YTQA 1KBJA 4IXXA 3UZJA 4XZHA 4IGNA 4XZIA 1ZY9A 1XD0A 2J66A 2ZDSA 5I5RA 1TA3A 1FVPA 4PCPA 4HT3A 4QFUA 1K03A 4DNHA 4OKDA 3C0LA 3KXQA 2BOFX 1Q7ZA 4INFA 3WK2A 2XUCA 4W8BA 2Y62A 4ERGA 1JYWA 2J7FA 4IQJA 1F61A 1E51A 3U7VA 1WXYA 3EX2A 1VFMA 4B2DA 4PTDA 1W9XA 3IIZA 2AMXA 2VD9A 3USBA 4Z2KA 1OX4B 4WJXA 3MTWA 3BMWA 3UCDA 4K8EA 4NAFA 2WYSA 2WHMA 4LY8A 2VGFA 3DHUA 1ALDA 1SU5A 4MWAC 1DJHA 1GWJA 3CIXA 1YDVA 3PVFA 3VOJA 3CHEA 1F4HA 3BQ6A 1XLKA 1AW1A 5HPOA 1ISYA 3WLLA 4UFLA 2WANA 4MWAE 3WLRA 2YCKX 3K8KA 2V67A 2PF0A 3M0HA 5LNWA 1LDCA 2GVGA 4ORMA 3JVAA 3PUEA 4UCGA 5LNVA 4IMGA 1E9ZB 5HUOA 4HIBA 4Z2HA 2XVNA 3W81A 1KGWA 3BG5A 3N3TA 5BW6A 4Q8OA 1AH3A 1H0IA 3HURA 3WMBA 1JRBA 1HFBA 1GQJA 3NQ2A 4DX3A 3AAMA 1JYNA 4UFMA 3NDOA 3HG3A 2WMIA 3LI1A 5I09A 2DFAA 3P62A 1FOBA 2G3JA 2Y2WA 2VFHA 3NZQA 1S46A 1NF0A 1O7AA 3UYCA 3PS7A 1R85A 1SJDA 4HB7A 1UWSA 4AVOA 2OEMA 2YX0A 4N02A 4JIIX 5EBAA 5IXEA 1V6TA 1L6YA 3TYBA 4IMAA 1ZBVA 4DHGA 4XD4A 4ZTXA 2QAPA 1QJWA 3RLVA 4ZTYA 1Q2SA 2WLYA 3C3NA 2XFYA 1JUKA 2WSYA 1XGDA 3CQJA 2QCEA 1REQB 2EPHA 3WBXA 4PEKA 2X0YA 5F1VA 4C5YA 3VAVA 3PHAA 4N7QA 3RYSA 1B3YA 1KFCA 3WH8A 3GTFA 2A3LA 2PB1A 3CJPA 3H26A 2P8CA 1V6WA 3AMCA 3PTDA 2X8RA 1O60A 1XINA 1BAGA 3GDKA 1TTPA 4A2RA 1FCVA 3W86A 2CYGA 4WXYA 2DIEA 1EEXA 4NILA 2NUXA 1CNVA 3ARRA 3RK8A 1J5TA 4HNNA 1E3ZA 3MMCA 2V3EA 3FK4A 1FCQA 3LCFA 3RXZA 2PDHA 4K8HA 4QIUA 5LXEA 4V15A 1QBAA 2FPTA 3VNLA 1KFWA 1E4IA 3C2YA 3NL5A 3TSBA 1QMLA 2XSJB 4GO9A 2HJPA 2W79A 2YDRA 4PFMA 3CBWA 1UB3A 5CJ5A 1D3CA 1AQMA 2CW6A 2WHKA 4WKHA 5CLTA 3HN3A 1RLCL 4FLSA 3BOXA 1R9YA 3OVQA 3MP5A 1A47A 5CPNA 3PULA 4A29A 1DJIA 3EA1A 3IGUA 5BMXA 3MMTA 3UWEA 4TX8A 4PCTA 1EX5A 3W1TA 4M1BA 4ZXLA 2VVNA 4EPKA 2JGQA 3SN1A 1GVSA 1JPMA 1FWSA 1YBQA 3WLIA 4S3BA 4K2SA 1SSGA 2CERA 4CNPA 4YVVA 1TZZA 1C29A 1JD7A 3TIMA 3IIOA 3W24A 4F3HA 2DSVA 1UKTA 5HR6A 3K30A 2J62A 4NXKA 4TU1A 3NWRA 2YIHA 3ITCA 3EOEA 1JZ4A 4GI8A 5A6BD 4B3KA 1QOXA 1GHSA 4EF8A 4KPLA 3S1VA 3WFLA 1KFLA 4ZZ9A 3N2OA 4WDTA 1ZBWA 1BQCA 4GI6A 3CUIA 3DYPA 3RCMA 1ZJIA 1VGAA 3AS0A 2DZVA 2ZUNA 4MWAD 4QLKA 3I7SA 2ZX9A 2WC3A 5DFAA 2DGAA 2GFTA 4NX0A 1PZ0A 2CBVA 5CPMA 5I77A 6GEPA 2D0HA 4UQCA 8A3HA 5HATA 4K68A 3RLGA 4V1XA 2CESA 1FHVA 2X1SA 4L1GA 3MMBA 4MYAA 4L6OA 3WF1A 2RDTA 1B31A 3R11A 2R1KA 3FVMA 1H7RA 1DWAM 1FDYA 4H8NA 3LTPA 3OA3A 2HCVA 3B04A 1JG9A 3OA5A 3M1ZA 2QDHA 5AHNA 3W01A 4L4LA 1E43A 4AISA 2R82A 2Z00A 4RV3A 1B4EA 4AD3A 2VJXA 1US2A 1E9IA 2PDJA 1Z8AA 3UWYA 3QOKA 4CN4A 1WXJA 5J5RA 1BWLA 3BCDA 3LNMA 2BODX 2ZZ3A 1XR2A 3AYTA 1A5OC 5EMKA 3GHUA 1BG9A 3OHMB 1A3WA 2QCMA 3CMFA 3MM7A 3G1SA 1SJAA 1CLXA 1TSIA 3WH7A 1B0IA 3GG0A 4HU0A 1NU5A 2JKPA 4YWIA 3VM7A 5FEZA 2YKKA 5H1WA 2SFPA 1T40A 1ZB5A 3GUGA 4GNKB 4RW5A 4ZOAA 1E0UA 3W71A 4NZCA 3TR9A 3AFBA 1YKWA 4QG9A 3H4WA 1IXNA 2OODA 3D0CA 3N12A 5KETA 1VKFA 3ITTA 3NEHA 1NFGA 1XM3A 4QM1A 4IHCA 2FHCA 4X22A 5CSSA 4O52A 2J77A 3ZZ1A 6TIMA 3UZ5A 2WKGA 1SO4A 3O7UA 2HE5A 2C18A 5F4WA 1ITUA 1E0VA 1UQZA 2KAUC 1GKRA 3ZMRA 3WLTA 5CBJA 4PGLA 1ZFJA 1ZZMA 2ZXBA 3T0AA 1VB9A 1MW2A 2DZAA 4S23A 2KX9A 3WBAA 1TJRA 3G6LA 4AD5A 3VU2A 4C6DA 4KWSA 3UWWA 3W7OA 4GJIA 1CGUA 1W3IA 1Q7MA 5HBFA 5DX7A 1XLCA 2A3HA 3OZYA 4PMUA 4CNOA 1VYRA 2ACRA 2UWFA 4EK7A 5J04A 4NJIA 4F9JA 3VKAA 2PDCA 5CSRA 1WV2A 2G3MA 1V8EA 2QMKA 7ODCA 1A53A 5K4XA 1EF2A 2FFIA 5AC5A 1P48A 3B0HA 1A80A 3AS1A 3N2BA 3SIMA 2XFWA 2YCLB 4M80A 2XIIA 3M5YA 4B9ZA 1S2TA 1QCWA 2B0MA 1FWEC 4WDXA 1KV5A 1F3EA 1UD4A 1DWGM 5EB8A 3SGGA 3CZEA 4E2DA 3KTSA 1Q8AA 5C8BB 3EWYA 4LEQA 1FXQA 2WQPA 1VIWA 4MAZA 4KEMA 4ZQRA 2PTDA 4H1ZA 4C7GA 3U4FA 3L66A 1MW3A 