3OR1A

Crystal structure of dissimilatory sulfite reductase i (dsri)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
435
structure length
435
Chain Sequence
KHPTPMLDELEKGPWPSFVSDIKQECDNRAKNPKGLDYQIPAECPDDLLGILELSFHEGETHWKHGGIVGVFGYGGGVIGRYCDQPEMFPGVAHFHTVRLAQPAAKYYTAEYLEAICDVWDLRGSGLTNMHGSTGDIVLLGTQTPQLEEIFFEMTHNLNTDLGGSGSNLRTPESCLGISRCEFACYDTQLMCYQLTQDYQDELHRPAFPYKFKFKFDGCPNGCVASMARSDFAVIGTWKDDIKIDQEAVKAYVGGEFKPNAGAHAGRDWGKFDIEAEVVGLCPTGCMTYESGTLSIDNKNCTRCMHCINTMPRALKIGDERGASILVGAKAPVLDGAQMGSLLIPFIAAEEPFDEVKEVIENIWEWWMEEGKNRERLGETMKRVGFQKLLEVTGTKAVPQHVSEPRHNPYIFFKEEEVPGGWSRDISDYRKRHMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure insights into the enzyme catalysis from comparison of three forms of dissimilatory sulfite reductase from Desulfovibrio gigas
rcsb
molecule tags Oxidoreductase
molecule keywords Sulfite reductase alpha
total genus 122
structure length 435
sequence length 435
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01077 NIR_SIR Nitrite and sulphite reductase 4Fe-4S domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3or1A04
3.30.70.2500 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3or1A02
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 3or1A03
1JB0C 1F5BA 2XSJA 4S3DA 3MM6B 1ROFA 2AOPA 1H7WA 5AOPA 1KEKA 1H0HB 2V4JA 1Y4ZB 2VPZB 5BYRA 1WTFA 2GEPA 7FDRA 3B0JA 3MM8A 3NOYA 4GEPA 3VLXA 5E7OB 1K0TA 5CH7B 2PA8D 2XSJB 4Y28C 3OR1A 3EGWB 3VLYA 1F5CA 2FGOA 1IR0A 4G39A 1AOPA 3IR5B 3VKPA 4RKUC 1RGVA 4S3EA 5L8RC 1B0TA 2GMHA 3C8YA 1VJWA 3MMBB 3GYXB 3MM7B 2C3MA 2WSEC 1ZJ9A 5BYQA 4CI0B 4YDDB 3MMCB 1PC5A 6FD1A 4L6V3 1FRKA 2Y0FA 3MM6A 7FD1A 1BWEA 4G38A 3B0GA 2WB1D 3EXYA 1C4CA 1FXDA 3VM1A 1HFEL 4AOPA 3AOPA 1DFDA 2VPXB 3IR6B 2C3PA 1GTHA 3MM9B 3VM0A 2FD2A 4S23A 3OR2B 2VPYB 2O01C 3VKSA 1FTCA 2WSFC 3OR1B 4XK8C 1Y5NB 2VKRA 1AXQA 1FCAA 1D3WA 1FD2A 2C3OA 4OMFG 1FDBA 3VKRA 3OR2A 1SIZA 3EUNA 1JNZB 3MMAB 2WAQD 3VKQA 3B0LA 1Y5IB 2ZVSA 3LW5C 1BQXA 3MMCA 1H98A 1SJ1A 2C42A 2Y0SD 2Z8QA 6GEPA 6FDRA 2V2KA 2FJAB 3MM5B 1JNRB 3MMAA 4HTRA 1KQGB 4OV1A 8GEPA 3PNIA 1C4AA 1FRIA 5GEPA 3GEOA 4ID8A 2PMZD 2FJDB 1FEHA 2AKJA 1BC6A 1R27B 3B0HA 3VKTA 3MM9A 1A6LA 1G6BA 3IR7B 5CHCB 1B0VA 1BD6A 2GMJA 1CLFA 3B0NA 1FERA 1FDNA 4S3FA 4S39A 1DAXA 7GEPA 4S3BA 2FJBB 1GT8A 3HKZD 4S3CA 2V4JB 4S3AA 1PC4A 2FDNA 2PDAA 1BLUA 2WSCC 5BYSA 4DHVA 1FRJA 1DURA 1GTEA 1Y5LB 1F2GA 3VLZA 1FRMA 1ZJ8A 1IQZA 1XERA 3MMBA 4G9PA 1FRXA 3B0MA 3MM7A 3MM5A 1Q16B 1SIWB 2FJEB 1H7XA 4AYBD 4XDDA 1FF2A 1FDDA 1FXRA 1FDAA 1B0PA 2C3YA 2IVFB 5FD1A 1FRLA 1FRHA 2C3UA 2VPWB 4KT0C 1GAOA 4XDCA 3MM8B 1KQFB 1G3OA 4S38A 2UZAA
chains in the Genus database with same CATH superfamily
3NAHA 4ZHRB 3I5CA 5CZVA 3V6DA 1VCTA 2HHHJ 1URNA 1RTZA 1UFKA 3THVA 2FLPA 2ZZNA 1J5OB 4MYTA 2CAJA 3C6UB 3SZ2A 1TQLA 1VGYA 5AE2A 3TANA 3OTDA 1WEYA 4MKBA 3ZNJ1 4FPRA 1Q8LA 2Q43A 4RW6B 1PG5B 1RT6B 3HT0A 4FYYB 1S0MA 3KK1A 4DL3A 4C8NA 1QSLA 3IR5B 3CJ0A 3D7SB 3QGIA 2ZE2B 4HHJA 5KFFA 2BZ2A 3PYDA 4LR7A 4G1QA 3FBFA 5J2NA 2I6WA 3LTOA 3MECB 4RW7B 5HBMA 2HHQA 4JB8B 3TP2A 3HF5A 4GKKF 2XCAA 4LQ9A 2RF2B 2IY5B 1YJTA 1WG4A 5D0GA 4ZVPB 1SPBP 2A1BA 1RLCL 3Q23A 4ED5A 3NG8A 2OJ3A 3JS9A 1C1BA 5DS7A 3WIVA 2L3MA 4G38A 2M9KA 1UWAA 2AX0A 4NX9A 4O4GA 3BKTA 2EI5A 2EPIA 5HLFB 3CC4S 3D4JA 5KFKA 3MI7X 3ADAC 4S38A 1S1UB 5KG0A 3T9NA 4E98A 2G1HA 4A8MP 4J9KA 3VWSA 4PG8A 4B9NA 1FJCA 4G65A 4OHWA 4RO0A 5DO2A 5IT4A 3BPDA 1AUSL 4S23A 2ROEA 3LA0A 1VDHA 2CNOB 1RA6A 4LRDA 4DV6F 2KT2A 3OBIA 4EEYA 4NXNF 4ATNA 4QU6A 5K14B 2BJ3A 4G1QB 5J2NB 3SQOP 2BACA 4MKYA 1FHTA 1NAQA 1NK8A 2XHCA 3S8SA 1Y11A 4Q5VA 2B7CB 2MY8A 1JNZB 5HMYA 2NS1B 2YH1A 2ZHBA 1IJFB 4JI4F 1XBWA 2HVIA 1NMEB 2XSFA 5I42B 1U1RA 2NPIA 1NXIA 2DGQA 3H59A 3UDLA 4HACB 1Q95G 1WKLA 4YP3A 2DY9A 4LREA 4IRCA 3B82A 1AFIA 3JQMA 4PG7A 3SDEA 3R7SB 2E7WA 2KFYA 5B0CA 4HTRA 3SMZA 3H40A 4C8OA 4JI0F 2VUGA 1TL1B 2RH3A 4A8KA 1S9EA 2HSEB 4MK7A 1HW9A 5KFXA 2AYMA 3AXMA 1SJQA 5THWA 4CT8A 4ZCIA 2UU9F 5KFPA 3KG1A 4U7CA 3DI6B 3N01A 1TMMA 1MWQA 4CRJA 4X4QA 1RAJA 4N5SA 4A8SA 3NGUA 4DV0J 2M5YA 4DFKA 1DRZA 3KDOA 4IG0A 3O1LA 3S1TA 3VVTA 2G2ZA 4ZVGA 2AW0A 3KLVA 4W92B 2WSCC 1H2VZ 2VFVA 2ZFHA 5KOWA 2YQ1A 2B8QA 2EKNA 1RSCA 5AT1B 1KP6A 3MMBA 1EARA 2ZM6F 1XNRF 3TOQA 2YNIB 2IAJB 4ZCMA 4P7VA 2J6UA 5KFAA 4IR1A 1UMJA 3ULHA 1NH7A 2DR6A 1YJWS 4KPYA 4HT7A 4ZKAA 1KLNA 4RWXA 2Z4PA 1WI6A 2U1AA 2LEBA 3OLAA 5IT0A 2C3UA 1HI8A 1X4CA 2BEFA 1N34J 2EBEA 2UUTA 1NNDA 3IS9A 3GSIA 4ED1A 2MGZB 2LECA 2DRBA 3V6JA 1PJ6A 3PX6A 3HKWA 1NH8A 1RAAB 4URSA 1Z4UA 3DYAA 5KFLA 4JI6J 4B9VA 2JFDA 3CCJS 1AB8A 4TQSA 1KEKA 1CULA 3DFEA 5A2QY 1IKWA 3SFUA 4AQYJ 1TL4A 2UVWA 1TKXB 4RBVA 4F3MA 1X5PA 2R3VA 2YNGB 4OI3A 2R9LA 3VAJA 5DQHA 1VC6A 2HQIA 3IM9A 1VQYA 1RWMB 2U2FA 5T7LA 2XSJB 4OHYA 4C48A 3R3TA 1XMBA 4X65F 1UA0A 4HHHA 1F3VA 3SSSA 1RU1A 2ADBA 4A8OA 5MAOA 2A3JA 3AHPA 3IMQJ 2KZZA 1P1TA 2MKCA 2QEXS 2HG4A 2XHWA 3BR9A 4U8YA 3HLUA 4PWUA 2ZH3A 1K44A 1JLGB 1T94A 2J9DA 2PT0A 4TXSA 4ZOSA 4ZN3A 3D0HE 4MJKA 1GXTA 5F9NA 2HRYA 3KK2A 4ICLB 2OTJS 1RT1B 1N5QA 3ETOA 2RHSB 1HNXF 3GWCA 4LFAJ 3LWLA 2GQ2A 2HHPA 4ETXA 5GMDA 2QG9B 2MKIA 4RNFA 1OSDA 4ZVRB 1I1GA 4UT4A 1FWLA 4B9TA 