3OR1A

Crystal structure of dissimilatory sulfite reductase i (dsri)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
435
structure length
435
Chain Sequence
b'KHPTPMLDELEKGPWPSFVSDIKQECDNRAKNPKGLDYQIPAECPDDLLGILELSFHEGETHWKHGGIVGVFGYGGGVIGRYCDQPEMFPGVAHFHTVRLAQPAAKYYTAEYLEAICDVWDLRGSGLTNMHGSTGDIVLLGTQTPQLEEIFFEMTHNLNTDLGGSGSNLRTPESCLGISRCEFACYDTQLMCYQLTQDYQDELHRPAFPYKFKFKFDGCPNGCVASMARSDFAVIGTWKDDIKIDQEAVKAYVGGEFKPNAGAHAGRDWGKFDIEAEVVGLCPTGCMTYESGTLSIDNKNCTRCMHCINTMPRALKIGDERGASILVGAKAPVLDGAQMGSLLIPFIAAEEPFDEVKEVIENIWEWWMEEGKNRERLGETMKRVGFQKLLEVTGTKAVPQHVSEPRHNPYIFFKEEEVPGGWSRDISDYRKRHMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfite reductase alpha
publication title Structure insights into the enzyme catalysis from comparison of three forms of dissimilatory sulfite reductase from Desulfovibrio gigas
rcsb
molecule tags Oxidoreductase
total genus 122
structure length 435
sequence length 435
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01077 NIR_SIR Nitrite and sulphite reductase 4Fe-4S domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3or1A04
3.30.70.2500 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3or1A02
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 3or1A03
2Y0SD 1GTHA 2GEPA 1BLUA 1JNRB 4S38A 2Z8QA 3B0MA 3MMCB 3MMAA 3EGWB 3MM7A 2C3UA 2ZVSA 3MM5B 1Y5IB 3VLYA 3MM6B 3MMAB 4AOPA 2FJDB 4HTRA 1CLFA 6GEPA 3VKSA 2V4JA 3MM8A 5FD1A 1F2GA 4S23A 4S3DA 3VM0A 3MM7B 2C3PA 1WTFA 1JB0C 1FDNA 1FCAA 1PC5A 1FF2A 2PA8D 4OMFG 3VKQA 3VLXA 2FJBB 1FRLA 4XDDA 2V4JB 1AOPA 1FRMA 3NOYA 1BC6A 1XERA 1FDAA 1FD2A 2VPXB 1DFDA 2PMZD 3IR7B 2FJEB 2FDNA 1BQXA 1B0VA 4AYBD 7FDRA 4GEPA 3MM9A 3B0LA 1D3WA 4YDDB 6FDRA 2C3MA 3EUNA 1H98A 4Y28C 1JNZB 2VPZB 1K0TA 4S3BA 4S3FA 5BYRA 1FXDA 3MM9B 3C8YA 1FERA 4ID8A 3VKTA 1ROFA 1AXQA 1PC4A 1FRKA 3AOPA 1F5BA 3LW5C 3VKRA 