4W86A 4PUJA 1EJ7L 1MW0A 5JIWA 3STCA 4YS1A 2NQ5A 4S3GA 4F4RA 2YYTA 5ABGA 1R2RA 1KXTA 2ZC1A 2WHJA 2Y0FA 1Q6QA 3BG3A 3WKZA 2XWEA 2X1RA 5CLWA 1MDRA 3ALFA 1JNEA 3HJZA 2INZA 1IXPA 1CPUA 4AZGA 5LZLA 2DSZA 1EOMA 1HG3A 4EIVA 2G96A 4Q3MA 3M44A 3QY7A 1UWIA 2BV9A 2XN2A 3UY7A 4XVDA 1UROA 1BKHA 3DCPA 4EANA 1PHQA 3UY8A 2YGYA 2VT0A 3VKBA 1FP9A 1EJSC 1MXGA 1VCGA 1QK2A 3M7SA 5ENLA 1EFZA 1OT1A 3DG6A 4Z0SA 2OLAA 5AKQA 3ANUA 5G1YA 1SMAA 2NZLA 3EBVA 1VBRA 2PDMA 4PUEA 4JZ5A 5M2FX 2RJGA 3MBFA 3LPGA 3ABZA 2OO6A 5I03A 3UERA 5HAOA 4MB4A 1E55A 2C79A 3B8TA 1DTUA 1ZNNA 1QOPA 2Z1SA 1J93A 2PDQA 1HKKA 2R24A 4DZAA 1KFEA 3N1AA 3NQGA 3S6TA 4L5ZA 3ATYA 2VL4A 5XINA 4GVIA 2CITA 4AHPA 3CS2A 1JPHA 3AISA 1E4LA 2AKMA 3GVGA 3M5XA 1XYCA 3NQMA 2OT0A 1H5YA 1E5JA 3R4IA 4JCLA 1OYAA 4HOWA 1V6XA 3WMCA 3R0DA 1H11A 2BVTA 2QPSA 3QKZA 4OV9A 2CZDA 2CZEA 2R6OA 2HTMA 4L7ZA 3BMXA 1ONEA 3UJRA 1KD0A 2Q8XA 2Z2BA 3AALA 3RGTA 4LYQA 3WJZA 4J3VA 4MUPA 2HDJA 3E0IA 1EJTC 1UA3A 1XH2A 4MFDA 1XISA 4JBRA 3G0XA 1XLFA 1WKFA 2ADAA 2GJXB 3WQ5A 5IDIA 1IWAA 4DUWA 3R8HA 4GUGA 1RP8A 2RDXA 3TC6A 1AUSL 1Z6KA 1FX6A 2R9RA 1W2PA 4RDZA 1IEXA 1O5RA 2VFFA 1WZMA 3RMEA 4PB5A 5CC5A 3BDKA 2E6FA 1OGGA 3MI6A 3XISA 2IMRA 1J6PA 5HXMA 2PE4A 3B0XA 1UQYA 1GYLA 4IG2A 4AG0A 4UWMA 2AL1A 1EIBA 3N3MA 3BSHA 4DYKA 4XZWA 3T07A 1R3YA 4K7VA 1OX5A 1POKA 3W1NA 2YA0A 2CETA 2VM8A 4XKMA 2GK1B 3WD4A 3EA2A 5C54A 2J8FA 2OPJA 4XAPA 3QMSA 3HB9A 4O1BA 3GTXA 5K2ZA 1DWHM 1XDJA 3N34A 2VRKA 3AHYA 4MG4A 1FWNA 2VC5A 2VCBA 4JFTA 4JKMA 1BRLA 3AJ7A 4CUCA 1TX0A 2ESCA 1IT8A 3H8AA 1OADA 1XLAA 1HJXA 2C7FA 3PBVA 3QN3A 3EX4A 1BQGA 5JBFA 3LCIA 3EX3A 1OIFA 3CLMA 5EYWA 4GX8A 4X0NA 4R27A 2DT0A 3OYXA 2P88A 3UEQA 3IACA 2J78A 4OOZA 4MM1A 5FAJA 3WO8A 4DUVA 3EB4A 1K9FA 2Y7DA 4JDBA 3AHVA 5E6YA 1XI3A 1I6NA 2CBJA 2W0UA 4FO4A 5G2IA 4GKLA 2QUUA 1RALA 4WKAA 2WVSA 1B54A 4DO6A 3QMRA 1IWBA 2EPLX 2ONEA 4U28A 5C7VA 2PRHA 4JL2A 4AWSA 3VIMA 3SN4A 1IZCA 5CG0A 4Q8WA 1NFBA 2C19A 1BEUA 2Y24A 2QIWA 3ARWA 1LOSA 3L4XA 3GW0A 1TIMA 3S2NA 3AWNA 1NOUA 4FNTA 3BVJA 4GQRA 2ZRVA 1PUDA 2O0TA 3QOMA 4J27A 1XV8A 4DF1A 1QTWA 3GTHA 2WKLA 2XGBA 2PLCA 4ZL1A 4OVXA 2PU0A 3SBFA 2UV8G 4M29A 3TW7A 3WQEA 1KQZA 2Y6ZA 4C65A 4OBRA 2I1OA 4A6GA 5FCZA 3N4AA 2Y5JA 4LUIA 1C91A 2TAAA 4LC6A 1PCWA 2GJNA 1KBIA 3G24A 3AC0A 5B7ZA 1OC6A 1Q4WA 3MM9B 4MFEA 1J4EA 1QR7A 3E6EA 1H41A 3GFXA 1VFHA 3KZPA 3HIJA 3MSDA 4CN1A 1DHKA 3CZKA 1S5MA 5CPSA 3TOYA 5D2XA 4E0CA 3KP1A 4LUYA 1EJWC 3NSXA 4RZBA 4HZ6A 3APGA 3PNZA 3PZUA 4JTDA 2BVYA 3VI2A 4FXSA 1AJ2A 1E4MM 4HYWA 3PM6A 4WR3A 3CHVA 3EXRA 5IBXC 4JFSA 3DESA 4QEHA 2DPEA 4CEUC 4DLFA 3PJUA 3KTCA 3DHPA 4DXVA 2DP3A 4XKYB 1ONXA 1C93A 1UD8A 4Q32A 3AZSA 2Z7KA 1LZOA 3MVTA 5D9PA 4JX4A 3K4DA 1X8FA 4HJWA 3U7BA 4Q8VA 3GNXA 1KCLA 4XBKA 2YXGA 1QDSA 4S3CA 5CZSA 4C6QA 3D3FA 1LL7A 3N2CA 4K8GA 1P0DA 2ZA2A 1H7OA 4M6UA 4QBXA 3UJEA 1OFQA 5GQBA 2CZ5A 3GW3A 5FF4A 3R94A 1XLHA 2ISSA 5DY3A 4IFKB 1TPC1 3TYDA 4W85A 4ZA0A 3DENA 3XIMA 1CIUA 3EPNA 2Z1XA 2A7NA 1TUXA 1DL3A 3GC5A 4J5NA 3TFCA 1ZCOA 2VEIA 3LENA 1Z41A 4CD4A 3THAA 4G7EA 4E3VA 1TVPA 3EOSA 2WNZA 4BA0A 5A6MA 3ES8A 2VR4A 3T1GA 2J6XA 4DXXA 4LF2A 3E5PA 2ZTJA 4W84A 3G1RA 4FIRA 2BZNA 3URNA 1PE1A 3CIVA 3BSMA 3M0ZA 4CCCA 3CMJA 5B80A 2V2CA 3GBEA 4OV4A 4JTCA 1R0MA 3ZVHA 3A22A 3AHXA 4G9PA 2VXNA 4BQ4A 3ES7A 4KQNA 5CZKA 2RJHA 1Q63A 2UY5A 5I78A 3O3RA 3D47A 2E77A 3OP2A 3TA9A 3A5FA 1KM4A 3TP4A 3W70A 4AIOA 1L9WA 3CMGA 2FLIA 3NQ6A 1MQQA 3WEZA 3F2DA 1IEVA 1CGYA 3V5CA 4X9SA 2VUNA 1YTEA 1OD0A 1KRMA 4MJ4A 5H2ZA 3MM6A 1TKKA 3A23A 4GYKA 3VE7A 1TREA 1WUEA 1ZAIA 2PAJA 2E09A 4GJ1A 1JQXA 