3RRKA 3OL6A 4IR9A 4LF9J 2NYHA 4P71A 4ZK7M 2WZ1A 2FIUA 4J91A 3D1HA 1XC9A 4F26A 3I32A 5FJ4A 2F8EX 2LEPA 4KH0B 1U6ZA 4C3LA 2DH9A 4U8VA 3DDNA 3DI6A 4ITSA 2W25A 3BO2A 4LSNA 1ZBTA 2DGSA 5C7PA 3SCLE 3TAPA 3D9BA 4OFZA 3HD1A 1PJ7A 1AYEA 2DNOA 5D0HA 5GADI 3GJRB 4R5PA 1RT7A 2VH7A 3KMSA 3JB9k 2E5GA 2F4VF 1EJ7L 4TY8A 4DSLA 4C3KA 3KOAA 1Q0NA 1AFJA 1TU0B 3PZPA 2UVVA 5HN0A 2DISA 2R7QA 1NHKL 2V34A 4HYKA 3UN2A 4N7TA 1WC4A 1Q86T 5KTQA 1QAYA 2JX2A 3T1HJ 3DLLQ 4H4MB 2R2TA 2CUYA 2RQ4A 1WTBA 3PNIA 4PQUB 4LBHA 1DJ0A 2V4QA 2AGPA 5GEPA 2R42A 2E1CA 4MFBA 1DTQA 4IO1A 3W2WB 1YG0A 4FBUA 1KONA 3B8HA 4I6YA 4J9LA 4QBUA 5I3UB 3CCMS 3UN5A 3MZIA 1RUSA 3LWMA 4KBIA 5HROB 1HNXJ 3HZEA 5IT9U 2P6TA 1HARA 1M1HA 3ILJA 3TA2A 3DOKA 5LMUF 2OPSA 4UW2A 3KNGA 2FLOA 4QR1A 3FMBA 4Z37A 3TA1A 3ENVA 1XMQF 4ELVA 4ELUA 1HNVA 4F3OA 3C2PA 4CYUB 1NKCA 3MMJA 4OZ5A 1VQKS 1JKHB 2XC9A 1URRA 1YLXA 2FYXA 3PM9A 3PXGa 5J2PA 2VBYA 3LP0B 3M1VB 3TYTA 1IM4A 1MWZA 5LSOA 3T5KA 1UZDA 1UFWA 2BVZA 4NXNJ 1B0PA 4X4UA 4CLKA 5DDPC 2XWXA 2XY7A 1M5OC 3GJQB 1NO8A 3FZBA 1DTQB 1W7WA 5GADU 3IG1A 5IC6B 1LEOA 1HR0F 2ZJPQ 1HBMB 4RW8A 3EGVA 2CPYA 2Z2ZA 2BRKA 2DRAA 2FZKB 2HK3A 3W5XA 2CG8A 4WKYA 3GMGA 9RUBA 4X4TA 4LFBF 4ECRA 1HWLA 4S3DA 3H5SA 2Y8WA 2IBKA 4NLTA 3CCQS 1A7GE 2YNHA 4ZS6A 2HMIB 3DU5A 3C16A 4EK2A 3CC2S 1HMVA 4P75A 2A2DA 2YKQA 2Q3PA 3SXLA 2BQRA 4JBCA 4KRWA 4GC7A 3WBZA 2VICA 5D0RA 3W8PA 5GAGI 3N6LA 4CLPA 2WVBA 2KVQE 4H54A 4J7CA 4M5GA 2MQOA 1EZZB 3CSKA 4LFBJ 5BXIA 5D6GA 2IM3A 1FKOA 1V9OA 4CDIA 5CQGA 4PRFA 4NLPA 3F56A 2C2MB 2DNZA 4R8UA 2WRMA 3K89A 4HTIA 2V6AA 4JV0A 2YKMB 2GVZA 2LYVA 5DLGA 1YJNS 3HO1A 3LGMA 1WD6A 2UXCJ 1RT5B 4USHA 3OJUA 3H4BA 1SQGA 3M2RB 4U6PA 2VQFF 5EDWA 4ZJLA 3MOJB 4K50A 2PIIA 2Y1RI 4PXCA 2E1AA 2E9ZA 3LP1B 2QA4G 3ZFVA 4ZVEA 2IM0A 1VQMS 1HFEL 4HH0A 2LQBA 2X51A 1F1BB 2VPXB 3QAEA 1QVFR 4C8LA 4UTGA 4M5HA 1PAEX 3Q8VA 3R5BA 5DZ7A 3WC2A 3Q86A 4JI3J 1FI4A 1UW4A 3VM0A 2HZVA 4L74A 5CAAA 3QFWA 4OYBA 5E0OA 4DSJA 1KN6A 1U45A 4I68A 3JYTB 1HQEA 2ZWPA 1KC8T 1T8EA 1N6QA 3E8OA 3C66A 3GJSB 1WC3A 2Q79A 1B99A 2GO8A 2K06A 1QE1A 4QIGA 1CJVB 4HLBA 4OMFG 1SC6A 2E1MC 4KHPJ 1E6YB 3Q8RB 3TUIC 3OR2A 1UKUA 3CD5A 3EZOA 4EI2A 2BQ3A 1L5UA 4IG0B 3R7BB 3QPIA 2JHEA 3LW5C 2GNKA 4NYOA 1RZMA 2KJVA 1VRUB 2ILYA 3EJMA 3IP0A 2Z8QA 3MEGA 1LWXA 3I9ZA 3RBZA 5LJ3Y 4LIRA 5EWEA 4UZBA 1FVSA 2AV5A 3POTA 3I6PA 3CJKB 2DT9A 2W7PA 2HS0A 2M52A 3T1YJ 1QVGR 1R7IA 3IFEA 2BKOA 4DV7F 4XIUA 4PUOA 1NJXA 2AKWB 2SXLA 5ETVA 5KG7A 3VAMA 1LW2B 1RHUB 4TN2A 1Q5VA 1S4FA 4OV1A 3HSZA 4JV5J 2ZNYA 4YFUA 2Y0BB 4B3TF 1BHNA 5D0EA 2A18A 1JK9B 2GHVC 3D0IE 4U9RA 3T6JA 2HGMA 2HW3A 2AYGA 2AKJA 1UTAA 2KVIA 2B9WA 5B0GA 1XEZA 4DL5A 2Y9HA 2KTQA 1ZM9A 2IRUA 2XMUA 1FERA 1FDNA 2F4FA 2PE8A 2VC0A 3VZIA 5KT5A 4I0WA 4F04B 2LA4A 3GCWP 4ER8A 4DL6A 4R0JA 1P1LA 4F4ZA 4ES2A 3Q22A 1X8DA 1U25A 1KDNA 1JLQB 2E44A 1MU2B 2YKOA 3AJDA 3MCMA 5L1JA 1U1MA 2APOA 1HHSA 1M0SA 4ZA1A 2RU3A 4ES1A 3KK1B 4B3RF 4GKKJ 3D1QA 3I4PA 1KVKA 1VQPS 3IXQA 4WIQA 3HHLC 4WJBA 4K4WA 3HDSA 1SKRA 4K2XA 1OWXA 5U47A 1FRHA 2ZBIA 4NYZA 3EGNA 3TAQA 4DFPA 5M2RA 3LP2A 2JJ4D 5K9FA 1K0VA 2YPZA 2HVEA 3MM8B 4GO7X 1U0HA 4RNMA 1U7LA 4AE5A 3GILA 2DNGA 3DC2A 2HQGA 3AB4B 3QMQA 4WTYA 1KTVA 1YKWA 1N5SA 3SCKE 3BBFA 3F73A 3W8GA 4JV5F 3OVBA 4WBFA 3CNQP 4HR2A 4F4WA 3FEZA 4ZPBA 1SH0A 2RIJA 5JMNA 4HT5A 2ZOGA 4RPFA 5D15A 1TP7A 5HO4A 3HXMA 1JLBB 1S0VA 1CC8A 5E7OB 3O8WA 4FZVA 1IBKJ 2B51A 3HJFA 1FNXH 1N6QB 3EGWB 3K8VA 4ZIVA 4NWBA 2MLYA 4DV1F 4DMZA 5HJYA 3A3OB 1C1CA 1S9GA 1IBCB 1R89A 2MKYA 3Q8UA 4OI2A 3CCZA 5CXTA 1HIYA 3KMQA 1WJ9A 3QT5A 2CJAA 4DEZA 4JI1F 2YTCA 3DRPB 2V69A 3KNAA 3HFKA 5BYQA 4CI0B 3VAHA 2A10A 3NKYA 1FFWB 1BQMB 3NP5A 4YDDB 1ZTWA 4JI5F 1RADB 2IDEA 4IQMA 1RLDA 3G82A 1Y3JA 1GFWB 1KTQA 2G13A 5E33A 5HANA 5KFOA 2IFXA 2ZWOA 3NNCA 1WEZA 3B0GA 1CJUB 3GU0A 2CPDA 4NRUA 1RTIB 2V8GA 3CD7A 1TL5A 1JJCB 3FK4A 4OI4A 3QBCA 2CWXA 3AOPA 2PFDA 3Q0AA 3KUEA 2MXYA 4I7FA 3M32A 3MEEA 5KFRA 3CIMA 4HHUA 2DNYA 2IC3A 4TYAA 3CCUS 2P9CA 3OTCA 1U1QA 3M30B 4OZNA 2HYIB 3W2WA 4MIAA 2KU7A 1S1VA 3AJ1A 2N4CA 1UZHA 3ISND 2GV1A 3D54A 2KRBA 4DR1F 3OUYA 4ZPTR 3W9HA 2ZH5A 5HMWA 1UVMA 1UWBA 2W7OA 2H5JB 5E5NA 4DS4A 2E29A 2BXJA 4ZLJA 3DRRB 3KXDA 1XMOJ 3TWZA 4YHHF 3SQGA 1CS4A 4NL5A 3R1LA 4B17A 4BCAA 1S6PA 6FDRA 3Q8SB 1WORA 3W3SA 2F65A 2HNZB 5E3QA 1NSQA 1LQ9A 1R6YA 5EWFA 2IMOA 3QZ8A 2KN4A 4OYPA 1FVQA 3EWGA 3CD0A 1Z1ZA 1GMVA 2GIFA 3GYGA 2C2DA 1YBUA 4O3RA 2CNLB 4JP8A 1TUGB 3RBXA 3DLHA 1HW8A 2KHDA 2XNRA 1IKYA 1L3SA 2EBGA 4Y00A 1F9FA 3WC0A 4OLOA 1T9XA 5HK4A 3SIPB 3C14A 4ED8A 3UDVA 1T9VA 3EICA 2A0FB 2KRRA 3CDEA 3R6LB 1NKEA 4NLOA 3UR0A 3BREA 2HFNA 3KYLA 3QGHA 5IOLA 4M5LA 1MSWD 4ILLA 2Q1LA 3SFGA 2M8HA 5G0RA 3T3FA 3OHBA 1PC4A 2XLIA 4CTAA 4M5NA 3KJVA 4DUZF 2F9JA 4IG3A 1KHVA 1RWVB 2E5HA 3KDNA 2ACYA 2BUNA 5C24A 1R6VA 1VK8A 4AQYF 1FKOB 4EGLA 1IM6A 1FRMA 2PA3A 2HHTA 2JWNA 2UXDF 2ZNZA 2ASYA 1WOOA 2CNKB 2ZH1A 1YJ7A 4ANCA 3KLEB 2FJEB 1H7XA 2UUAJ 3VAKA 1SJFA 3TZZA 2MKSA 1JIHA 3DLEA 3TVKA 4LBPA 2UP1A 4NRTA 3L95X 5J2QB 3G8QA 2ALZA 1FRLA 2HS3A 4AD6A 4TU9A 4ZP8A 5CA5A 4PG5A 2HMIA 3MD3A 3CWJA 4NLVA 5T41A 3EX7B 2ZUGA 4J9PA 2WVDA 1IBMJ 1NB2A 2BR0A 5D3GA 3NEKA 2H48B 3VGUA 3H4DA 1BQNB 1IR2A 4ICLA 2K1RA 