1FDDA 3VKPA 1GT8A 1R27B 4G38A 1A6LA 1BD6A 4S3EA 1Y5LB 2WSFC 5E7OB 8GEPA 1B0TA 1IR0A 2WSEC 7GEPA 1KQGB 1FRJA 3OR1A 5CHCB 4G9PA 1FTCA 2C3OA 1B0PA 2AOPA 2C3YA 1H0HB 5CH7B 4S39A 3B0GA 5BYSA 3MMBA 1Y5NB 2C42A 2WAQD 5AOPA 2FD2A 4KT0C 4G39A 4DHVA 1G6BA 3OR1B 4S3AA 1SIZA 1H7XA 7FD1A 1ZJ8A 1FRXA 3IR6B 1F5CA 2XSJA 1HFEL 1C4AA 3VM1A 2WB1D 1FXRA 3IR5B 3B0NA 1FRHA 3MMBB 1FEHA 1VJWA 1BWEA 5BYQA 2UZAA 2PDAA 4OV1A 3OR2B 2Y0FA 3B0JA 1FRIA 2XSJB 5L8RC 2AKJA 3GYXB 6FD1A 1SJ1A 1DURA 1Q16B 2VPWB 2GMJA 3B0HA 2GMHA 1DAXA 1SIWB 4S3CA 4XK8C 1KQFB 5GEPA 4L6V3 2V2KA 2FGOA 1Y4ZB 3GEOA 3MMCA 1KEKA 3HKZD 1C4CA 4CI0B 1ZJ9A 3PNIA 3VLZA 3OR2A 2VPYB 4XDCA 2IVFB 4RKUC 1G3OA 1FDBA 2O01C 1GAOA 3MM5A 1IQZA 1GTEA 2FJAB 3MM6A 2WSCC 1RGVA 2VKRA 3MM8B 3EXYA 1H7WA
chains in the Genus database with same CATH superfamily
2E5LJ 2Y0SD 3TUIC 5D4PA 1M1GA 2MJUA 3KK2A 3MECB 4ZPDA 3TJ9A 2OLWA 3RUBL 5F8GA 3LGHA 3VZHA 4IQXA 3GZ7A 1D0EA 1VFJA 3S8SA 4LBHA 1V6HA 4LF9J 1HI8A 2E5LF 2RHQB 4KC5A 4FYDA 4PYDA 3B82A 5HATA 1NK5A 3CD5A 4H4KA 1OIAA 2MQOA 2YH1A 2RILA 2W9AA 1RT7B 3H25A 3B0GA 4IYQA 4ED5A 2HS0A 2B9WA 1EP4A 3IRXA 2CUYA 3N6MA 3RR8A 4B02A 1QJHA 2EFPA 3MMBB 4C3MA 2R7TA 1X4BA 2UZAA 3P4UB 2ZZTA 2CPYA 1U8SA 3TWZA 1BXNA 2KJVA 1C0TA 4U67Q 3R8YA 2GHWA 2RJZA 5KFSA 3PIPQ 3NBPA 5KFRA 4B9LA 1ICEB 4MMOA 2L9DA 5C5JA 4ELVA 4F2RA 3M8QA 1QSYA 3ZTPA 4JI3J 4JV5J 1AOPA 4O0IA 3DRYA 2CZ9A 3H42A 4QYRA 1P6TA 3QWUA 4U6PA 3BO4A 3JYTA 2IMWP 1VK8A 4CQ1A 3CCES 3LW5C 1U49A 1FKPA 3BPSP 3WIVA 2CQGA 3HZGA 3OTEA 4Y34A 1QVFR 4MFBA 1B0PA 1VQYA 5EWFA 1PCAA 4NLSA 2XS7A 4OHYA 4A8SA 1FXRA 3RBDA 1YHQS 2UUTA 2N82B 4F8RA 2RKIA 5I3QA 3C19A 4CLYA 3OTOJ 5J1PA 1S0NA 3BBBA 1IKVB 2Q1LA 3AD8C 1RJJA 1LXNA 1U1PA 1UWBB 1LFPA 1Q82T 1MU2A 1XK8A 2W4PA 1RA7A 3R2DJ 3HJVA 1YDLA 2M7SA 1LWCB 3CVKA 4Q2MA 1AUSL 2AJ0A 1L3VA 3M9OB 2D1CA 3MPWA 4Y3CA 1S77D 1DJ0A 4DX6A 3V4IB 3UN2A 1IR2A 