4QSFA 3WNMA 3M43A 1HUVA 4H19A 5I3DA 2YLAA 3ZT5A 5IRPA 3KBSA 2WJFA 1V4YA 4MIMA 1DJGA 4O0ZA 1G01A 4FB7A 1C8YA 1U22A 5K7JA 4ZO8A 3CGTA 2B7QA 5D8WA 1HKJA 4AZBA 2BNJA 4UTWA 1UPMB 1KWGA 5AECA 3EB3A 2E8YA 1H7XA 3NGFA 4HNUA 2VFEA 3K13A 2WZHA 2R1PA 3ZO9A 1DIKA 2XG9A 1A5AA 2V5LA 5CPLA 1JCJA 1JGMA 5A8QA 1LG1A 1FBAA 3L4ZA 4O16A 2FHBA 7ENLA 2B81A 1W9VA 2V68A 3PZMA 3WEMA 2POTA 4URIA 3U48A 1RD6A 5AVNA 3CH9A 2GGJA 1DORA 1NJJA 1TE1A 4QG8A 2CLKA 1WDWA 2NX9A 2CHOA 3EOUA 4DZ5A 2ZE0A 3MUY1 3G8RA 2GQ8A 4Q7IA 4Z0JA 5I00A 1C7TA 2OQYA 2ZE3A 4V27A 3VGGA 1O12A 4EWJA 4K1GA 3M7WA 4M5PA 1PXGA 3MWAA 6XIAA 2FB2A 4A4AA 3MZ2A 2OOGA 2P10A 1UA7A 1FTXA 1UZ4A 3HQ1A 4GIAA 3VC5A 3LHUA 1CXFA 3MYPA 1PTAA 1QI4A 4J3UA 4HN8A 4O11A 3E12A 1RD5A 2HVOA 1U5VA 4PULA 3S4TA 1JZ8A 3N2XA 3T08A 3PPGA 2YR1A 3N13A 3S5YA 1IF2A 1EIXA 1EF3A 1JDFA 1MNZA 3WQDA 3W88A 3VIKA 1GGOA 3L2MA 4NZ5A 2CU0A 3K8LA 1FKWA 4U4MA 2VQTA 4KEUA 3P60A 1OGSA 5AYYA 3T0DA 4Y7EA 5JBDA 1XPGA 2QGYA 4Q8MA 4R34A 5CAHA 2YW4A 3Q2DA 1GEQA 1E0TA 5BNKA 4H9TA 2AGTA 3CQ0A 4HD5A 3CV7A 4WSHA 1EP1A 3DXIA 4N9DA 1NDYA 3UG8A 3TUUA 2OMAA 1FH7A 3GDRA 4R53A 3P14A 3VOFA 4B15A 4GH1A 4DBUA 2JQXA 1ZJAA 8XIMA 4A3RA 4YU1A 1XCFA 3TAKA 1F05A 3GZ3A 3QLLA 2Y61A 4PUWA 3URAA 3S1WA 4AWUA 5LIXX 3SUTA 4AFYA 4LAKA 5HJYA 3C2RA 4U31A 5MKGA 4PTXA 2ZZ7A 2JGYA 1LUCA 1M03A 2XSBA 4JOMA 2WSKA 2C8NA 1CWYA 3Q94A 1M7PA 2QKFA 2DVUA 2Z2UA 2A21A 5GNYA 4X63A 3IV3A 3NOEA 4RDWA 4TV6A 4MB5A 1HKWA 7XIMA 2EPKX 1EGVA 4CQAA 3MKCA 2DW7A 4HK6A 5EMLA 3M5ZA 1U5JA 2JF7A 3EZ4A 2FZNA 3T81A 3NQCA 4HCLA 3FYOA 3W6YA 1RXOB 1XIMA 1HN1A 1ADOA 2JKEA 2ZZ1A 2PFHA 1R3WA 3FW6A 1ADDA 2BASA 1SQ7A 1PKMA 4XZBA 2A2IA 5DMYA 5C6MA 3UCCA 3K8MA 5T26A 5DT7A 1MRAA 3SCTA 1VBJA 1W91A 3MUIA 2NT1A 1TPVA 3ZLFA 3ZOAA 4AZCA 3OOQA 1OABA 4DN1A 1K8CA 2YW3A 3M64A 4LGXA 4H9MA 3NO5A 5CC6A 3H2FA 1Z9AA 3ABSA 4XZMX 4W5UA 3QKEA 4YJ5A 4IGSA 1TG7A 1XLEA 2JEQA 2VX4A 4UTFA 4EVZA 3CQIA 3KVMA 4G8TA 5JVLA 2WB5A 4AB4A 1SFTA 4GUFA 5D04C 1IZJA 5FACA 5IHRA 1GQKA 1QW7A 1VFOA 3L0KA 2ZUUA 1HGYA 1EHAA 3HO8A 3NXLA 3WD0A 2YCJA 3G1XA 4WF7A 3WUBA 2WVTA 3A5VA 3SRFA 3V35A 3ZJ7A 3HPFA 1U30A 2ISWA 3RX4A 3PZGA 2FJKA 3OPSA 4GZ7A 3UW6A 1AD1A 1ZSXA 3W7HA 3ZSTA 5A1AA 4G38A 5U4NA 4DJEA 1O6IA 4O1EA 2D73A 1SJCA 1NAL1 5JQ9A 2V3FA 4BQ3A 3ITYA 2E9LA 1UD3A 2INEA 4IF2A 4B2DD 4CD6A 2O9TA 5CH9A 3UR7A 1W17A 3VKSA 1K02A 2ZFAA 1PSCA 3VUPA 4LU0A 1V02A 4HOZA 2I57A 1CCWB 2BHZA 4IQDA 1ZJHA 3LA4A 4RK8A 3LDVA 4FNUA 1A3XA 1YTDA 2A3EA 1AQHA 3DKLA 3THDA 3UESA 4XAGA 5AC4A 5HQMA 3OYZA 1A5NC 4MJMA 1UR1A 4AD0A 1F6YA 1O1HA 4Q4PA 1K1DA 4FNSA 3GNOA 4AD1A 1TPB1 3B0LA 3WD2A 1RQHA 4RNJA 4QEEA 5CSUA 3DHFA 2ZRWA 7A3HA 5D9NA 3PZNA 5LHEA 1GZ1A 3WUEA 3R58A 2J79A 2VO5A 1EDTA 3IVUA 3HMJG 3SSZA 3MDUA 3C0QA 3NNTA 3CPRA 4MPKA 3PBMA 2ZQ0A 4OU1A 1QXLA 3AXHA 1SO5A 2PDYA 2Z24A 5A6BA 4RPQA 3QTGA 1T7LA 1XYMA 3FJLA 1XHGA 3MM5A 1LL6A 3ATZA 3BUVA 3EMZA 3IUIA 4QNEA 1EBHA 3CUGA 6XIMA 2F8QA 2VEGA 1CX9A 1YMYA 3U5UA 5CXPA 2DY3A 2H8XA 1UH4A 2W9MA 3TAOA 4J28A 2EKCA 3C52A 4DZIA 1UYQA 3QXBA 3KE0A 1OYBA 2JFEX 3SCVA 1LYXA 3H2AA 3SZ8A 4HPJA 1E6QM 5AN7A 1OQFA 1A5MC 4RLIA 4E2OA 1G0CA 3B9DA 1V79A 3PBYA 3UR5A 1RJPA 3UWQA 3F4NA 1C7SA 1VFTA 2GWNA 1TJ1A 3ONCA 1TZ9A 3LLDA 1C90A 3HGSA 4E8GA 3TVAA 2OU4A 5I3FA 1OD8A 1PCKA 2PWEA 1YADA 3OBEA 4FNRA 4WEVX 5KMYA 2XGIA 2QPXA 3TROA 3QZEA 4TUFA 1Q6GA 2C6QA 3WQVA 1WQ5A 4H9XA 3AYSA 3D6NA 4GABA 2EJ1A 4ZQCA 3B3DA 2WZMA 4B5XA 3E49A 4ERAA 3OIHA 4O4WA 4KIRA 1WB0A 5AYZA 2PTXA 5BXSA 2XFRA 3QW4B 8XIAA 4Z08A 4B5NA 1BFNA 3VILA 3S9IA 1TV7A 1QW8A 2EJAA 4Q8UA 4WY0F 1BPLB 2GDVA 4LRSA 