4Q8EA 3MCOA 1RWUA 4YUDA 1H7WA 4OX7A 1U02A 2DNNA 4RR5A 3VR1A 1HQEB 3QRPA 1VIXA 2ZE2A 1IWAA 2DRDA 2M88A 4MK9A 2RSQA 4OYXA 4ZLPA 3GG1A 3QGGA 1FNOA 1M5HA 1O6XA 2BANA 4ZHRA 4V19J 2IC3B 1SH3A 4K2JA 3GV7B 2M3DA 5F8HA 3PW7A 2VZ9A 5DRKA 1FKAF 1NBEB 3THTA 5B7WA 3R5JB 3BO4A 2CKWA 1VQSA 2VD3A 2GMHA 3DRSA 4QCLA 5HVFA 3M9OB 3FBBA 3H7HB 1NSKL 3R5GA 3K5NA 4NLGA 2I1RA 4DF4A 2HBYB 2OMOA 5CYMA 4OYAA 3D6FB 4DCOB 4ZITA 4ECYA 4RUCA 2M8DB 3MTJA 1OS5A 4ED0A 2HQFA 3OTEA 1TV6A 2XULA 1K1QA 3FVYA 3H2UB 1S1TA 2J7UA 5A0YA 2DNMA 3V2UC 3J81U 3V6KA 1NK6A 4B9SA 1LWCA 2ILZA 3FSYA 3IBFB 1LKZA 4QWAA 4WZQA 1SKSA 1I51B 4M1KA 1T7PA 1G7CB 1NDKA 2LQJA 3DRYA 3I31A 4P7TA 1SC3B 2CXEA 2HLTA 1F5AA 2OEKA 3AD9C 3OXGA 4WYWA 5DM7Q 4NLRA 4LQ3A 2EFOA 5A8KA 4RNNA 1SCJB 1QM9A 3UVJA 3GB0A 2VFRA 4C7QA 2WSFC 1YRXA 1C1BB 2H9ZA 1RWWB 3LAKA 5DDQC 3HT3A 2DO4A 5I42A 2D3OR 4C97A 4HTJA 4RW9B 2VA3A 3BS9A 2C2RA 1FCAA 5L38A 3CCES 3CW2C 3EMTA 5F0WA 1PBUA 1IJEB 3PIOQ 4HDGA 3ZZ0A 3T5JA 3CO9A 3I0RB 2MQQA 1R3NA 2H54B 4TVAB 3A8KA 4CO4A 2ZVSA 3T6BA 4N8NA 1FESA 4O3PA 1NK9A 3OL8A 2HWTA 2OPPB 1J5EJ 1CJTB 3TQEA 2GHWA 4GVBB 1KR4A 4NLQA 1Q82T 1NSPA 2MY7A 1YWXA 3ZZPA 2DEJA 4CO3A 2CZVC 3QAUA 5A6WA 4CO1A 2MSTA 2Z30B 4UZCA 4JI6F 5J2QA 1MROA 3OD2A 1QY7A 2NCKL 4DPTA 1BY9A 2RVJA 2GS8A 2KH9A 1N32F 5HQ8A 4QYZJ 2DEIA 2NSBA 5DDOC 1R27B 3VAGA 1CVJA 2KYXA 3GLJA 4C0HA 1BD6A 2DNLA 4IFYB 2R7WA 4S3FA 2LVWA 1DAXA 2W9BA 2FHKA 2CJBA 3A8EA 3TJAA 1JWWA 4LIWA 3IRXA 4DR7F 1X5TA 2YNHB 1TMJA 4L3KA 4ZN1A 3U27A 1YSJA 2AGQA 1OPIA 3CD6S 2QJ3A 2UV8A 5ETSA 1JLBA 1T03B 3PTWA 4WFNQ 2Y8YA 4YR3A 5A6PA 3IWLA 1X4EA 3AOAA 3IWNC 4C4WA 1KWMA 1XR7A 2A6OA 1AT1B 3PACA 3GSDA 1Q16B 4P72A 4AYBD 5IM0B 2VJVA 1KNZA 1O5JA 1V3RA 2GC8A 5JJBA 4KGZB 3P96A 5H9EJ 3RR8A 3D0GE 1DLOB 2W24A 3K0JA 1APSA 2AJ4A 3OW2R 1ZS6A 3W9JA 5SZTA 4Y65A 4DV3F 4WE1A 3W9IA 3PR5B 1WDDA 3QFHA 1UJ4A 3X3UA 2RRAA 1LNQA 2OTLS 1RHMB 1T9WA 4IH7A 1JB0C 1F5BA 2XSJA 2JL9A 3MM6B 1W2IA 2I2YA 2HK2A 4OZ3A 3OT9A 4OYOA 1SKWA 1N5YA 1W26A 1SKUB 2VU5A 1D9DA 3IS9B 3S01A 3W64A 4DX7A 2OPQA 2QYCA 5LSLA 3VLXA 2G2YA 2J5AA 3GJTB 1LWFB 3RW6A 3QJJA 1K0TA 3N79A 3DRPA 1BE4A 1U09A 3PJWA 2B43A 4QZVB 3NGTA 3TZXA 5A8RA 1EIYB 4JI4J 3HD2A 4IKAA 1OY9A 2XYHB 4G39A 3AH6A 3BH6B 3TW0A 2X1BA 3ZNUA 1PBAA 4LF1A 3NCQA 4ZJQA 3TARA 4FPIA 3EXCX 2ZBCA 1CJUA 3D3BJ 3DMJB 2VF3A 2HFUA 3R6GB 1CQMA 2GAHC 4F4XA 1ICEB 2MKHA 2N7YA 1T3NA 1CJKA 2LDYA 2ATCB 4L6V3 4UF4A 2BQUA 1S0NA 3L7UA 4O4RA 2OPRA 4O3SA 2YQ3A 4GVBA 4C8ZA 4B9UA 1SQFA 4ECVA 1PAUB 2XMKA 3BO3A 4ZP9A 4ED6A 3FMWA 1WACA 2YX7A 1JLGA 1T02A 2EWHA 3M6UA 3JSMB 4F4KA 2QE5A 2DD8S 5CABA 4LRCA 5J1EB 2VG7A 1B4SA 4HH1A 1S12A 1Z2ZA 4PABA 2HPUA 2OSQA 2MZTA 3LUYA 1X31C 4NMXA 1A9NB 2Q6BA 4I1TA 2HHUA 3A1YG 4WF9Q 4MH8A 3TEGA 5K20B 1HWJA 1RKIA 2OPSB 4C9DA 2AEFA 4Q43A 4P10A 1UFLA 4V19X 1R8HA 2CQCA 3MMAB 3CJTA 2JZ5A 4OHVA 4LF7F 2E7XA 3B0LA 2LXUA 3HPOA 3K7RA 2CFXA 4C2MA 2LXFA 3KHHA 3K57A 4JI2J 1NJWA 3FCVA 4LSNB 4U7UK 4A47A 3DLEB 1RTHB 4CCHA 1MLAA 1KQKA 4R5PB 5KFBA 2B9YA 4Z2XA 2J0XA 3OXFA 1JNRB 2HRUA 2JOQA 2Y1LB 3GR0A 1YRUA 4P2MA 5EUHA 2NXCA 3BKFA 3W1YC 2C2EA 4OLPA 4YR2A 1C4AA 1RWNB 1JLFB 2RDIA 4A8QA 1N32J 4ILMA 2DXEA 3O44A 4ZVQB 1CSJA 2FVPA 1RT4A 4W90B 3HI9A 4Q8FA 2J9DE 2DTJA 1O51A 1XN9A 2UU9J 2KM8B 2AIRB 4KR0B 4Q0BB 4FXWA 1VMBA 4PWDB 2QSWA 3HZGA 4L75A 3J7ZT 2UVUA 1VQ7S 3TJ8A 4ZIWA 4FS1A 1WOPA 2RU9A 2XGQA 2GCFA 3F41A 3X1LB 4K4ZA 4ALZA 3GP9A 1IKVB 3PYFA 2O67A 1DURA 2D69A 2KL8A 3AXKA 1RBLA 3PFEA 1SJRA 3QGPA 1DBDA 3G8SA 3JTNA 3NL0A 4C8YA 4DQIA 1C0TB 3T5LA 4NLDA 1NPRA 2HHWA 4OJGA 4F2RA 2C2ZB 4JI7F 2HQCA 3QT6A 3T1YF 5D3GB 3KLIA 3Q83A 1KOHA 1VHIA 2FC9A 4JI3F 4KE5A 4RUAA 2RHQB 1S1WA 5G4DA 5D4OA 1FO1A 2DXDA 3B4DA 2YWFA 3PKMA 4I2QA 1VC5A 2RB7A 2BMBA 4DR5F 2QTWA 2DNHA 1WHYA 5KG4A 1HBNB 3FRYA 1ZH5A 3GFHA 3RRGA 2EKYA 3CIZA 5AOPA 1RTIA 1WTFA 3TI0A 4N56A 4ED3A 1IKVA 2MZJA 2OAUA 4I7FB 3RAMA 4Q7AA 1QE1B 2VJUA 3MD1A 3M2UA 3TVZA 3D67A 1D1UA 3CJ8A 1M5KC 4B3TJ 1WF2A 2PA8D 1HA1A 2G1DA 3N6NA 3OTOF 2QC3A 1RAHB 4USMA 3C46A 2FGOA 3DOMB 2EFNA 2ZITA 2XQCA 3M8QB 3E2EA 1JXLA 4S3EA 3DLKB 1R8PA 3DHWC 3QZ7A 1QTMA 1HBUB 2DH8A 2DNRA 4LF5F 1TK8A 3DDKA 1TKZA 3WDOA 1ZJ9A 4YB1P 3NGDA 2GVDB 4LJMA 3VHQA 4NLXA 4DUYF 2VFSA 3G2XA 3K8WA 2OPPA 1IBMF 1HNZF 3V5RA 1VIOA 3M8ZA 2HNZA 3GQCA 2HNYB 4DCJB 3VZHA 3FEXB 3ENAA 3OVSA 3AJ2A 5ETPA 1FXDA 2B9XA 3F44A 2DO0A 1U6BA 4UOHA 2ADCA 2DH7A 3KUGA 4UUWA 3DDIA 3OV7A 4KIAA 2FZCB 4DR2F 3UD3P 5F8IA 1AZSB 1U1OA 4KYZA 1U49A 4CLTA 4LRFA 1NHVA 2FJWA 2DNQA 3JAMU 1FJEB 2W4DA 1K47A 4CLLA 2CZ4A 1RT6A 2OLWA 3P5TL 3CTRA 1QJHA 2EG1A 3LPYA 4LVOP 2IRYA 2DNKA 1YJUA 2P5VA 2V2QA 1LFWA 3EUNA 2UXCF 5FLXU 5CD4A 1Y5IB 1UEVA 5B0DA 3KJVB 4J37A 3BQ1A 1Q5YA 2QMWA 5B09A 5H9EK 4NEZA 2HURA 3R1HA 3C3LA 1T03A 1JLCB 3LPEA 2HNYA 3ISNC 3HFVA 2GMLA 5MLCV 2J9CA 3A4TA 3KLEA 4A46A 2B8PA 2DXFA 2IVMA 4NA3A 3FQKA 4OV6A 3TUPA 3W2VB 3QIDA 2QL5B 2ZBRA 4CO0A 4X64F 3R5AA 2JC0A 5KG1A 3IC1A 3QO9B 3PW4A 2C2KB 4DN9A 3RB0A 2G2OA 5BR8J 4J9VA 3HHLA 5B0FA 3VGVA 3IM8A 4O3NA 3L09A 4LF6F 3RJMB 5H1SV 4EBEA 1RB0A 2PN6A 3CJ3A 4KGKA 4ZPDA 2HRTA 6AT1B 3BBCA 3L7OA 3NCRA 1VBXA 1E6VA 3IR7B 1MU2A 4OYWA 2NPFA 2GJIA 2JNJA 2OPQB 3W62A 1UL3A 5DLFA 3P49B 4O3QA 3FUYA 3PDNA 