4K2JA 2JL9A 2U2FA 4DL7A 1O51A 2HK2A 1NK0A 1S4FA 3IWLA 1SC1B 2N7CA 2F3JA 2HBQB 3CNQP 2HG4A 2IMOA 2FJXA 2IM1A 3K8VA 1MROA 3TOQA 3HHEA 2ZHAA 1SH3A 2VOOA 3QIPB 2UUBJ 1R0AA 4YB5A 1F9EB 3QGPA 4DHVA 2L9NA 2CQ3A 4F25A 3IR6B 3KTQA 5J2NA 3EVOA 3Q23A 3RB4A 1NB7A 4IH6A 2OD4A 3PCOB 2E9ZA 2OPQA 3LP0B 4DL6A 2CIMA 1Q16B 3HFVA 5CA5A 4WFNQ 2J6TA 3TZYA 2KJWA 3VGTA 3MF5A 3BS9A 2IVMA 1MMDA 1V9OA 4DQSA 2IJNA 5A8KA 1T3NA 3MMCB 2J6SA 2W7PA 1XMOJ 4CTAB 3HSJA 1VMBA 4B3MJ 2HKEA 4DF4A 5F8LA 2M2BA 4EZ6A 1C1BA 2QLBB 4OYWA 4J5OA 3ZNJ1 2R2RA 3DXSX 1YJTA 3DLBA 2DRDA 2XMMA 2DH7A 4AT1B 4Y28C 4OYAA 5LJ3Y 2XG8A 3ZC4A 2AYEA 2XC9A 3B54A 1XMOF 1R27B 3BZQA 1BQMA 3NNHA 4P74A 2ASYA 3GIIA 3C66A 3UDCA 2DGOA 2FJVA 3CCUS 5GMKa 1RT2A 2IYGA 4I6AA 3CJ2A 4KGVB 3BKUA 3TA0A 3DLGB 1MNEA 1P8GA 1ZZNA 3NMRA 2R7VA 3OT9A 3W62A 1KFDA 4EZ9A 5IQQA 3O1LA 5A76A 2MKCA 3TZXA 5C24B 3J7A1 4N56A 1T3OA 2LCWA 3CEDA 3MMAA 3FCVA 5IM0A 2MB0B 1RT4B 4ZP7A 2I9SA 2ZH6A 1S9EB 1VI7A 3G6YA 3HHLA 3F44A 3DHWC 2YKQA 4ENOA 2QIFA 4KYZA 1KQSR 3KDNA 1N88A 3T5LA 3D3CJ 3H4DA 3NOYA 4PWWA 2PSZA 3DLEA 4GRSA 2GQQA 5LXYA 1DTQB 3NRBA 1J5OA 2B5JB 4O0NA 1NDLA 2WONA 1HWKA 2ZEJA 4Y6IA 3GCXP 1KQGB 3ZTRA 3BQ2A 4OJHA 3T5JA 2KVQE 4BC9A 3MEKA 3OPKA 4FS2A 3ILOA 1MWYA 1XWLA 3B6BA 2EKNA 4C11A 4B17A 2G0IA 2DR9A 3AB2B 4OX6A 4NZ7A 1Q7LB 5E3CA 1VQNS 1VRTB 3PKMA 3QBCA 5GVQA 3JTNA 4IFYB 4GC7A 2VA2A 1G7CB 2GMHA 2AF6A 5T14A 4ECZA 2JVOA 1H72C 3CGIA 1RZMA 3VV2B 4B9TA 3H4BA 1XIQA 2ZFHA 1R8BA 3M2RB 1MWZA 2C3UA 3M6VA 5I42B 2R7QA 4LF5J 2HAIA 2A3JA 4P73A 1RHQB 2ZKTA 3MI7X 2H54B 4PYAA 3QRRA 3GFYA 2VPXB 3EZ5A 1U6FA 1X8DA 4AYBD 2JRSA 5B0BA 4RX6A 2ZC3A 5B0GA 2HW3A 2LP4A 3P6YC 2FHOB 4WF9Q 1NCLA 1PC4A 2JDJA 4UUXA 4J9NA 3UCUP 4CLWA 1NH8A 1K73T 1PAUB 1U0SA 1N5SA 4PEOA 5IT0A 4YB7A 2GO9A 4CT9A 4OX7A 5A8RB 1RE1B 1VIXA 4FKXA 1RKJA 4CO3A 1QSSA 1FFWB 1HBNA 3Q8UA 3RZAA 4UQGA 2DRAA 1KQFB 3K7RA 3EM1A 