1E6RA 3S2MA 1SUXA 3IJ9A 2VKZG 1OB0A 4ILSA 2WSQA 4Z1YA 3EPMA 2IUZA 3I68A 4K7YA 1EBGA 4NNCA 2HWGA 2J27A 3C4UA 3WMLA 1SVDA 1K4HA 3TLLA 3VDAA 3TNBA 4Z1DA 4UNKA 1UKQA 3QW3A 2XIQA 2PODA 3O1NA 3H7UA 3T6CA 1OCJA 4LVDA 1K70A 3E2QA 4LUJA 6CGTA 1XRTA 1K3UA 3IIVA 1WNOA 4H41A 1BYAA 1TMHA 2W61A 5AYBA 3AXXA 1V3MA 3E0VA 4Q4MA 4NHVA 2DU2A 3QPZA 3SRHA 2GWGA 4MKVA 4Y96A 4HSHA 1PJ9A 4GQ0A 3TWBA 2E5BA 2C1HA 5AC8A 1HVQA 4XSLA 3G1HA 3BO9A 4FZIA 3G5EA 2CLLA 5ABFB 4TQTA 2E9BA 3U2OA 1RK5A 4AXKA 4UFKA 1K8XA 4YVXA 3QGVA 3E0WA 5KZ6A 3H7VA 3OR2B 1ZTVA 2Y8VA 3TN6A 2YXOA 4V33A 2L5HA 3VOCA 3MUXA 1JCNA 4J40A 4PMNA 1B3VA 1JI2A 1J0HA 3VVGA 3MHFA 4HBKA 4GD0A 4AC7C 2QIIA 1NWSA 3WNOA 3DU0A 2V82A 4LCSA 1ZJ8A 2Y4SA 2J47A 2DUAA 3UG3A 3DG3A 3VOHA 4C6LA 5A6LA 1GW9A 3W1PA 4FXRA 2ODOA 1AD4A 3P5ZA 3AIQA 3NTYA 1XLBA 2QYGA 4PMVA 3PB0A 2FHFA 1E72M 2FDSA 2DVXA 4O54A 2E5CA 3ARZA 5DBTA 3R8GA 2EPNA 3CQHA 1SSDA 1CZ1A 2VZVA 3TNOA 2YL5A 1RBAA 3IGXA 3MVIA 3VM1A 2DSWA 5EU9A 2GVYA 5BRPA 1CXEA 1ZBCA 2Z27A 1X6LA 3WJXA 4CCZA 4PMDA 5CSYA 1UZHA 3I4KA 6PTDA 4AEEA 4EPBC 1ZL1A 4C6MA 4ZQMA 3VNZA 5DXXA 4XBSA 4AZHA 1AVAA 1X1NA 4DBWA 3AIRA 3DGRA 1J0JA 4JTKA 3AMDA 2QUMA 3H54A 4BZYA 4CEXC 1TMQA 4O14A 4MHBA 1GOKA 3BPWA 3OJGA 2CFFA 1YE6A 1YPFA 1BVNP 4G1KA 3MM7B 2ZADA 1KW1A 4JICA 3SADA 1W9PA 3SGZA 1S3TC 4MADA 3PFMA 2V6AA 1WA3A 1XL9A 1EL3A 4WXZA 3W3OA 3M07A 3P0XA 4AWEA 5K9DA 1VFSA 4D8AA 4BQ5A 1ECQA 4MZ1A 1OFBA 1UPPA 3VZXA 4O1DA 4A3QA 1ISVA 3II1A 3AXIA 3N6QA 3WLJA 3RLHA 4W9TA 1UZ1A 3EXSA 2AKZA 2C1IA 4W7VA 3TYAA 3NJ3A 3QY6A 2OVLA 3WDRA 3DUGA 1JGIA 2ZRYA 3BW2A 4MZ8A 4AOPA 4PBGA 2WOQA 5ABTA 3N6HA 1HZYA 3QPYA 1DTNA 2A85A 2ZWYA 1HKMA 5IFTA 1R2SA 3BGAA 3L67A 4HMDA 4PCSA 4O15A 3BARA 3STEA 3S1UA 3KOZA 4AVNA 4B4HA 4GYFA 1HL9A 4HKPA 3RU8X 1QAPA 3O07A 3S2LA 2CLFA 2YL9A 2IXVA 4H6EA 2A79A 1QUMA 4HGXA 3VC6A 5AC7A 3LBCA 5D2TA 5I3KA 2JEPA 4AH7A 1EP2A 1HTIA 4PMOA 4ES4A 3KBVA 1AH0A 3VKTA 3ZVIA 3OLDA 2FZ8A 1M53A 2WWDA 2QQ6A 1EX1A 4HPNA 1FWTA 3ARSA 1YXYA 4XG1A 3EPOA 5TAOA 4NY2A 1CW2A 2O56A 3KOFA 1TJ0A 3KL3A 3W6LA 2J9YA 1TPEA 3REQA 3CHDA 3CWNA 5CJNA 4QE1A 3LBMA 4H6RA 3W27A 5XIMA 4IP5A 4KWWA 4M81A 4ML4A 5G4WA 4KRUA 4OFCA 1H09A 1W8SA 3QHNA 3WDJA 3GAYA 3LZ3A 1GQNA 3ARYA 4L1WA 4XV0A 4OBSA 1P0NA 3HA1A 3B4UA 1BXNA 1MWOA 1T6MA 3FJNA 3M16A 4DEFA 3AYRA 4IXHA 4QS6A 4JN8A 3BMVA 3MM8A 1FA2A 2OGJA 2PC8A 5BROA 3V36A 3JUGA 4B5WA 5HMDA 3L68A 3U3HA 3E02A 3TCSA 4LUSA 4AW7A 1N55A 1E6ZA 3PUGA 5E0KA 3W87A 4YWSA 3W7QA 4D6EA 4R9XA 1VFFA 3BAXA 3URQA 1OC5A 4KCWA 1I2OA 3VMPA 4QQUA 3PSWA 1OZQA 4AAJA 1XIGA 1O5XA 3C6CA 3GIYA 1NELA 3UT0A 4AD2A 1HKIA 1F3XA 4QQ3A 3RCYA 3TR2A 4ZSTA 1I2QA 2Z6JA 4GBDA 1P1XA 3P6LA 4W8AA 2O55A 5HJLA 3CYVA 5RUBA 4NKCA 2XVPA 2WKJA 2POZA 2OYLA 4ZOCA 3GXMA 4W4QA 2B4GA 5D9MA 3SQSA 2BWGA 1S5TA 4D6FA 3W2KA 1THFD 1JZ6A 4J1OA 2XH0A 2XISA 4BR1A 2Y7FA 4F9DA 4DPQA 3SY1A 4CD7A 4DF0A 3EWBX 4P7RA 3TXZA 5AOUA 2VR5A 4HTYA 3TQ0A 3F4CA 3ARXA 4DUOA 1OF8A 3D3AA 2R1MA 4ASTA 4QG6A 3H21A 1XLJA 4CQBA 3AICA 4RE0A 1L6WA 1OG0A 2G5WA 5DRCA 3GVWA 2QZRA 4FEZA 4BF9A 4AIEA 2E0PA 2RFGA 1JZ5A 2A4AA 1A0DA 2G50A 3HG5A 3KS5A 1QWKA 3AIBA 4H7ZA 2BMBA 5DMLA 4AYSA 1IYXA 3E0LA 3ZFHA 3D46A 2NUYA 3DC8A 4KRZA 2WCAA 2QUVA 3W7PA 4WX2A 4PRWA 3E5BA 5A69A 2Z1VA 5C5YA 4X3ZA 2X7VA 2EPMX 1EXBA 5DN1A 4ZMGA 1ZU8A 3A4AA 4UZUA 4UR7A 1ME9A 3QC0A 4UOQA 1PIGA 2X0HA 3HPAA 4E6MA 3MJYA 5BU9A 3LPOA 1OCBA 3S5NA 2VX7A 4MUZA 3GC2A 4QITA 4AC1X 3ARUA 3HTWA 5K3VA 4YN5A 2VZSA 4ALDA 1TCMA 3NDZA 3E38A 1F6KA 3ITXA 1DYSA 3KLLA 3LS9A 4IG2B 3K1GA 2WCSA 2A6LA 2ISFA 5CKSA 7TAAA 1M5WA 1TZ7A 3SEPA 1E15A 