2XLJA 4DL2A 1Y0HA 2OUGA 4M5DA 4A8FA 3PW0A 1N5YB 1NPPA 3PEHA 3FJ2A 3W61A 3P8BB 2MQPA 1YZ7A 2LXIA 1ZA1B 3TUZC 3QJLA 3KJNB 1S9GB 1NDCA 3B4MA 4RJVA 3TNVA 2RQCA 2E5LJ 1RQ0A 2PD1A 2YVSA 2IHR1 3B6BA 4OX6A 2GIRA 2Z2YB 4R0EA 3S6EA 2VQEJ 4FF2A 1FA0A 1WF0A 3M8QA 3KUHA 1SIWB 1R43A 2HGNA 3NBPB 1V5IB 3SEOA 1YX2A 1EQ0A 1C0UA 2CIMA 1FDDA 2OELA 3Q8YA 1FDAA 4ZCLA 1HD1A 4PQUA 3D66A 4QWCA 1RWPB 5KG2A 2HHHF 3I4HX 1U26A 4AL7A 2J6TA 4DV2J 2GX8A 3DLGB 2LEAA 1GAOA 3NXZA 1RKJA 1R8BA 4V1Ak 3QLHB 2BJEA 2MZQA 2ZDPA 3CMAS 2AX1A 2CJ9A 4J9MA 4PWWA 1F6TA 1LWCB 5F3TA 3CJQA 1NRKA 3DXSX 4WP3A 2Z57B 4MK8A 2AOPA 4F7VA 3GFXA 3D3CJ 1M5VC 4FVMA 2VPZB 2COLA 1S1XA 3TAMA 4DR7J 3MM8A 5IZHA 4CH1A 3PX0A 4FXDA 4WFYA 4F8RA 2IM2A 2J0WA 2R2UA 1AW0A 2MZSA 5CH7B 1VLOA 3DYAB 2B6AB 3UDCA 4X66F 2XMAA 1OJ4A 1TR0A 2BJ7A 1N33F 5H9FJ 1NUEA 4DOZA 5J2PB 2DPIA 4Y34A 1JLQA 3R7NB 4Y2KA 4JUZA 3EDQB 4H4KC 4NLSA 5ETMA 1VJWA 2DKOB 3PEJA 1FFSB 3PRVA 2I5JB 2Z56B 2OEMA 3MM7B 4MYUA 2I9SA 1IXKA 1L3VA 1V3SA 1SL0A 2AHOB 2ROGA 3MPUB 2FHMA 1OIAA 2XZDB 1U2CA 3MMCB 1PO6A 1N36J 3HHDA 1XTZA 1RT3B 4FYXB 4X66J 2BJ8A 1M5SA 4C98A 4F0KA 5CD4H 3V6DB 2JEGA 1BXNA 3EM1A 1X0FA 2WB1D 1YRTA 3EXYA 4DQPA 3PYGA 1M5PC 1B70B 2AJ1A 3M6XA 3H0PA 4Y3CA 3PJ9A 2ZH4A 3RB3A 2CVEA 1GNKA 3G71S 3UD4P 3MM9B 3PO5A 4FF3A 2MB0B 4P52A 1FFGB 1VLYA 3U1NA 2H1YA 1H3DA 3N5FA 4PR6A 1VQ4S 3MFIA 2JLFA 2RE1A 4DV0F 3KJQB 4M5IA 1YJ9S 4LF8F 2DB1A 3B78A 3CB4A 5KT3A 3BN7A 4GO5X 2KJWA 3BYRA 4USIA 3J81Y 3M05A 2VIHA 2FLLA 3RTVA 2H65B 1RTHA 5LJ5Y 4ECXA 2ASJA 2QLBB 3GCXP 1UCNA 1EQMA 4DL7A 1Q8KA 1H2UX 3I5BA 4X4RA 3MMCA 3OTOJ 1SV5B 4B3SJ 1S6QA 2CA9A 4U7UD 2Y0SD 3TX8A 3IN5A 1Q1KA 4YEAA 2W8LA 3J7AN 5KG3A 4J9NA 1PYTA 2MJUA 9ATCB 1ZZFA 3OUYB 1RP5A 3FDSA 3VTIA 2QA2A 3QRQA 1UEKA 4IRKA 2H3EB 1JJ2R 5DETA 5DG7A 5L46A 2AU0A 1UETA 2CQIA 2V2ZA 1HQ2A 4K4YA 1ELOA 4EZ9A 1KVIA 1TL3B 4ZVSB 3PVXA 2W2NP 1NB7A 3HX9A 1HI0P 3NOGA 5KFMA 2LCWA 2L9NA 2R7OA 5JUMA 5L1LA 1BC6A 3VKTA 1F2HA 4ZCKA 1UVIA 3VKSA 3D28A 2NXUA 1S4EA 3K5LA 1NM2A 3H2LA 1RBAA 3I0SB 3M2UB 3TRGA 1U47A 3UCZP 3BBBA 4K59A 2E1RA 1VK3A 1DQ8A 1U6FA 1ZPWX 2QZ8A 3DNCA 1NZ8A 3UNYA 1GTEA 4KFBB 2V9WA 2MKJA 1H72C 3EGZA 4JV1A 5M2PA 1HNWF 3B0MA 4H4MA 3NGKA 3PR4A 3CF5Q 1QAIA 1JXEA 3SDEB 2OO4A 2C22A 1VQ5S 3FQLA 1U8SA 1Y3KA 2KT5A 4JI8F 4NMLA 1Q7LB 4DR3J 3MCNA 5FD1A 1N48A 1TK5A 1R0CB 3LAMA 4WU2A 2DHGA 3GIKA 3THPA 2YX1A 4NE9C 4EUVA 3G6ES 2GQQA 2HVDA 3N6MA 4KGVB 5HMXA 1RYRA 3LP0A 2CYYA 1IR1A 2KO1A 4K5SA 3R27A 1V6HA 2DCLA 4KTQA 4I67A 1FE0A 1X4DA 3UVJB 5BJRA 3MEKA 1TAUA 1S59A 1CEZA 4DV6J 4USVA 2PEBA 4DR4J 1U1LA 3IBWA 3IWXA 3RB4A 2DR8A 3M8YA 2N4DA 3DLBA 3UQSA 4YOEA 2BV3A 4PPZA 1TKZB 1Y00A 3RBEA 2RS8A 4AUKA 4OX9F 2I38A 2RQKA 3MR7A 1T9YA 1N54B 2XMMA 4Y28C 3UN3A 4RU9A 1KSPA 2UXBJ 3H5UA 3HHNB 4WP8A 3VAFA 5D4LA 2AEMA 4EYIB 4CYUA 2YY3A 4OJHA 3BGOP 4LF5J 2BANB 3IGVA 2Y3YA 1SL1A 4B3RJ 4S0MA 2H51B 3MR5A 3C6TB 3JSYA 2D9OA 2M2BA 3AD7C 2ABYA 3W2VA 1RTJB 5DG9A 2R4FA 1SI9A 1X9WA 2B4VA 4KJIA 5CZXA 4R8UB 1C4CA 1S49A 1HHQA 3ILLA 3VM1A 1IKWB 1HL6A 3KLGB 4Y0FA 2CQGA 3EDRB 2CQ2A 3CJRA 4P9SA 2XCPA 2V94A 4ECTA 4RW6A 1S6OA 1RAGB 2F1FA 3I0RA 5ETOA 1TL3A 1JJ4A 3VF0B 1FTCA 2H5EA 3G6YA 2AJFE 5A8WA 4P73A 5E3PA 4GVLA 2ZEJA 2RAQA 2MEWA 2XI3A 3BH7B 2B0GA 3R5CA 5L9XA 3W5YA 3PIPQ 2RDJA 3K5MA 3DN9A 3I0SA 1RTDA 4CH0S 3CGIA 3MHYA 4LSLB 2W9CA 3AAWB 3A3PB 3OQ2A 4K8RA 4DR3F 1H2TZ 3FCWA 1NKBA 1MN9A 3OVAA 1X60A 4NYPA 1YDLA 2V2KA 1N34F 3L7PA 1RT1A 4CT9A 1E6YA 3GIJA 4JI5J 2I8EA 3V81A 3PHTA 4KHRA 3WQPA 3KWMA 1S1UA 4DXLA 4KHPF 1KQGB 4F67A 2MLXA 1ZTTA 1VC0A 2RKIA 2NLWA 2RDDA 4DN0A 2YWGA 5FIIA 2RD5C 2E66A 3UFCX 1HQUB 3GEOA 5SUHA 2F8MA 2QIFA 2HKEA 2QYGA 2PMZD 3HHLD 8ATCB 4PUOB 3B0HA 3CDUA 1G6BA 1IBKF 2YX4A 3TAMB 2ZC3A 2VONA 1LWEB 1CLFA 1RCXB 2W4PA 2V8HA 2YKNB 3A8IA 4HVZA 3WZ0A 4F36A 1RTDB 2ZBQA 3HKZD 2OHDA 3FSIA 1CULB 4YB7A 4FS2A 1FJ7A 3BGLA 1VRUA 1NK0A 1FJGJ 4MAKA 4O0NA 4DR6J 2HZAA 4O23A 2FVRA 5J2MA 1GQEA 2R2RA 5HP1B 2POKA 2AMCB 1S6PB 2CPEA 3DOLA 1C2PA 1IQZA 1XERA 3SSQA 2BX6A 4B02A 4ES3A 4CNZA 2D74B 3V6HA 4JI0J 5KG6A 4D3GA 2VG6B 2LDIA 1TL1A 1YJRA 4NZ6A 1X9SA 4LR8A 3MECA 4RW7A 4ECWA 1KOOA 3DM2B 2HVZA 5T14A 3P6YC 3V4IA 4DBQA 1KQFB 3O2IA 1DQ9A 1L3KA 2K3IA 2NUHA 3UWTA 5DG8A 4J9RA 2YWHA 3NS7B 3C15A 3GZ7A 3AFGA 4F02A 3KFWX 2HHXA 1K8AT 4WU3A 2MMYA 4OZLA 2V8DA 1B64A 4AL6A 4DI6A 3PW2A 1YBAA 4X4OA 2G0CA 1H0HB 4MKAA 3CE8A 4QOTA 4E8UA 2ZOMA 4XTTA 2BOAA 2GQCA 3LANA 3NOYA 4GEPA 2UV8G 2DCUB 2LQ5A 1X5SA 4JOUA 1DY3A 3M9NB 4YMEA 5CYJA 3CMES 3MAAB 4USUA 2GEPA 1U1PA 3VLYA 1T05B 2F3JA 2LQ9A 1OY6A 4DPOA 3IAS9 3M1VA 3JQJA 2K8GA 4FXVA 4K0KF 2N7CA 5L1IA 1B0TA 3C8YA 5EN1A 2HQDA 3E01B 4USKA 1TFWA 4ECQA 2ERRA 2WSEC 4PXDA 2CNNB 5A8RB 4Y2MA 4J9QA 1REVA 2ZOFA 4IDKB 1X4FA 2XYGB 1S6QB 2FZGB 4PYAA 1FD8A 3KHRA 4YS2A 4I2PB 2Y1JA 3RBDA 2PI4A 1WEXA 2XI2A 2H4WB 5I3PA 3KLFB 1UVJA 4JI8J 2ZDOA 1N33J 2G9OA 3RAQA 1N0UA 4DR2J 2N3OA 4PYDA 2LU2A 4DSIA 1FX4A 3IR6B 3L4BC 1GMUA 3BGUA 1YJVA 3SCIE 4YB5A 3TZYA 5LT5A 4KV8B 2GAGC 3D2WA 1HKAA 4LUBA 2GIQA 1Q8BA 5K8MA 1FTRA 2O01C 3HHLB 2CJXB 3BGRA 1RAFB 2DIVA 1YITS 4NCBA 2CPJA 4ZDNA 1H74A 2RUGA 4KH1B 4LRBA 5HAOA 1LWFA 2YXLA 4NCGA 4NZ7A 2AYBA 4LF7J 3DGPA 1VYAA 1JJHA 2D1CA 2C3OA 