4BBYA 4WP3A 3TQ1A 1C4CA 1LW2B 2G2YA 2POKA 3T1HJ 1QAJA 3MECA 2BKPA 5A6PA 2MZJA 1GX5A 3D54A 2EK1A 4WFAQ 2N3LA 1KC8T 3OL7A 4C8KA 2W8LA 1FI4A 2BE7D 3FMBA 4WZMA 4DV0J 2CPIA 2PFFB 2E5HA 2I0XA 5HQ8A 3BDPA 2C2KB 1T95A 4DJBA 3T1HF 4WFBQ 3AHPA 3QJPA 2QLWA 2MQ8A 1FRKA 2R7WA 3GP9A 2YBVA 3CDWA 4ZCIA 3PX0A 4G9PA 1B7YB 3HHLC 3MMBA 4EO6A 3AXMA 3UQSA 2J0XA 2GV1A 1C4AA 1QUPA 1VJWA 4ZPAA 1YBTA 3IA0A 4TN2A 3W2VB 3D6HB 1Q0NA 2ROEA 2CJ9A 5DO2A 3CC4S 1OS5A 1HR0F 3IM8A 4TY9A 2HQDA 2HHWA 4DLGA 1GTEA 3RYLA 5KFKA 2QMUB 1RLDA 1UAWA 4L75A 4YR0A 2EFOA 2MLXA 4FS1A 3ILIA 4ES1A 6GEPA 4OLPA 5LSRA 2DR6A 1FDNA 1SV5B 1NO8A 3C16B 2J9CA 3QATA 3OJSA 2CPJA 1FD8A 3I87A 3MPDA 2D3ZA 2W2MP 5HVGA 3V81A 8AT1B 5LOQA 5SZTA 4ZVOB 4NRUA 2NSBA 3DDKA 2ZDOA 4WTOB 2RD5C 3KLEB 1ZPVA 2VBYA 4DCJB 3GIMA 4Q2LA 4LFBJ 2HBZB 2M0GB 1TVRB 3MFIA 1IKVA 1ELOA 3T1YF 3GPAA 2AT1B 2VU5A 2NXNA 4LVNP 2B9XA 4USMA 4C8MA 1LWCA 1S48A 1I3OB 2W4DA 4YB6A 1Q7YT 2ZH1A 4BC7A 4Y0FA 1IKXB 3R3TA 5I3UB 2BKOA 4IH5A 3V4IA 1T8EA 5KFIA 3T9NA 5LM7E 1VQPS 2GJIA 3VLXA 3MURP 2NZCA 1FRLA 1VQOS 2Q6BA 2L48A 2DB1A 2DPJA 2YNGB 4IO1A 1HMVB 5B0AA 3MZIA 3G96A 3DXBA 1ZPWX 2J7UA 3VKTA 2GS8A 4NLOA 1GFWB 3PJXA 2GO8A 2UXCJ 4KE5A 3VGVA 2DHAA 2EBGA 1R6YA 3LP2B 2EG2A 4HL9A 4AFFA 1XN9A 1NZ8A 3KLGB 4F3OA 4N41A 1S7IA 4HDHA 4C3LA 3CD6S 3HD2A 1WI6A 3AAWB 3C3LA 4CO2A 3MMCA 4UOGA 4ED6A 4O4RA 2E1MC 1VK3A 1AW0A 3NG8A 4CTAA 3HHNB 2FVQA 1L3UA 2A1BA 4CP5A 2XM3A 2BM0A 4CLKA 2ZJRQ 2XMJA 1JLBB 3U1MA 2F8MA 3W63A 4NCGB 2CDRB 3MWBA 2CXEA 3UD3P 1NAQA 4NRTA 4LF4J 4H4MB 2BV3A 2A6OA 3LGMA 4B9NA 5J2MA 3FVYA 1KHWA 4LFCJ 1JLGB 2A2CA 4USJC 1SPBP 3CMQA 5EHHA 1UPMB 3PEJA 2UV8G 5DDPC 4GC6A 2DNLA 4IG0B 5KOWA 1U47A 3UCZP 2P6SA 3HSDA 2KRRA 3DLGA 1RTIB 3HHLD 4LFCF 4NLTA 3FUYA 2MSSA 4ZCLA 5C24A 6AT1B 2GMJA 1GX6A 2H1YA 3MPUB 3HKZD 1U1MA 2LECA 1RHMB 2DO0A 5HVHA 4RUBA 3GQCA 1S9EA 3CDUA 2GNKA 3M8PA 4LF6J 3BKFA 