1W6TA 3ZXWA 5JUVA 3IUDA 1OHLA 4WD0A 2OT1A 3K2GA 2CXEA 2QCDA 2E28A 2WVVB 2XSXA 4WGXA 3R6IA 2J13A 1OFAA 1NIUA 4M8UA 5A6KA 2ZX5A 3GO2A 2ZRZA 2PUZA 2FZ9A 1G94A 1EEPA 3EDJA 3NSMA 3EGJA 1UBPC 3ZM8A 3VZYA 2BGQA 1PX8A 2BOGX 5HJXA 3UXIA 3FXGA 4P7OA 4ADTA 2PTYA 3HG4A 2Q3OA 3TTQA 4DJDA 3UVIA 8CGTA 4IPLA 3VKRA 1U2YA 3B03A 4GMEA 2GLKA 4FP1A 2XINA 4DWSA 3CLWA 1JNDA 4LWWA 2A0NA 1FFRA 2IKGA 1LM1A 1YRRA 2G3FA 3GNRA 3ANYA 3W1UA 2QDGA 3W83A 4QROA 5DLCA 4H9YA 4Z42C 4QAIA 3R89A 4D6DA 3BAKA 3HGRA 3MV01 3A3HA 2QVNA 3B4YA 1KM2A 2W4XA 1BD0A 3R13A 3V0UA 5CPTA 4HMNA 4UFIA 1W1TA 4ZO7A 2Y89A 3QSRA 1OFEA 5A2AA 1E6SM 3W7NA 3K5XA 3Q65A 1R2TA 1EC8A 3GU1A 1OCQA 4WCJA 1H50A 1XCXA 3W9ZA 2IKJA 3GHRA 1POJA 5FJJA 4DLMA 3MYOA 9CGTA 3F03K 1H1NA 3W74A 2IW0A 2J7EA 4Y9PA 2VDGA 5B7YA 3LV5A 4Y9AA 1XRSA 5I24A 1WUFA 3QQ1A 4M24A 3RR1A 1RK6A 3SQLA 4JEJA 1MUWA 3RRAA 4GLEA 5I3GA 3LQGA 3IJ8A 5EKYA 1BGAA 1QFEA 1HJQA 1KLZA 4AX7A 1E1CA 2DEPA 1H1YA 3VKKA 5DCDA 4Z2LA 3LERA 4IIFA 4JNMA 4UTWC 1ZPTA 5DANA 1YPIA 3EWXA 3F5LA 3QGAC 4US5A 1R46A 5D03A 3ERPA 1KQYA 3W4RA 2FH6A 2WZTA 5BOFA 4IUGA 4A3HA 6REQB 3ISIX 1TWZA 1IE7C 3YPIA 4J2MA 4NI3A 2GVJA 1W3NA 4C6EA 2GGGA 3THQA 4XVEA 4K38A 1SR9A 4XAFA 4P7LA 3ITOA 1WCGA 1EB3A 1IR1A 3OHIA 3MMAB 2VR2A 1ZQ5A 4CLMA 3R8RA 1UG6A 3EEZA 4O8AA 1QNPA 2HXTA 4N9CA 1M3UA 1NWRA 4OWGA 1E0WA 3QC3A 4Q4RA 2ACQA 2R14A 4ZR8A 3RM8A 4U5KA 2PP3A 1TTIA 3WNPA 3QQWA 1PTGA 3QBUA 3W7DA 1I2NA 3R2GA 2XTKA 1JAKA 1GJUA 1JEZA 1UKPA 3MO4A 3M0IA 2D0FA 3T09A 3PZQA 4TVDA 4OQVA 3M5VA 4I6KA 4FA3A 5T8GA 4AD4A 2VEMA 2Q3RA 4NZJA 5HUPA 4LVFA 3L12A 5BWFA 3IS4A 2GOKA 3ZLHA 2Z6IA 4MKSA 4U2YA 4ATLA 3J7HA 3N4EA 4FI4A 1WKEA 1NARA 2GL5A 2DZBA 3CHCA 2PZ0A 4NZFA 2E6AA 1EC9A 2PWHA 3MKVA 4N4PA 5EFFA 5A6SA 3ZIZA 1RCQA 3OR1B 2DH3A 3OO2A 4H01A 2VEKA 3P84A 1XP3A 5JH2A 5G1MA 3PZOA 3VLYA 4L56A 4M6VA 2C15A 3A24A 3SCOA 1UWAA 4AEFA 4OJYA 1K7EA 1K9DA 2PLKA 3T55A 1SW3A 1F4AA 5D2WA 3WQPA 3L4UA 3MA8A 3DYMA 3LNPA 1QI0A 1C92A 4LPCA 3ZVHB 3BCFA 3P2VA 5EMUA 1G1YA 1VJZA 2GGEA 4JTLA 4FX8A 3R25A 1I1XA 1PDZA 2I9UA 4EX4A 4GQGA 2YYUA 1UJQA 1KWKA 1M1BA 1O5QA 5TIMA 2V30A 5A3HA 1G7UA 1W5QA 3B0JA 4ZFMA 3NVDA 1OX6A 1M41A 4O13A 1SM9A 4HCDA 1GPWA 1GZGA 4TTGA 2OYKA 4GXMA 3CHFA 1ESWA 3I7RA 2Z29A 2AL2B 3R0UA 4H7CA 1REQA 3LPPA 3QH2A 4HPHA 4MOZA 3T05A 1G4SA 3B0MA 3TZNA 2BX7A 3ZLGA 3O16A 4NZ4A 4KERA 2FGZA 1W3TA 5I3JA 1W0MA 7GEPA 5ECUA 2BDQA 2I7GA 3KL5A 3L2IA 2EPOA 3WIJA 3N6JA 4PBEA 3BL3A 4WDWA 2QGHA 3G1YA 1TR9A 1ME8A 4JDYA 5TNVA 9XIAA 3QHMA 2FGLA 4B5TA 4RXGA 3WY1A 2G95A 4K39A 4D9PA 3MPGA 3WF0A 4RKAA 4A8LA 2D69A 3QR0A 4QJ4B 1BYCA 1H61A 1CB2A 4S3KA 3NGJA 1NTHA 4UQAA 3W37A 2VQUA 4U2ZA 1DBTA 1PPIA 5EBUA 2VVSA 4RNHA 3VD4A 1WDPA 1DIEA 3S3GA 4GPNA 3CL7A 1ELSA 3AJXA 1GOIA 2XSJA 3GVRA 2VC6A 3W00A 4EPDC 2GQAA 1D8CA 1J8VA 2FMOA 1MEHA 2YB1A 4W88A 4GGBA 2VWTA 1RJRA 6ENLA 1YXCA 1SO3A 4C1NB 3VGEA 5E0FA 3L23A 5E93A 2CNCA 2GUYA 3CB3A 5F2LA 4NAEA 3NZGA 4HNTA 3SGUA 4GY1A 3WN6A 1A49A 3VD9A 1C9WA 3IJDA 3TMQA 3CV6A 1EWDA 5CGQA 7REQB 3T40A 2VRJA 1IGWA 3OGVA 3M0KA 4K36A 1AODA 1YNYA 4YTSA 3H2OA 3UGRA 3LN3A 2BY3A 3SCNA 3H2NA 3GVQA 4L64A 5EL1A 3PBGA 1MQPA 1G5AA 2Y8KA 2WSRA 3WL1A 4W89A 2W91A 4AWTA 1WXZA 3TW6A 4MMWA 3CB8A 3S42A 1OBAA 4F66A 3RMJA 2P8BA 3O6AA 1GOXA 1JVNA 3WK3A 3E3HA 4DJEC 1XIEA 2OZTA 2A1YA 3TW9A 1UMYA 4KCUA 3W84A 1YDOA 5DMMA 4K6AA 5DF0A 4UNIA 4GYPA 3NPWA 4DQWA 3FJ6A 1JFXA 1HW6A 2VC9A 2I56A 2NLYA 1KM6A 4IIDA 1ZALA 1VBHA 2AOPA 1R87A 1QNQA 1XH0A 2I5QA 3IUHA 4HYRA 2Q8ZA 2JIWA 4JTGA 3UWUA 3ZSSA 4RV8A 4NZ1A 1KXQA 1B30A 4NT0A 3L21A 1W1IE 5FKYA 2HRWA 5HQLA 1U1UA 