1TVRB 2MYFA 1H73A 1RWOB 2OGUA 1D09B 4NI2A 3FSXA 3P3DA 4GKJF 4M5DB 1U1NA 3H42A 3KLHB 3MEEB 3WX8A 2YWKA 5CYMB 4JYAF 3UPFA 1MG7A 2AYEA 3G86A 3KKFA 3BKUA 3MPWA 1OPZA 1SVDA 2GJ2A 3N9UC 4NEYA 4AT1B 5M2UA 2XGPA 2WTFA 1H98A 3DOKB 2Y1IA 2RJZA 2HFOA 1TZ0A 2JSXA 4ID5B 2CQ0A 2WHOA 3Q2SC 5A0YB 3VAIA 1LXJA 4C8MA 3GIIA 1N52B 2B4PA 3OFFA 3ZZTA 1XNQJ 3MPYA 2H5IB 2F63A 2IAJA 2OFHX 2VFUA 3IGNA 3JAMY 3KLHA 2EW9A 1NDLA 1KRPA 4WK1A 5CCLA 4DSKA 2EK1A 1U1KA 3PRBA 5RUBA 2OIHA 4B9MA 5KT2A 4NASA 1R8AA 3CDBA 3M32B 3Q8PB 3U02A 1Y7PA 3PW5A 3MPVA 1Q4RA 4WIIA 1TAQA 1S10A 3TA0A 4DZ6A 4QU7A 3DLGA 4CLFA 5AE1A 4G3IA 1T9TA 2PFFB 3GTYX 1ZYQA 4LFAF 2WONA 1NLKL 1SUQA 1JQGA 4OQJA 1N88A 4C0BA 1KFSA 4RLEA 3I96A 2P9EA 1UWBB 2FB0A 2Z58B 2B5JA 4K7QA 2M0GB 2ASLA 4S3BA 3SSRA 3CCLS 4OZ0A 4S3AA 2QL7B 3BEGB 1KBRA 1HLWA 4LF8J 1BLUA 3CCSS 3TZWA 1MWYA 3RU0A 4DF8A 2GGPB 3C16B 1S1WB 1WC6A 2QLJB 5I4MA 2G4BA 4XO0A 1EB0A 2XNQA 3POTB 3CJKA 3T1AA 2UUBF 4PWDA 1EKSA 1J5EF 1ZJ8A 3OSNA 3MM5A 2DHXA 1S57A 5HSPA 1B7FA 4IRDA 2W9AA 5A2QU 1YI2S 4BS2A 5KFIA 3ITHB 1EHWA 1H6KX 3OPKA 4OYIA 2BE7D 2JH3A 2QMXA 3DRXA 3I82A 2CQ3A 4KT0C 4MKVA 2V67A 3U7JA 1C0TA 1B7YB 3US5A 2Z2MA 3KG4A 1D9AA 3A13A 4L73A 1G3OA 4F0MA 5K5MA 3CCVS 4DS5A 1U48A 3NRBA 3T5HA 4I2PA 3DXBA 3H2VE 1IUJA 1VJQA 1RTJA 2DYAA 1IKXB 2CQPA 3C14B 3D1OA 3QNWB 4Q2MA 5C42B 2J7KA 5G0RB 2V4JA 4DV5J 1UPPA 1Y4ZB 3DLKA 4WXOA 2WBRA 4IG3B 4Q2LA 7FDRA 2XO7A 4N41A 2NREA 1HBUA 1SH2A 2K7JA 1I5OB 2WVCA 1WC0A 1N5VA 1WI8A 4LF4J 3IRWP 2XS2A 2R7VA 3MF5A 4FF4A 3IO1A 2RS2A 2E9TA 1LV5A 3O3LA 2AJQA 1RHRB 4U96A 2HEKA 3O5TB 1OMSA 5HI7A 3BGFA 2JEJA 4Y2AA 1NK5A 1X9MA 4FN5A 4DUYJ 5JVGQ 4KQZA 2I0XA 2NXNA 4FP9A 1UPMB 1S5ZA 2WOMB 2FGCA 3NLCA 1XNRJ 2ZHOA 5LOQA 2J8SA 3JQKA 2AWZA 1PKUA 1SV5A 5HVGA 2JLGA 1PC5A 1U0HB 1VOMA 2ZJRQ 3OSPA 3HFZB 5AJ3F 2W9BB 2CQHA 4FF1A 1G1XA 2K1RB 1TK0A 1MNEA 3K17A 2FJXA 2QL9B 3ELHA 3ENQA 3LQVA 3CJ5A 3MM6A 3OFGA 4PXBA 5D78A 7FD1A 3VALA 1I94J 2Y0FA 3F0NA 3AA8A 1X5OA 4EO8A 3HVWA 2VQEF 1S77D 3PO4A 1DARA 4BWMA 5ETQA 5B0BA 4ZPWR 5LXRA 4IFVB 4DDFA 2DGXA 2IMWP 1YIJS 2EC0A 1N0VC 1OSCA 3MDFA 1YBTA 4ANEA 3OR1B 2F8HA 4IQXA 1NDPA 1AXQA 2CPHA 2IM1A 1FNMA 2PMWA 4WPAA 1EETB 2B4UA 1FDBA 8AT1B 4DR5J 3OLBA 2M4MA 2B5JB 2AD9A 1MMDA 1TUWA 4NOHA 1O8BA 2WVFA 4O44B 4EFAC 1SJ4P 3R2DJ 3VKRA 3DMJA 3VKQA 4YDXA 3CDAA 1HHTP 4LF6J 3CDWA 4DV5F 1BMQB 1RT5A 2KHCA 2OKQA 4USWA 3TVYA 4ZMMA 5FDLB 2FJVA 4A48A 4WFAQ 3H25A 1EP4B 2YH0A 2HBQB 1HD0A 4PG4A 2GO9A 2HFVA 3G87A 4CQ1A 2W1BA 3UI3A 4ED7A 4AL5A 3BSOA 5C2GA 4X4VA 1Q81T 1XR6A 2L9DA 2FVSA 1S1TB 2HNDA 4MMOA 4NLYA 4XPEA 3HP6A 2XYPB 3ZTRA 3MXHP 3WHIA 2NSCA 4A8YA 4B3MJ 4ECUA 1YGYA 1CG2A 1VR6A 2PO4A 4CWBA 4ELTA 1V3ZA 4CO2A 4X65J 2E5LF 4IH6A 2FJDB 1ZAXA 3NGRA 3QIPB 2O66A 3QSIA 3ILOA 4DPUA 3HSJA 4NXMF 1Q53A 2LQ8A 1OO0B 2CPIA 5IFMA 1RAEB 3M8RA 1L3TA 2VOOA 1WG5A 5F8NA 1UVLA 3DOLB 4ED4A 2V4RA 1RAIB 1YZ6A 4IUFA 2D9PA 1IVZA 2WW4A 2X7IA 3I56S 2FJBB 2CQ1A 5T7LB 2YPYA 4F25A 2BJ9A 2IYGA 2CJKA 4UOGA 2BA9A 1F0XA 1K9MT 3Q2TC 3EPGA 1MW7A 1QD1A 4B3OB 1O0PA 4X4PA 4KSEB 1KKHA 3G4SS 1Y5LB 5KT7A 2X1FA 1CC7A 1F2GA 1TKDA 5DQGA 2O5DA 2MKKA 1RYSA 2NZ4A 1TKTB 4OX8A 2I5JA 3MM7A 2VDHA 5HMZA 4CM2A 2UXBF 3J7Z5 4O0IA 1EKRA 1FT8A 2KG1A 2OD4A 1PYOB 2ZH6A 4K0KJ 4K4SA 3KK2B 4DR1J 4DFMA 2EC2A 1RT2A 2PC6A 2FY1A 2IBOA 4L76A 1ULRA 4NZ0A 5KFDA 1P9QC 1ZETA 4QPTA 2C28A 4IFYA 2R7UA 1RHJB 2YWWA 1WF1A 3ICLA 3RUBL 3J7YU 1P27B 2JEIA 3GIMA 2R7XA 3UDEA 4D3HA 2R7SA 4K4TA 2QO3A 4QWEA 5HATA 2F9DA 3DCAA 3M2VB 3OHAA 4RX6A 1WNEA 4K4UA 1LK7A 4OI1A 5C24B 3BZQA 3QLHA 2ZKTA 4KO0B 5LMUJ 4JYAJ 2UXDJ 1XJWB 4LT6A 3MPDA 2ZUAA 1QLNA 5IXUA 3OR1A 4QIWD 3VV2B 4IOBA 1F5CA 2BKNA 4QW8A 4DLGA 1T11A 3VKPA 4LF2A 3PRDA 4Z7YA 2W4CA 4Y2CA 1VISA 1KVJA 3CCTA 3D6MB 3FFIA 1L3UA 5KG5A 2XMWA 4GRSA 5DDRC 2IA6A 4LF9F 1SQEA 3ZO7A 3MUTP 1C0UB 4YY3F 3DRRA 2C1EB 1GXUA 1U2FA 3C19A 3K2YA 5KFCA 2HFSA 4WFZA 1K1SA 1D9FA 2DY1A 4FVCA 3HSGA 3R2CJ 5F8JA 1R0BG 1HPZA 3NGSA 2M7SA 2HAIA 1BWEA 2E7VA 3TEHB 4RU2A 1HBOB 4KV8A 3Q24A 1VQOS 2XWYA 2IA0A 1FWPA 2EVZA 3PJXA 1RACB 2XY6A 3RAXA 1IQTA 2QGFB 3CJ4A 3LF0A 2DGWA 4KO0A 1SUQB 4UY8T 1FXLA 2FQQB 2QLFB 4ANDA 4NA1A 3FRZA 2R8JA 2CQBA 2XZWA 3GV5B 2CADA 3VQSA 2NQPA 4XK8C 3U1LA 3M7VA 2IYIA 2K3KA 2RUSA 3RG6A 3JSMA 3AD8C 1D3WA 2B6AA 2CPZA 1FX2A 4TYBA 4F4AA 4I69A 1SIZA 2FVCA 3Q8QB 3MR3A 1EAYC 1WUUA 4FNHA 4A4JA 5KT4A 3DGVA 4EZ6A 5ETKA 2HIYA 3OFEA 3R5DA 4KAIA 3CJSA 2DIUA 3BB5A 1Q79A 3R9LA 1IN0A 2W2MP 5E3AA 2BW2A 3ETMA 4N77A 2NXJA 3UO0A 1S97A 2WONB 5DGBA 1VQ9S 3N4WA 1NEEA 1CJKB 2MZRA 2N3LA 3MMAA 4ZP7A 5ETLA 1NK4A 4BWJA 5EX0A 2AQ4A 1N5TA 3G6XA 3H5XA 2LLZA 2CG4A 3ITHA 3BR8A 4M5MA 4ECZA 3CC7S 3K59A 4CM0A 1RT2B 2XTJP 4B9LA 1AZSA 3V4IB 4ECSA 1J5OA 1GH8A 2YNFB 2ZBPA 3JXOA 4OZ1A 3KG0A 3C15B 4ZLNA 4M95A 4RW8B 2O1PA 4ZLLA 2VHGA 4Z7CA 2GMJA 3BSCA 3CT9A 5E3CA 2R8GA 3PCOB 5IWAF 1B3TA 4JI1J 1IKXA 3BM7A 4CLZA 2XMTA 3HHKA 7AT1B 2IDLA 4PXEA 2MSSA 2PDAA 3D6HB 4LMZA 1WC5A 2X3DA 3K58A 1FRJA 2UUBJ 1RAOA 4QR2A 2NXEA 5F3ZA 2R8IA 2WB4A 4DSEA 3HK2A 1LXNA 4OIXA 4URQU 3VLZA 3SV3A 2R7RA 4J9SA 4DPYA 1FRXA 4AXJA 4CLUA 3D68A 1HBMA 4IH5A 4ZVOB 3WIUA 4J90A 4OYZA 2MQMA 5DZ6A 1VBZA 2BM0A 2C3YA 3NS6A 5HQLA 3W66A 3E01A 2C2OB 2KYZA 3QT7A 5C42A 4EBDA 2V8PA 5DQIA 1WHVA 8RUCA 2LFVA 1Q78A 2HWIA 4XDCA 1DZ5A 2OH2A 4QYZK 4UOFA 3GONA 3HULA 1T3OA 4BC7A 4C8KA 4Q0BA 3KLFA 1Y10A 2RILA 1T0TV 3BF4A 3PG9A 4OYMA 3FZ2A 2JEFA 4NLWA 5KFVA 1D0EA 1GEHA 4QIFA 1RCOB 2MJNA 5GAEI 5IC4B 3B0JA 4NA2A 4TKTA 5A8WB 3LOUA 1MN7A 5AE3A 5C2CA 5F41A 4LSZB 3M8SA 2KB2A 1EETA 4LR9A 1SJ3P 5EGYA 2YKMA 4O44A 1BGXT 3BQ0A 3ZC4A 3M8PA 1IR0A 1AOPA 2WVEA 1VRTA 2P6SA 3C6UA 4QWDA 2FY8A 3DGPB 5L8RC 3TR5A 3BPSP 5JVHQ 3ZTQA 2B9EA 3BDPA 1U2RA 3E3XA 1PYSB 4PZVA 2KKHA 2EG2A 5IQQA 3T41A 1UAWA 2UUWA 4TY8B 2JC1A 5HLFA 4LBIA 3J7A1 4GC6A 5HJXA 2BE9B 3OJSA 2FVQA 2Z2LA 2AP6A 3SQGB 1CS4B 1W25A 1X4HA 3ISZA 4DWIA 1S72S 5FDLA 1HBNA 4DX6A 3MEDA 2XY5A 1GMWD 1SB6A 1CJTA 1FRKA 2QLWA 4ILRA 1YTYA 2JRSA 2B56A 4M94A 4U95A 1FK9A 5C25A 1DFDA 1RBOB 2XM3A 1U24A 2FUG9 3NWRA 5KFGA 1S0OA 2GVDA 2FD2A 1UEUA 1ZAWA 2IJFA 2CPXA 4G6VB 1LWEA 4DUTA 4RNOA 2VL1A 4X64J 3K5OA 1CQNA 2YKNA 4MFBB 4PEOA 2V5HG 3M8PB 3H5YA 2QSFA 2YNFA 1QTNB 2VBZA 3J81j 1WSVA 1R0AB 2KXFA 1J2VA 2GHPA 3DRSB 3UNGC 4F0HA 3IA0A 1LFPA 4KY3A 3RB6A 1RABB 2W2PP 5J2MB 2CJYB 1PGZA 2A2CA 2K7KA 2V8VA 1JX4A 3DU6A 2WCXA 4FYVB 1VQ6S 5J1PA 1BQXA 2HFZA 2YNIA 3AOCA 4PG6A 4PKDB 3VGTA 4WFBQ 1REGX 3M9MB 4UY85 3EVWA 3ZZZA 2MTLA 2BE2B 1AA1B 4DV3J 4OL8A 3KJFB 1GXLA 3QIPA 1SC1B 2HWHA 3MM5B 2CVIA 3AT1B 3O6QA 3AA9A 4LSLA 2W9CB 3OL7A 3VCDA 2X1GA 2CQDA 5F8LA 4K5RA 3T9ZA 1WELA 2MQLA 3H90A 4EU0A 5KOXA 5HL7Q 2QT7A 1JLCA 3SBMA 4B08A 3PX4A 3NCPA 3QRRA 4QR0A 2OP5A 2BJ1A 3EZUA 3G9CA 2VDIA 5GMKa 4B3OA 5HP1A 2JFKA 3S7RA 5CHCB 1B0VA 3B0NA 1N8RT 4TQRA 1VQ8S 1PJ5A 3M8WA 5IT9Y 7GEPA 1F3FA 1GT8A 1UA1A 3MAQA 2V4JB 3MUMP 2VKZG 1Q7YT 3UR3C 5K14A 5KFYA 3CXCR 4R25A 2E5IA 1HMVB 1S48A 3TO8A 4C11B 4DPWA 5LSRA 1LW0A 1PIEA 1J27A 2FLNA 1D8ZA 5KFJA 2IRXA 1JXVA 3LP2B 4U67Q 3LO3A 2V0NA 4N76A 1T95A 2DITA 2QV6A 3I9V9 3M6VA 4G9PA 2OD6A 5K8NA 5DGAA 3MFHA 1G4CA 2KT3A 3FBCA 2BM1A 2OFGX 1FXRA 1MMNA 1R31A 2ROPA 4HACA 1MROB 4W98A 2IVFB 3GE9A 3V4MA 4YHHJ 3QSYB 1IWGA 1JLFA 2DK2A 3ILIA 3G82B 1NZAA 1VHFA 3SYZA 4ED2A 2DR7A 2HVHA 4ERDA 2GVZB 2QFIA 2RNEA 1TV6B 3E51A 4ENOA 3PYEA 2YNGA 3HVAA 2EEYA 2KDOA 3QO9A 4QPXA 4EBCA 2W2OP 4NXMJ 2FC8A 2UUCJ 3NWGA 4HI1A 1HNIB 5IS2A 5KFTA 1RHKB 4FKYA 2DGTA 1N4LA 2YKAA 3BN4A 3DM2A 4QQBA 4QIVA 1C1CB 2NZCA 1FK9B 1ZM3A 1QAXA 1UJ5A 1UW9A 4UQTA 5BYRA 5C25B 4B3SF 4BC9A 2AEJA 2AJ2A 2GZOA 1H38A 3CCWA 3EVOA 4Q45A 4N47A 3ZTSA 2R8HA 4WKRA 3T19A 4X4SA 2DGVA 1S6UA 2QA1A 1BQMA 3LALA 4GMKA 4MTPA 1ZM2A 3UD5A 4AXIA 2AGOA 4X62J 1HYSA 2KZMA 1WOSA 2AZ3A 1RGVA 4RKUC 4ZJOA 3G6VA 1R0AA 2YQ0A 2RQMA 1HPZB 4DV4F 3H98A 1XIQA 3MMBB 4LRAA 3J80Y 1QSYA 2KG0A 3IAM9 2C3MA 1F9EB 1WDTA 2WW8A 5F8GA 4QYRA 4PAAA 2VG6A 2CZ9A 3I87A 1FKPA 5LXYA 2LA6A 2BYCA 4KPCA 1NJIT 3AOBA 2Z0GA 3NY0A 2GW8A 2BE2A 4F2SA 2ZD1B 1QSSA 2UVRA 1PCAA 1HNIA 2EFGA 2MHEA 1BUXA 1P6TA 4P74A 3J7YI 3VQTA 3RYLA 2G0IA 5LMNJ 3IBCB 2RT3A 2FHOB 3UCGA 4YR0A 3QJPA 2HNDB 4QWBA 3RZAA 2C3PA 3B54A 4NI2B 1REVB 1GX6A 1SC4B 2MDAA 3MCSA 4IDKA 4DCPB 1QUPA 2GJFA 3EYZA 4RZRA 3KHLA 2ZZTA 4H4KA 4H4OB 2ZJQQ 1S1XB 1P8GA 1Y5NB 2FTRA 3NS5A 4N8OA 3UE2A 4ID5A 4BLGA 5KFQA 4CTAB 4IO9Q 5HROA 4QIEA 3I55S 1FD2A 2E1PA 1XK8A 2J7WA 2GGPA 3MAAA 2MQNA 4IYQA 5F0UA 3ZTOA 1AROP 1DQAA 2PGCA 4GKJJ 1TTHB 3DHXA 3GR1A 4OJ1A 4P2XA 3JTOA 1JKHA 5IV3A 2YWEA 3MR6A 1KHWA 2ZKUA 3K5PA 1SJ1A 2HBRB 1KLMB 1KS2A 5D4PA 2FPHX 3EVMA 4NCGB 3PV8A 2DBBA 2ZM6J 4KKOB 2JVRA 5HQMA 2FJAB 2HIQA 4P2SA 5AXKA 3CULA 3ZZRA 1LOUA 3IG1B 4DV1J 2PEHA 2E9RX 5I3UA 4ZVFA 3A3NB 3KLGA 1N36F 3PFOA 4J9UE 4RW4B 5DM6Q 1DLOA 2BJDA 4OZJA 1N56A 3JSBA 2IPOB 3OTBA 1FRIA 1X4GA 4RBUA 2ZZMA 1CBKA 2LU1A 2VA2A 5ETNA 2EFQA 4CH7A 3N5BA 3QYYA 5LMNF 1V5VA 2V68A 3MM9A 1A6LA 2B7BB 4WK3A 4DUZJ 2E5JA 4S39A 1KFDA 2XB2D 4M5JA 2EFVA 2XG8A 4BDPA 1JMTA 5IWAJ 4ZVHA 1RWXB 2BBEA 4KGXB 3MGJA 3ET6B 1XWLA 2FDNA 1VBYA 2ZH8A 5GMEA 1JLEB 2CWKA 5ETRA 4DSFA 4DHVA 3NMRA 1OY8A 2BW7A 3R97A 2MPUA 5CYQA 5KFEA 2P8IA 2KM8C 1HWUA 4X62F 1JLAB 2W7AA 3HCXA 4CIOA 1HI1A 4I4BA 3G96A 1XMQJ 1VRTB 5ITHA 4J5OA 3UCUP 1KQSR 1RA7A 4DG1A 5AXLA 1X0PA 3CJ2A 3HJVA 5AXMA 5F9LA 1NJZA 2C2NA 3M2RA 3M6WA 4I6AA 1FE4A 5DJBA 1VBKA 4ZVUB 4ZVTB 1HQUA 5E3RA 2GA7A 2VC1A 3QQCD 3HMJG 3LP1A 2ZH9A 4DJBA 3KK3B 1K73T 5D8HB 4HI2A 2CPFA 3GV8B 4OI0A 1XMOF 1E6VB 1HWIA 1RISA 1RJJA 2FHJD 2OEJA 2OSRA 4CLWA 3LGHA 4WCEQ 4DQSA 3GFZA 3LGNA 5HVHA 4NLUA 4ZPAA 1M90T 4Y2IA 1ROFA 4URGA 4LFCJ 5KAKA 3OL9A 4MIWA 1YHQS 2X1AA 4WP9A 3SI8A 3UW1A 2DVIA 4DL4A 1R8CA 5L1KA 2VV5A 4B3MF 2AF6A 1S7HA 3PKYA 2Q66A 1RK8A 3OXLA 3D6TB 1QUVA 2WOMA 4P2FA 3T1HF 2DR5A 2DGUA 5B0AA 5EX3A 4F3QA 3CMQA 3LH2S 3M30A 3HM9A 4DX8H 4C0OC 1NK7A 4CZCA 1P9YA 4KFBA 4ZP6A 5I3QA 1S7IA 1VI7A 2HLUA 3MWBA 4RW9A 5KFZA 3MEGB 3ONQA 4M8LA 3VVUA 4FKXA 4L3NA 3FC9A 3GYXB 4RL1A 3ZTPA 4L72B 4C3MA 5GAGU 3MURP 1AUDA 1S99A 3J80U 4IOCQ 3KK3A 2MQ8A 4TU8A 2MGZA 3GFYA 4OZ2A 5A8KB 2EK6A 2V63A 1ITPA 1YQHA 3P45B 1GMWA 2OMLA 4USJC 1EX8A 3HVRA 4OX9J 1PILA 4A8WA 2DHAA 1TL7B 2KFZA 2N82B 3MUVP 1MMLA 5HBMB 2KFNA 2DPJA 3PHEA 5KFNA 5D77A 3NAIA 4K4XA 3NNAA 1CJVA 2VASA 4DR4F 1VQLS 4DZDA 3C6TA 3W7BA 3W65A 4W4MA 1IBLF 3OR2B 5E2QA 2DJWA 2LMIA 3W63A 2BKPA 4Y6IA 3MR2A 3DOMA 2D41A 4WFXA 1NCLA 2HS4A 4O4GB 4EMDA 2VKRA 1SXLA 