4UR9A 3BJFA 1LG2A 2PA6A 4DO7A 2QJJA 1Z42A 1SZGA 4Q22A 3C2FA 1V02E 4MNKA 1RP9A 2VGGA 3GXPA 1QASA 3PBUA 3WBYA 4M82A 1BXCA 3LOTA 2GUUA 1H49A 2V8ZA 4AHOA 4Q6XA 2WMFA 1BG4A 2YXXA 4FX7A 2ALRA 3GU2A 4GJJA 5BXTA 5D09A 4GZIA 3RNDA 1WDDA 4CGTA 2WMKA 2WMGA 1PO9A 1KRBC 4BS0A 1YTKA 3HFTA 4GOAA 1XC4A 1H5VA 4K1WA 3E2VA 4YTTA 4FLQA 1OC7A 1XBVA 2X09A 3OU8A 3SJNA 4C7DA 1V08A 2IS7A 2BSLA 4WRHA 1TV2A 1O68A 2IQ0A 3PTQA 5HWJA 3RR4A 1S2CA 4Z2GA 4IP4A 3BANA 4MJZA 4NF7A 2BGSA 3GNPA 1K6AA 3AS2A 4LUTB 3S47A 4FOJA 1H2JA 1QO2A 2ZC8A 4JYDA 1SZEA 4V28A 5CQ1A 4Z2IA 3QVQA 3UJFA 2QAFA 3S2JA 1TTQA 3GLCA 1V6UA 4J3SA 1WKYA 3KRSA 4GA8A 1JF5A 7CGTA 3EDEA 4HSNA 1F9CA 2CZVA 4FF7A 3IAQA 1UUMA 4UTKA 3GIQA 1GOWA 3LY0A 4Y6GA 4JL1A 3TV8A 1J79A 1W31A 1FWGC 2AMGA 4RL3A 1EA9C 1JYVA 1L2UA 5CGMA 3VGHA 1W3KA 2HVMA 2GOUA 5HULA 5C9UA 3BQ5A 1PHWA 1VZWA 3PPCA 3BZGA 3GTNA 4UTTA 3AXMA 3LHWA 1EO5A 2W92A 4C6FA 4QX4A 1CGWA 1TPDA 1YIXA 4X2RA 5FF7A 3VGBA 1SZNA 1TRIA 5DCBA 2G97A 5AHMA 5H91A 1MMFA 2CWXA 3IV8A 4A22A 3LPFA 3P61A 1UUOA 4J2PA 1JD9A 4NYUA 4GIYA 4GQBA 3LHTA 3WBWA 1TWIA 3JS3A 3PJWA 2EGZA 4PUNA 4UOJA 3Q37A 5A6AA 3PTKA 1N8IA 1W5NA 4GACA 3O0FA 2F2HA 3QZAA 1OY0A 1CI1A 1R38A 4QAWA 4GCXA 1WBJA 3O05A 5T9BG 3H2CA 3CO8A 2OWCA 4AY8A 3N4FA 1F07A 1HVXA 1C8VA 3TC7A 1EJVC 3GM8A 5D2YA 4O10A 4HNVA 3IRSA 1QO5A 1S38A 2YCLA 3GG8A 3GH7A 3VCRA 2W6RA 4ICCX 3BV4A 4GINA 4MSSA 3G77A 1UJPA 4IFOA 3UZWA 5CZ0A 1EJUC 4J7RA 3UXAA 4M56A 1KGXA 1Q65A 2ZCGA 3EWWA 4HA1A 3U2ZA 2WWCA 2LLEA 5I3IA 1TJPA 4HMEA 4PBFA 3VYLA 4DJED 4GZJA 1PB0A 1J5SA 4RNIA 2QHAA 5BXPA 1TV8A 4DAFA 1Q6RA 3GVVA 2PDBA 1DJYA 4RXFA 4LAMA 1AH4A 1HP5A 3WYZA 3P5YA 1YNPA 1WPCA 3DFSA 4LALA 4ZOBA 3UA4A 3WLHA 2YOCA 2FH8A 4GVGA 4Z1AA 4DO5A 4JTUA 4X9YA 5GPRA 3MCMA 2YFOA 4K3ZA 1NSJA 1FHUA 2E25A 4N6FA 1B3OA 2Z2AA 3MHUA 2E6DA 5I79A 1XYLA 4DYJA 4F0KA 1A3HA 2V0TA 1GKQA 2HS8A 5E6ZA 2IPJA 5MF5A 3IGSA 3BLIA 2R1LA 4KFOA 4M1RA 1UR2A 1JL8A 1HF6A 2DUXA 4AF0B 2WM0A 4Y9OA 3TK7A 3LTYA 1YDYA 2VELA 2E6YA 2I16A 2OKTA 4M6QA 1NWTA 1US0A 2W63A 1VJSA 3WQ8A 1Y5WA 2HBXA 2WV8A 3UZZA 3VCNA 5M1TA 3GSMA 4JTQA 2X2YA 5GNXA 1TPWA 4ZE5A 1YNQA 2BY2A 3FDKA 5AC6A 3GYCA 2VENA 1UC4A 1MFVA 4XO7A 1DIDA 2PGFA 3FHQA 4LJ3A 3G1VA 4C6BA 2P1FA 5GJNA 2GSJA 4RE2A 5H8PA 4QGCA 4MWAB 1X1OA 3V5OA 1O1ZA 4HVXA 1UCWA 5A6JA 2AKJA 4GEPA 3V0SA 5GEPA 3TSMA 2QS8A 3FX4A 1W3HA 4ZBCA 4XO6A 1AZ2A 1FH8A 1R6WA 3CEUA 2C0HA 2P0OA 3HJEA 1VH7A 4D72A 1H51A 5J5DA 1H7PA 4KCVA 4M3PA 1QNSA 5FF0A 3SUWA 3TKFA 2VOTA 4U10A 3ZJ6A 5LIWX 3B8SA 1YPXA 3BAYA 3BLPX 4D6GA 3O6YX 2ZZ2A 3B8DA 3PWAA 4C91A 3CUJA 4KFPA 1MXSA 4UQDA 2GJXA 3IJ7A 1JYXA 3PR2A 2J8GA 1A5BA 4TVUA 2V4JB 4L9XA 3STPA 4ROPA 1E56A 3B8IA 5E5CA 2ZDRA 4NRRA 4UIOA 5DXYA 1AK5A 2F6KA 2Y85A 4JHOA 4QR6A 4R3UA 3AYVA 1EUAA 2I5GA 3TTSA 2BY1A 3E96A 4I7WA 2HNHA 1BYDA 2DZTA 1ECEA 2J6VA 2JALA 3IAPA 3IPWA 2GSHA 3P80A 2NWRA 3MU7A 2O4MA 3UYIA 1ZGDA 4BEQA 1Y5VA 2GK1A 3GBDA 1XIIA 5LIKX 2EQDA 4ERIA 2X05A 3JR2A 3PFRA 3VIGA 4PA8A 3KCLA 1Q6DA 1RCOB 3QV6A 4IMCA 1CGXA 3VLZA 3GG7A 4Q4SA 3SY5A 3GTIA 1JF6A 3Q58A 2V5KA 1UOKA 1RZMA 3MQTA 1OFPA 1ZJ9A 3ONBA 4RW3A 3ZJKA 1Q6LA 3UETA 2OG9A 1KV8A 2IKIA 1D3GA 4LANA 6ALDA 2OQLA 4R85A 1LRQA 2WMJA 2HZGA 4L61A 1TRDA 2JKAA 4PFHA 3QEZA 2WNNA 5C9RA 3RDKA 3KAOA 4B5VA 1R9XA 1K4GA 2OCZA 2XDFA 2V5JA 5IDZA 3KZSA 1I2RA 4Q33A 1RCXB 2OR2A 1TWSA 4MKNA 5DBUA 3WLSA 1OINA 4A8RA 3IGHX 4UTHA 1V0NA 4H83A 5EPDA 3W23A 4ZB2A 1JXKA 4J35A 4ML9A 4UQ9A 1BTMA 1LQ2A 1GVOA 2ISVA 4XISA 1GJWA 5LNUA 4YCOA 1T0OA 2XFFA 5EY5A 3PBWA 1QHZA 4ADSA 4KFNA 3S5SA 1EZ2A 3VPLA 3WSUA 5ABHA 4YPJA 1S5NA 4LYRA 