2ZVIA 2V9KA 3NOCA 3MTKA 2QFJA 2R8KA 1KD1T 2J0SD 4YQWA 4DL0C 1LW0B 4ZPVR 4YB6A 1RWKB 3N0VA 1DHMA 4HDHA 4TY9A 3IRXB 1LW2A 4BBYA 2WAQD 4BHQA 3L3CA 3EZ5A 4UQGA 1JLEA 1QDUB 2XZTB 5KFSA 2IJRA 1IBLJ 3G8TA 2C42A 2VOPA 3CEDA 2KI2A 3NMAA 4IOAQ 4C11A 5K8OA 5CYQB 2F40A 1G2EA 1TL7A 2CDQA 3R8YA 3AQPA 4G1PA 3HHEA 1UVNA 5KT6A 4QJVA 4EYHB 2NR0A 3JTPA 2P2CB 4K4VA 2M70A 3KLIB 2XS5A 1WSRA 3Q89A 4ZPCA 2HGLA 3P5BP 4QW9A 2DNPA 3I5AA 4OHXA 3ZXWA 4Q44A 4A8XA 2F5GA 2XMVA 2CDRB 4DX5A 1XR5A 2G0JA 4ID8A 1S76D 3BYPA 2J76E 3MOZA 4I2QB 4M5KA 1A0OB 2EFPA 1FEHA 3BDEA 4USTA 4WE1B 3W5ZA 4DV2F 1NJYA 1BWVA 1ZAVA 4NCAA 2VG5B 3ZZUA 1BQNA 1S79A 2DR9A 2RRNA 5K8PA 4EWTA 4UUXA 5H9FK 4PQAA 1RT7B 1ACMB 5E41A 4LVNP 1RU2A 4MIBA 1NHUA 4RUBA 2W2QP 4PCQA 2HBZB 3D5MA 5D4NA 2CQ4A 4XPCA 5F8MA 2ALYB 1QAJA 3CVKA 4WYLA 4DQQA 2DGOA 2VBWA 2NUUG 1VFJA 2WK4A 3FFIB 4I64A 4WXWA 3RGIA 1T9UA 1ZM4A 2P9GA 3SCJE 4DLEA 1W2BR 2BOPA 2J6SA 1VQNS 1XNQF 2QMUB 4XDDA 4DR6F 1FF2A 2F7VA 4F4YA 1EP4A 2JLEA 3CPWR 1ZZNA 1I94F 2J0QD 2A6MA 5EHHA 1S9EB 2VFTA 2ZD1A 5GAHI 3V81B 2YBVA 1M1KT 2OPRB 3ZZOA 4MT1A 3M2VA 1TUVA 5KFWA 4DU7A 2LP4A 1TKTA 3FGVA 5KFHA 3SV4A 4RWWA 3A12A 1HBOA 3AB2B 3HSDA 2X3GA 2UZAA 2VG5A 1Y9OA 4I6WA 1I3OB 3BSAA 5FLXY 2UUCF 2D3UA 4I56A 1RHQB 2QRRA 3KHGA 3MEDB 2D3O1 2XLKA 2BDPA 4DPXA 2IIHA 2QN6B 3KTQA 2BRLA 3H20A 2MHNA 3QATA 1OYDA 4AFFA 1DTTA 1UJ6A 1NSAA 5A76A 1HYSB 2VODA 3AQOA 3FNNA 4DQRA 2RMLA 4YY3J 1TELA 3BV8A 1UVKA 3EPIA 2VG7B 1FWKA 3P4UB 2ZHAA 2FHJA 4HKQA 4XAKA 2L41A 3AODA 2H4YB 2UUAF 4H4OA 1FKPB 1SBRA 1U8WA 1VS3A 1WG1A 2ZH7A 1I6JA 4KHMA 2EXUA 2VBXA 2JVOA 1OQ6A 2O3DA 1TKXA 3CO0P 2DHHA 2WBMA 3DKDA 3QWUA 2KXNB 1U4BA 2QLXA 3DLJA 5KFUA 1HR0J 1WHXA 4M63A 2HQ3A 4CO5A 5AJ3J 1FEEA 3HVTA 3JSRA 2XBPA 4WWSA 4CP5A 6FD1A 5J1EA 1KLMA 2IJNA 1CPZA 4FYDA 2VB6A 5B0EA 3ZZYA 4YN3B 1X4BA 5L39A 5LL6d 2IVYA 5C5JA 1S9FA 4UOCA 3BQ2A 1DTTB 2PMHA 4PPDA 3GG0A 4DFJA 3CUNA 4AOPA 1YVFA 2V2VA 2DHSA 2QX0A 4RUHA 1ZPVA 1GTHA 1UP1A 3QT8A 5GAEU 4JI2F 4RW4A 4TLQA 4X2BA 2VPYB 2XEXA 3TUJC 3RR7A 2MLZA 2XMJA 2L48A 5L9NA 3VGSA 4O3OA 3FBEA 1T05A 4LF4F 2YKPA 1LK5A 1OYEA 1RDRA 1RT4B 5IV4A 1WKJA 2B3TB 1YK9A 4TNOA 2ZH2A 2CRLA 2J9EA 5IQ6A 1SL2A 1ZA2B 1HNZJ 3MAHA 4KKOA 1D8YA 1RE1B 2BABA 5EWGA 4FNIA 1X4AA 4KC5A 2AZ1A 4WTOB 2KXHA 3PY8A 1F9HA 4X84A 2W01A 5B08A 3HVTB 1JLAA 4X4NA 2ASDA 5J1NA 5ADZA 2HAFA 3A8JA 6GEPA 3M4XA 1RT3A 1TFYA 2HHSA 1NU4A 1ZOTA 4DU8A 1TVRA 1WC1A 4FBTA 4OI6A 3N28A 3BSNA 1HWKA 3NBPA 4G1IA 4CNYA 4E2FB 2B4OA 5CCMA 5IM0A 4KGMA 3RRHA 5GAHU 2W8KA 4WZMA 4FYWB 4HEA9 4LFCF 8GEPA 4F50A 4JV2A 1VRQC 3RW7A 2GFFA 1FJGF 3TX0A 4IFVA 2L9WA 2HZCA 1F60B 2RRBA 3NNHA 3ET6A 3JYTA 4P6QA 4CLSA 2Q6CA 3WX4A 1NPKA 4KB7A 2HHVA 2LKZA 4DV4J 1WHWA 3W60A 3U1MA 1X7VA 3FCHA 2F4VJ 5ETTA 4RNHA 5BR8F 3BGRB 3H8YA 1GK8A 4NPOA 4DV7J 2OI2A 2CJQA 4TLRA 3BJYA 4S3CA 3TJ9A 4C6AA 2XO6A 1S1VB 1RI7A 1WKKA 4OHZA 4JI7J 3ENWA 2XS7A 2K2PA 3GYNA 4OJ3A 4DG1B 5BYSA 1M1GA 4HL9A 2J8AA 5AXNA 2AT1B 5GVQA 2V50A 1U0SA 1HNWJ 2R2SA 1Z2LA 4FDFA 2L08A 2ZC4A 3EE3A 3TQ1A 3GPAA 2R7TA 1GX5A 1OQ3A 2QA4S 2ACMA 1WWHA 2PSZA 2D7SA 3FKBA 3L9ZA 1RXOB 3QWPA 3OFHA 1PSDA 4RBTA 2RKIB 1XQIA 3FEYB 4TU7A 2MZ1A 1HNVB 2VPWB 2ATLA 2AJ0A 3AY0A 5JXSA 4J9OA 2JDJA 5LM7E 4ETZA 3CCRS 4E0DA 4EO6A 1Q8IA 2VQFJ 2RF2A 2PI5A 3GIRA 4CLYA 1IKYB 2NYIA 2D3ZA
chains in the Genus database with same CATH topology
3NAHA 4ZHRB 3I5CA 5CZVA 3V6DA 1URNA 2ZZNA 3THVA 2FLPA 1J5OB 4MYTA 3C6UB 3SZ2A 1TQLA 1VGYA 5AE2A 3TANA 3OTDA 1WEYA 4MKBA 4FPRA 1Q8LA 2Q43A 4RW6B 1RT6B 1S0MA 3KK1A 4DL3A 4C8NA 1QSLA 3IR5B 3CJ0A 3QGIA 2ZE2B 4HHJA 5KFFA 2BZ2A 4G1QA 5J2NA 5HBMA 3MECB 4RW7B 2HHQA 3TP2A 3HF5A 4GKKF 2XCAA 4LQ9A 2RF2B 1YJTA 1WG4A 2A1BA 3Q23A 4ED5A 3NG8A 2OJ3A 1C1BA 5DS7A 4G38A 2L3MA 2M9KA 2AX0A 4NX9A 4O4GA 3CC4S 2EI5A 2EPIA 5HLFB 5KFKA 3MI7X 1S1UB 5KG0A 3T9NA 4E98A 4A8MP 4J9KA 3VWSA 4PG8A 4B9NA 1FJCA 4OHWA 4S23A 5DO2A 5IT4A 2ROEA 1RA6A 4DV6F 2KT2A 3OBIA 4EEYA 4NXNF 4ATNA 4QU6A 5K14B 4G1QB 5J2NB 4MKYA 2BACA 1FHTA 1NAQA 1NK8A 4Q5VA 3S8SA 2B7CB 2MY8A 1JNZB 5HMYA 2NS1B 2YH1A 2ZHBA 1IJFB 4JI4F 1XBWA 2XSFA 5I42B 1U1RA 2NPIA 2DGQA 3H59A 4YP3A 4IRCA 3B82A 1AFIA 4PG7A 3SDEA 2E7WA 2KFYA 5B0CA 4HTRA 3SMZA 3H40A 4C8OA 4JI0F 2VUGA 1TL1B 2RH3A 4A8KA 1S9EA 4MK7A 1HW9A 5KFXA 2AYMA 4ZCIA 1SJQA 5THWA 4CT8A 2UU9F 5KFPA 3KG1A 4U7CA 3DI6B 3N01A 4X4QA 1RAJA 4N5SA 4A8SA 2M5YA 4DFKA 1DRZA 4IG0A 3O1LA 3S1TA 4ZVGA 2AW0A 3KLVA 2WSCC 1H2VZ 2VFVA 2ZFHA 5KOWA 3MMBA 2ZM6F 1XNRF 3TOQA 2YNIB 2IAJB 4ZCMA 4P7VA 2J6UA 5KFAA 4IR1A 1UMJA 3ULHA 1NH7A 1YJWS 4KPYA 4HT7A 4ZKAA 1KLNA 4RWXA 2Z4PA 1WI6A 2U1AA 2LEBA 3OLAA 5IT0A 2C3UA 1HI8A 1X4CA 2EBEA 2UUTA 1NNDA 3IS9A 4ED1A 2MGZB 2LECA 2DRBA 3V6JA 3PX6A 3HKWA 1NH8A 4URSA 1Z4UA 3DYAA 5KFLA 4B9VA 2JFDA 3CCJS 4TQSA 1KEKA 3DFEA 5A2QY 1IKWA 3SFUA 1TL4A 2UVWA 1TKXB 4RBVA 4F3MA 1X5PA 4OI3A 2YNGB 2R9LA 3VAJA 5DQHA 1VC6A 2HQIA 1VQYA 2U2FA 5T7LA 2XSJB 4OHYA 3R3TA 1XMBA 4X65F 1UA0A 3SSSA 2ADBA 4A8OA 5MAOA 2A3JA 3AHPA 2KZZA 1P1TA 2MKCA 2QEXS 2HG4A 2XHWA 3BR9A 2ZH3A 3HLUA 4PWUA 4K0KF 2J9DA 1JLGB 1T94A 2PT0A 4ZOSA 4TXSA 3D0HE 4MJKA 1GXTA 5F9NA 2HRYA 3KK2A 4ICLB 2OTJS 1RT1B 1N5QA 3ETOA 1HNXF 3GWCA 3LWLA 2GQ2A 2HHPA 4ETXA 2MKIA 4RNFA 1OSDA 