2KZHA 3B40A 1K8ZA 1LORA 2H9AB 1GONA 2OKOA 4G56A 4P5UA 1XF0A 1H0GA 1B1YA 1OFOA 3TYZA 3P82A 2ZX8A 2CWNA 4D1IA 5HNRA 5T91A 4GUIA 1QPRA 5FSEC 4FPSA 3WUFA 3WQFA 1K7XA 2GQ9A 4KH2A 4MYXA 5E9XA 1J0IA 2PDIA 1PX4A 2YL6A 3DH7A 3HM7A 1IZKA 4YHEA 3VTRA 3N25A 4EXQA 1KXVA 3A9BA 4R7WA 3SR7A 3MM9A 2WJEA 3O63A 4CU6A 3GFYA 1EPXA 2RDWA 1QHOA 1RJQA 2CLEA 3V1HA 2PRLA 3URBA 3U2CA 4GX9A 3BJTA 2Y88A 3K4AA 1EQPA 2DQWA 1XIFA 4ICMA 3UFYA 4JQ3A 4IX2A 2NVDA 1FWDC 4X60A 1D7KA 4S3FA 5BRQA 3MUZ1 2J24A 3L0NA 2GVEA 4WJ8A 5LIYX 3DFOA 3HMCA 3W0KA 2UZ9A 4Q7NA 3GD6A 1Z48A 2R91A 4O4VA 1DJWA 3TQKA 5M17A 3WNNA 3NVTA 1QWGA 3S9ZA 3EB2A 2PGEA 2FZDA 4QS5A 3MW7A 4IP7A 2PD9A 4XUYA 4H9VA 1TB3A 4QJ5B 3L4VA 5LA1A 4JR5A 4OUIA 3V75A 1XW8A 3O6CA 5AYIA 3UR8A 3BV7A 4GUJA 3CM4A 1VYPX 5JBEA 1JIBA 3IIPA 3HPSA 3OGSA 4HZ7A 5F2IA 5EGRA 2R94A 4I9MA 4JN7A 5DO8A 1GYNA 3ZWTA 3LYEA 1F8IA 1UP0A 3FOKA 3KOYA 1OIMA 5D38A 2D2HA 3ZR5A 3GIPA 2QXWA 3ZT7A 2F2KA 4J3WA 1WBHA 2PSNA 1W1A1 3CV1A 2PC4A 4V1YA 5TBOA 1P0KA 4FS9A 5DMNA 5CPOA 2VP8A 2QNEA 4GNJA 2V5DA 3NQAA 3TFXA 3BICA 4C6JA 2QCHA 1FH9A 2J7DA 4JPGA 5HA7A 4UUIA 4IUOA 4HOXA 3F7JA 3TJIA 4JQ1A 5HMEA 3A6OA 1UASA 2PDFA 1Q6OA 3BAIA 4NUWA 3ZR4A 2REQB 3T8LA 4YNGA 4GUHA 3WF2A 1DE6A 2YB4A 3TEVA 1K6WA 4DJDC 4WOQA 3ARVA 5JU6A 1VS1A 4V2XA 4ZOEA 2C3ZA 2Q71A 4LNCA 4ECLA 4DWSC 4J9JA 3UJSA 5AOPA 3BSGA 3DFPA 1LROA 5CC3A 2OZ3A 4JTHA 4Q4OA 4XD6A 4XD5A 4P7QA 4H2CA 4C7FA 1GKPA 2X41A 2OLHA 4LBRA 2CLOA 1U33A 3IJQA 2J8TA 1XIBA 2D22A 1LTDA 3WQOA 2X42A 5DY2A 3N18A 1MNSA 3MUCA 2Z7GA 3E0FA 4I90A 2XZ7A 7TIMA 2PZNA 1O94A 4I3GA 4FNQA 3WH5A 4BF7A 1NOFA 3RUBL 3TN3A 1Z44A 1VEMA 3APYA 2E5DA 3B06A 1X7IA 1S1PA 4J3XA 3CV2A 2NSXA 3ECQA 1XC6A 1LOQA 3GNNA 4Q8QA 4H4IA 4D8ZA 1J01A 2BTMA 3AMKA 3KBNA 3BAWA 4UFHA 1EZWA 4IIHA 4JFUA 2PDNA 3LX9A 3WQ4A 3BH4A 3KHJA 4W87A 3W85A 1N2VA 1Y8BA 3L2LA 2DZXA 3G8EA 1VCFA 1T99A 2WM1A 1QPNA 4JFWA 4CD5A 3KP0A 3MSRA 2P50A 3GNDA 4JTEA 4D2JA 1EKOA 2BG5A 4ONVA 2ICSA 4HHHA 2X40A 1TE6A 3H4GA 2MANA 1UR4A 1XWYA 3HBLA 3UGVA 4YCPA 4JHMA 1FY6A 2DW6A 4CNNA 3NL6A 3GE7A 1LLZA 5HWNA 4FF5A 1VR6A 2QDEA 3PF3A 5H6HA 1BXBA 1NQ6A 4NQ1A 3UQNA 3UA3A 1DJXA 3VKPA 3NFUA 4IIEA 2O9OA 1XX1A 1ZRQA 4MY8A 2BVWA 4FNPA 4DVOA 3ABRA 3LCXA 1PZ1A 1FWJC 3PPHA 1AA1B 1FDZA 3QFEA 3VOIA 3NPVA 2OWWA 3S5ZA 4EF9A 1KBKA 1HO1A 1GQLA 3NZ1A 1Q4NX 4I8YA 2BHYA 5C55A 1Z32X 4QE5A 3O06A 3SCQA 3G22A 3WQWA 2YDQA 1ZENA 4WQ6A 3NQFA 4A21A 1X98A 2FDMA 4A2SA 1J10A 3OLGA 1JCMP 4HA4A 1T8XA 5AB3A 3RU6A 3BLDA 1R86A 1TO3A 5C9ZA 1H1ZA 3GXFA 1TPUA 1WAWA 4YYCA 3TTOA 4C6PA 2OB3A 3LXBA 3OEXA 2X7WA 4LVGA 2ZRXA 3DECA 2QCDB 2WPBA 2ZWZA 1PWLA 4PUDA 2FKPA 3A64A 2QF8A 2ZZ6A 2RGMA 2VDIA 3G6MA 4UMAA 3VM0A 1UD6A 1L6GA 1H7NA 3B0YA 3ABOA 4IOTA 1WO2A 5LHFA 3S1XA 3R12A 1J96A 5EFDA 1N8WA 1HX0A 5HK4A 4LBSA 3F5JA 1B3WA 4KCTA 4DWSB 1F8MA 3BLLA 3WJYA 2WNWA 1XFBA 3DI1A 3TYEA 2E4TA 3U2EA 4DJDD 3DG7A 3W7CA 1J0ZA 4FMVA 1B9BA 3WLPA 4W8LA 4E8CA 4DWSD 4F2BA 4AZIA 1XIJA 4KWUA 3WLKX 4RX0A 4BI5A 2EG8A 1PKNA 4G5DA 4KESA 1IIGA 2PDUA 2XM2A 1CDGA 5FJOA 3UXDA 5A8GA 3VD3A 3CAKA 2OZ8A 2GJLA 3W1AA 2PD5A 3IVSA 1J6OA 1YX1A 2RAGA 2EHHA 4PRRA 3NAVA 2CHNA 4JTAA 4R7JA 4Z1BA 2YCIX 3W22A 1Q8JA 3SCWA 3EWUA 4F0RA 4J3TA 3DFTA 4WY0A 3CZ8A 1ZAHA 3W7RA 1KKRA 2E67A 2A6NA 4Q7BA 2E3ZA 4JIPA 2O4QA 3CUZA 2ZKMX 3S1GA 2AAAA 3CL8A 2ZX7A 1TJ2A 5L6UA 5GVJA 3GRIA 1TVLA 5G4EA 2CLIA 1L6FA 1KBBA 1E1CB 1RV8A 5FI8A 4YYFA 2EG6A 4C6OA 1ZS2A 5EMYA 4PMRA 1CTNA 2V38A 1I60A 4JHZA 3BE7A 1C8QA 4PMQA 3CAVA 3UZYA 4LYKA 3WENA 3M47A 4PTNA 1E73M 1G4PA 5LGZA 4US5D 3WJWA 2VEFA 2PDWA 3AMLA 1BVWA 1QNVA 2YZRA 