1I1GA 4IR9A 4B9TA 3RRKA 3OL6A 4ZK7M 2FIUA 5FJ4A 3D1HA 1XC9A 4F26A 3I32A 2F8EX 2LEPA 1U6ZA 4C3LA 2DH9A 3BO2A 3DDNA 3DI6A 4ITSA 2W25A 4LSNA 1ZBTA 2DGSA 3TAPA 3SCLE 4OFZA 2DNOA 5GADI 4R5PA 1RT7A 2VH7A 3KMSA 3JB9k 2E5GA 2F4VF 4TY8A 4DSLA 4C3KA 3KOAA 1AFJA 3PZPA 2UVVA 5HN0A 2DISA 2R7QA 4HYKA 1Q86T 5KTQA 1QAYA 2JX2A 3DLLQ 4H4MB 2R2TA 2RQ4A 1WTBA 3PNIA 4PQUB 1DJ0A 2V4QA 2AGPA 5GEPA 2E1CA 4MFBA 1DTQA 4IO1A 3W2WB 1YG0A 4FBUA 1KONA 3B8HA 4I6YA 4J9LA 4QBUA 5I3UB 3CCMS 3MZIA 3LWMA 4KBIA 5HROB 3HZEA 2P6TA 1HARA 3TA2A 3DOKA 5LMUF 2OPSA 4UW2A 3KNGA 2FLOA 4QR1A 3FMBA 4Z37A 3TA1A 3ENVA 1XMQF 4ELVA 4ELUA 1HNVA 4F3OA 3C2PA 1NKCA 3MMJA 4OZ5A 1VQKS 1JKHB 2XC9A 1URRA 3PM9A 3PXGa 5J2PA 2VBYA 3LP0B 3M1VB 3TYTA 1IM4A 1MWZA 5LSOA 3T5KA 1UFWA 2BVZA 1B0PA 4X4UA 5DDPC 2XWXA 2XY7A 1M5OC 1NO8A 3FZBA 1DTQB 5GADU 3IG1A 1HR0F 2ZJPQ 1HBMB 4RW8A 2DRAA 2CPYA 2BRKA 4LFBF 4WKYA 3GMGA 4X4TA 4ECRA 1HWLA 4S3DA 3H5SA 2IBKA 4NLTA 3CCQS 1A7GE 2YNHA 4ZS6A 2HMIB 3DU5A 3CC2S 1HMVA 2A2DA 2YKQA 2Q3PA 3SXLA 2BQRA 4JBCA 4KRWA 4GC7A 3WBZA 5GAGI 3N6LA 4H54A 2MQOA 3CSKA 5D6GA 2IM3A 1FKOA 1V9OA 4PRFA 5CQGA 4NLPA 3F56A 2DNZA 4R8UA 2WRMA 4HTIA 4JV0A 2YKMB 2LYVA 5DLGA 1YJNS 3HO1A 3LGMA 1WD6A 1RT5B 4USHA 3OJUA 3H4BA 3M2RB 4U6PA 2VQFF 5EDWA 3MOJB 4K50A 2PIIA 2Y1RI 4PXCA 2E1AA 2E9ZA 3LP1B 2QA4G 3ZFVA 4ZVEA 2IM0A 1VQMS 1HFEL 4HH0A 2LQBA 2X51A 3QAEA 2VPXB 1QVFR 4C8LA 3WC2A 3R5BA 3VM0A 1UW4A 5E0OA 1KN6A 1U45A 4I68A 3JYTB 1HQEA 1KC8T 1T8EA 1N6QA 3E8OA 3C66A 2Q79A 2GO8A 1QE1A 4QIGA 4HLBA 4OMFG 1SC6A 2E1MC 1E6YB 3Q8RB 3TUIC 3OR2A 1UKUA 3CD5A 2BQ3A 1L5UA 4IG0B 3QPIA 2JHEA 3LW5C 2GNKA 4NYOA 2KJVA 3MEGA 1VRUB 2ILYA 5B0FA 3WDOA 2Z8QA 2W9BA 3I9ZA 5LJ3Y 4LIRA 1FVSA 2AV5A 3POTA 3I6PA 3CJKB 2DT9A 2W7PA 2HS0A 2M52A 1QVGR 1R7IA 3IFEA 4DV7F 4XIUA 4PUOA 1NJXA 5KG7A 2SXLA 3VAMA 1LW2B 4TN2A 1S4FA 4OV1A 2ZNYA 4YFUA 4B3TF 2A18A 1JK9B 2GHVC 3D0IE 4U9RA 3T6JA 2HGMA 2HW3A 2AYGA 2AKJA 2KVIA 5B0GA 2B9WA 1XEZA 4DL5A 2KTQA 1ZM9A 2IRUA 2XMUA 1FERA 1FDNA 2PE8A 2VC0A 3VZIA 4I0WA 2LA4A 4DL6A 4R0JA 1P1LA 4F4ZA 4ES2A 3Q22A 1X8DA 1U25A 1JLQB 2E44A 1MU2B 2YKOA 5L1JA 1U1MA 2APOA 1HHSA 1M0SA 4ZA1A 2RU3A 4ES1A 3KK1B 4B3RF 3D1QA 3I4PA 1VQPS 3IXQA 3HHLC 4WJBA 4K4WA 3HDSA 1SKRA 4K2XA 1OWXA 5U47A 1FRHA 2ZBIA 4NYZA 3EGNA 3TAQA 4DFPA 5M2RA 3LP2A 2JJ4D 5K9FA 1K0VA 3MM8B 4GO7X 4RNMA 3GILA 1U7LA 4AE5A 2DNGA 3DC2A 4WTYA 3AB4B 3QMQA 3SCKE 1KTVA 1N5SA 3F73A 4JV5F 3OVBA 4F4WA 3FEZA 4ZPBA 1SH0A 2RIJA 5HO4A 4HT5A 2ZOGA 3HXMA 1TP7A 1JLBB 1S0VA 1CC8A 5E7OB 3O8WA 4FZVA 2B51A 3HJFA 1FNXH 1N6QB 3EGWB 3K8VA 4NWBA 4DV1F 4DMZA 1C1CA 1S9GA 1R89A 4OI2A 5CXTA 3CCZA 3KMQA 2CJAA 4DEZA 4JI1F 2YTCA 3DRPB 3KNAA 3HFKA 5BYQA 4CI0B 3VAHA 2A10A 3NKYA 4YDDB 1BQMB 3NP5A 1ZTWA 4JI5F 4IQMA 1Y3JA 1KTQA 2G13A 5E33A 5KFOA 2IFXA 3NNCA 1WEZA 3B0GA 2CPDA 4NRUA 1RTIB 2V8GA 3CD7A 1TL5A 4OI4A 3AOPA 3Q0AA 2MXYA 4I7FA 3M32A 3MEEA 5KFRA 3CIMA 2DNYA 2IC3A 4TYAA 3CCUS 2P9CA 3OTCA 1U1QA 3M30B 4OZNA 2HYIB 3W2WA 4MIAA 2KU7A 1S1VA 3AJ1A 2N4CA 3ISND 2GV1A 3D54A 2KRBA 4DR1F 3OUYA 4ZPTR 2ZH5A 1UVMA 5HMWA 1UWBA 2W7OA 4DS4A 5E5NA 2E29A 2BXJA 3DRRB 4YHHF 3SQGA 4NL5A 3R1LA 4B17A 4BCAA 1S6PA 6FDRA 3Q8SB 3W3SA 5E3QA 2HNZB 1LQ9A 1R6YA 5EWFA 2IMOA 3QZ8A 2KN4A 1FVQA 3CD0A 1Z1ZA 2C2DA 4O3RA 3DLHA 1HW8A 2KHDA 1IKYA 1L3SA 2EBGA 4Y00A 1F9FA 3WC0A 4OLOA 4ED8A 2KRRA 3CDEA 1NKEA 4NLOA 3UR0A 3BREA 2HFNA 3KYLA 3QGHA 1MSWD 4ILLA 2Q1LA 3SFGA 2M8HA 5G0RA 3T3FA 3OHBA 1PC4A 2XLIA 4CTAA 3KJVA 4DUZF 2F9JA 4IG3A 1KHVA 5C24A 2E5HA 2ACYA 2BUNA 1VK8A 4AQYF 1FKOB 4EGLA 1FRMA 2PA3A 2HHTA 2JWNA 2UXDF 2ZNZA 2ASYA 2ZH1A 3KLEB 2FJEB 1H7XA 3VAKA 1SJFA 2MKSA 1JIHA 3DLEA 3TVKA 2UP1A 4NRTA 3L95X 5J2QB 3G8QA 2ALZA 1FRLA 2HS3A 4TU9A 4ZP8A 5CA5A 4PG5A 2HMIA 3MD3A 3CWJA 4NLVA 5T41A 3EX7B 2ZUGA 4J9PA 5D3GA 2BR0A 3H4DA 1BQNB 4ICLA 2K1RA 4Q8EA 1RWUA 4YUDA 1H7WA 4OX7A 2DNNA 3VR1A 1HQEB 1VIXA 2ZE2A 2M88A 4MK9A 2RSQA 4ZLPA 3GG1A 3QGGA 1FNOA 1M5HA 2BANA 4ZHRA 4V19J 2IC3B 1SH3A 3GV7B 2M3DA 5F8HA 3PW7A 2VZ9A 5DRKA 1FKAF 3THTA 5B7WA 3BO4A 2CKWA 1VQSA 2VD3A 2GMHA 3DRSA 4QCLA 3M9OB 3K5NA 4NLGA 2I1RA 4DF4A 5CYMA 2OMOA 4ECYA 2M8DB 4RUCA 3MTJA 1OS5A 4ED0A 3OTEA 1TV6A 2XULA 1K1QA 3FVYA 3H2UB 1S1TA 2J7UA 5A0YA 2DNMA 3V2UC 3V6KA 1NK6A 4WZQA 4B9SA 1LWCA 2ILZA 3FSYA 4QWAA 1LKZA 1SKSA 4M1KA 1T7PA 1G7CB 2LQJA 3DRYA 3I31A 4P7TA 5KT5A 2HLTA 4WYWA 2JLGA 1F5AA 3OXGA 4LQ3A 5DM7Q 4NLRA 2EFOA 5A8KA 4RNNA 1QM9A 3GB0A 2VFRA 4C7QA 2WSFC 1YRXA 1C1BB 2H9ZA 3LAKA 5DDQC 3HT3A 2DO4A 5I42A 2D3OR 4C97A 4HTJA 4RW9B 2VA3A 3BS9A 2C2RA 1FCAA 5L38A 3CCES 5F0WA 1IJEB 3PIOQ 4HDGA 3ZZ0A 3T5JA 3CO9A 3I0RB 2MQQA 1R3NA 4CO4A 2ZVSA 3T6BA 4N8NA 1FESA 4O3PA 1NK9A 3OL8A 2HWTA 2OPPB 2GHWA 4NLQA 1KR4A 1Q82T 3ZZPA 2MY7A 1YWXA 4CO3A 2CZVC 3QAUA 5A6WA 4CO1A 2MSTA 4JI6F 5J2QA 1MROA 1QY7A 1BY9A 2RVJA 2KH9A 1N32F 5HQ8A 4QYZJ 2NSBA 5DDOC 1R27B 3VAGA 2KYXA 4C0HA 1BD6A 2DNLA 4IFYB 2R7WA 4S3FA 2LVWA 1DAXA 1JWWA 2FHKA 2CJBA 3A8EA 4LIWA 3IRXA 4DR7F 1X5TA 2YNHB 2AGQA 3U27A 1YSJA 1OPIA 3CD6S 2UV8A 1JLBA 1T03B 4WFNQ 4YR3A 5A6PA 3IWLA 1X4EA 4C4WA 3IWNC 1XR7A 3PACA 3GSDA 1Q16B 4AYBD 5IM0B 1KNZA 1O5JA 1V3RA 2GC8A 5JJBA 3P96A 5H9EJ 3RR8A 3D0GE 1DLOB 2W24A 3K0JA 1APSA 2AJ4A 3OW2R 5SZTA 4DV3F