1OF6A 4LS1A 3CL6A 2WHLA 3F4WA 3SECA 3LGGA 1FWBC 1XG3A 1P6BA 3VGDA 5I07A 2C91A 3MMDA 4YL2A 1B9ZA 4HJFA 3RM9A 3T0TA 3MS8A 4N9BA 2IPFA 4UNLA 3GHSA 3Q45A 1W8GA 3SM0A 3EWCA 2VYOA 3C0JA 2V81A 5FESA 4JS3A 3MMUA 3TN5A 4H6QA 3FGCA 4MY1A 4PUUA 2D1ZA 1R7OA 1JI1A 5CBBA 4WUIA 5HOSA 1RLDA 4KEZA 1KRCC 4LS0A 4NVTA 2HNEA 2FB3A 2XU2A 3NCOA 4REQA 3BLFA 5D4YA 2PEVA 1EH9A 2ZUSA 2VWSA 1AL7A 1IT0A 2HMCA 1NDZA 3OZOA 4IPIA 4BWLC 4PYSA 3IIXA 4ORIA 3THUA 4DNMA 4XAYA 3WFZA 2NX1A 2PDXA 3KHDA 3EKGA 1EDQA 1W9BM 5L9FA 4W7UA 4DB7A 4S38A 3QRHA 4F48A 2YA2A 3H12A 2QCFA 1UD5A 3GZAA 3WZ0E 4GVHA 4E4PA 4Z17A 2OEKA 4GYPC 2PDGA 4DRSA 3CIWA 3GAKA 2WXDM 2ATSA 1SZFA 4TR9A 4XIAA 1V0MA 1B4KA 1LP6A 3W73A 1YW1A 2NQLA 1I75A 1PKYA 3MZNA 2W62A 4KS0A 4P8XA 3FV9A 1SFJA 1A5KC 4FOKA 1W1PA 3SO7A 2DIJA 2HXUA 3LCGA 3CU2A 1UP3A 3KLKA 1C9DA 4DXKA 2DJLA 4RPPA 3TX9A 2XJ7A 2WBGA 4RZ6A 3WMSA 3EMQA 2DT1A 4QDPA 1F74A 4MNJA 1TUFA 5D33A 1H3GA 1KM1A 1ISXA 5AZ1A 3NPXA 1XYBA 3U4AA 4G2DA 3BLOA 4LS2A 2I14A 3PZ9A 2CPUA 2AQOA 4PMXA 2VD8A 2J7CA 1FWIC 3CPGA 1DXEA 3WQCA 1CENA 4PH6A 3WLOA 4BK9A 1F2JA 4KWVA 4KMQA 1JCLA 3E74A 5F7UA 4QISA 1PBGA 1P7TB 1KTBA 4YVPA 4JXCA 1RA0A 3KVLA 1DWFM 1BHGA 4HHMA 1R5YA 3FFSA 1DQWA 3PG9A 3QR1A 4PMZA 4PL2A 3EDKA 3RFAA 3ITGA 4PN2A 4W5ZA 1S2VA 5I02A 4FK9A 3C86A 5HWMA 1KCKA 1UUQA 3H2MA 4FX6M 4F0MA 2HSAA 3AIEA 1V77A 3VNYA 3MI2A 1QBBA 2FVKA 2WNQA 1XKJA 3LEPA 2XIMA 4QHRA 3EWZA 3W2LA 2X2GA 1EOKA 4C1KA 5G4HC 3WCZA 1EO7A 2DUZA 3A9IA 3CNYA 5E09A 3TQPA 1UR3M 3W1XA 3EXTA 3FHAA 3H22A 3MB9A 4JTSA 3GFZA 3DOPA 2V2DA 5G5IA 4I7VA 3COTA 1M6JA 3MHGA 2E8ZA 4UTTC 3UPBA 2FQIA 5HNUA 1LQAA 1RQBA 3T0CA 4AYGA 5F4SA 3VFLA 3KDNA 3LM7A 2NX3A 2BHUA 4NAEB 3B0VC 4LV9A 4ZEPA 3SUSA 3VGFA 4NI8A 1IEIA 2A3AA 2QVHA 4PTVA 4Q4QA 4JQAA 1AFSA 2H8ZA 2PDKA 5KEZA 2D24A 3MSGA 3MI3A 2NXIA 2HISA 4FHAA 2ZZ5A 1R7AA 3TYUA 2I17A 3ABQA 1J0KA 3VX1A 1AJZA 3I6RA 4IISA 5ABFA 4BCEA 3QY8A 3OG2A 4S3AA 4UMBA 5J8LA 1DVJA 1XQLA 5I06A 4CQDA 4XQ6A 4YTUA 3OR2A 4A8NA 1LRNA 3EMCA 1XCWA 1RBLA 3H6OA 4NG3A 3VNIA 1RH9A 4ZVJA 3MJMA 2IQTA 2VX6A 3TE9A 5HMFA 4NIRA 1S39A 3FAXA 3HF3A 2C14A 3I3EA 1W1VA 3TA6A 4XZ9A 3WD3A 2ALDA 3AQUA 4MAVA 2J75A 3OZMA 3KVJA 1UP2A 3FS2A 3RG6A 4F8XA 1Y0EA 4E4UA 2FFCA 2NV9A 4X0VA 2CLPA 1D7FA 1FWWA 1TWWA 1BSLA 1H60A 1FUYA 1NDWA 1WOAA 1V0KA 1NH6A 5M3WA 4G7FA 4GI9A 1R8LA 4QRNA 1MSSA 1O4UA 1XPYA 5FF3A 3GU9A 4R9OA 3TH6A 1E9LA 1R9ZA 1TQJA 1V3JA 3R79A 2J4GA 2F38A 2W5FA 4WKFA 1TA3B 3LHVA 1VHNA 2WO5A 1EP3A 4HA3A 4NU7A 1ML1A 4O1FA 2B7PA 2B7OA 4KKXA 4XB3A 4ZFCA 1I0BA 3CPUA 3CZJA 4FSAA 4GBUA 1JUEA 1KFJA 2DZUA 4L80A 4GXPA 4R88A 1RPKA 1LLOA 1JDAA 2Z26A 3OODA 3DBPA 4XTDA 3ZR6A 3QV7A 4MY9A 1V5XA 3BOLA 4IL0A 3FSTA 3I3DA 1DQUA 4GG9A 1SFSA 1Q6FA 3NO3A 4NAFB 2QPUA 1HJSA 1ONWA 4ACZA 3OW1A 4JY9A 3UCQA 3MP3A 3SUUA 5D30A 1KFBA 1OYCA 2ZVRA 2TYSA 5KZMA 5CAKA 4DBEA 1G7VA 2EXOA 4UFJA 4KBXA 2FIQA 2O92A 1P1MA 4PMJA 1CB7B 3IJ6A 1B5TA 4JKKA 2QUTA 2ZA3A 1D8WA 8RUCA 2GDQA 1DOSA 3CXOA 4F2UA 4LBUA 2VTFA 3FY1A 3M0YA 5GNZA 2VZTA 3RX3A 2ZYFA 2CBIA 1ODUA 3F4DA 3CUXA 2DZPA 3W1MA 1QPOA 3VDCA 2D23A 3G0SA 1TV3A 5H8UA 3FEMA 4KIEA 1WE5A 1Y7VA 4B4FA 1EA0A 3V3WA 4TVCA 2E7FA 4O8RA 3G3DA 2D0GA 3HZ3A 3BLEA 1CXHA 4CN6A 3FSUA 4UTUA 2WMIB 3BXWA 4ZENA 2PDPA 5CGTA 4IGMA 3FIGA 3S6OA 2Y1HA 3L9CA 1CEOA 4IMEA 4BFAA 2EF9A 4B3LA 4Z2JA 2PBOA 3NZPA 1WYIA 2QULA 3I6TA 4U3AA 1LRTA 2AGKA 3WELA 3F2BA 3I3BA 1T41A 3TN4A 2QJHA 1EPVA 1K8YA 1UHVA 3WLQA 1JCXA 2J7GA 3W2NA 4R5EA 3GDTA 5FAGA 1UW9A 5HPCA 2I9EA 4QNWA 4B91A 4EP8C 1R30A 1Q5MA 4NZ3A 1XBXA 3EX1A 1JZ2A 5CBIA 4TV5A 3DFYA 1FHDA 3Q67A 2NV1A