1NPRA 2HFSA 2LQ8A 1TP7A 2IIHA 4J9SA 4MKVA 3IBWA 4MK8A 3DNCA 2PC6A 3R5DA 1ZAXA 2FJBB 4U7CA 4C97A 1DTQA 4FDFA 4KH0B 2XI3A 1FJGF 3I32A 3PV8A 3VAFA 3G8SA 4W4MA 4LF6F 1UETA 4EYIB 1FWPA 1WWHA 3ENWA 3EGZA 3UFCX 5M2RA 3ZZZA 2O66A 3BN7A 3T5KA 5HJYA 3OW2R 4S3AA 1FRXA 2EI5A 4K5RA 5FLXY 3LWLA 1RAOA 2DHSA 4ZVRB 2D7SA 2DGWA 3D1QA 5D8HB 2IM3A 4RU9A 4IO9Q 4F0HA 4OIXA 3FBFA 1RWMB 3FC9A 4LSNB 2QLFB 1N52B 3CDAA 3GTYX 4UOHA 2YWHA 1U25A 5KFDA 4NEZA 4R0JA 2J7WA 3PNIA 2OUGA 4LRAA 3M2RA 4MK9A 5I42A 3KG1A 5IT9U 1ZM4A 3C46A 2QMXA 4NMLA 5ETPA 2HMIA 2KFNA 4OYZA 2CADA 3QJJA 1WOOA 3MM5B 2D3O1 2IJFA 2QGFB 3FEXB 2RDIA 3DRPB 4DR7F 1X4HA 4FYWB 1C1CA 2W7AA 1RCOB 5KFPA 2Y1IA 1LXJA 2IAJB 4G38A 4F7VA 1GMVA 3W9IA 4CLFA 4LIWA 5ETOA 1NB2A 2CJYB 3QO9B 4DL4A 4WK1A 3ET6B 5A8RA 4B3TJ 3BGRB 4CYUB 3M8YA 1QY7A 2FLPA 2PMWA 3VAKA 2FUG9 2ASDA 1BUXA 1EARA 2NSCA 1LW2A 2B4OA 2HZCA 4ZDNA 4DG1A 1HNVB 1SUQB 1SJFA 4ZVTB 1HPZA 4RO0A 4YEAA 4Q45A 5LJ5Y 1IKYB 2EFVA 3BH6B 2DGVA 4RWXA 3OTBA 1DTTB 4DR4J 1VJQA 4P10A 4ZVUB 2ZH7A 3IMQJ 3BH7B 2RE1A 3TAPA 3SCLE 1YQHA 4EBEA 2V69A 4JUZA 4DV5J 4NLDA 2JLFA 3DLJA 4AUKA 1FRMA 2AZ3A 1XBWA 4U9RA 4WKRA 4DR6J 1VBYA 4YQWA 4DR4F 2DBBA 2UUAJ 2G4BA 2I5JA 1VGYA 1RQ0A 3O2IA 3BBCA 8GEPA 3CIMA 3UVJB 2DTJA 1PBUA 3D66A 2C3OA 4J37A 1TMMA 3M9MB 2L9WA 3LAMA 1RTJB 4OZ1A 1M1HA 4DV5F 4YHHJ 1WSVA 1W2IA 4K4WA 5GMEA 1OMSA 2NCKL 3KLIA 3W2VA 4G1PA 2OMOA 3K5OA 3KUGA 4OV1A 3DN9A 3ZZOA 3FCWA 5D0EA 2UUAF 2F4FA 5B0FA 4NXNF 2ZHBA 1S5ZA 4O4GB 5A0YB 3OUYB 5A8WB 3RU0A 1K47A 4Y2IA 3VLZA 3H98A 1HNWJ 4B9MA 1IR1A 2BACA 5C42B 3GU0A 2GX8A 2NUUG 3MR7A 4KFBB 2M5YA 3WIUA 1SV5A 1WNEA 3C16A 2FJDB 2XYPB 4HHJA 2DXEA 2LVWA 4LRCA 1S7HA 3HO1A 2MPUA 2JEIA 2BQ3A 2QFIA 4OQJA 4ZVGA 4TU9A 3MD1A 1HNWF 2BANB 4N5SA 2C3MA 4KV8B 2AJ2A 2G1HA 5T7LB 3CCLS 1FESA 3DDNA 1U1OA 4QJVA 1FWKA 3M7VA 4EWTA 1TL7A 3KLEA 1IBLF 2O67A 2BEFA 3NOCA 2NXEA 3UN5A 1U26A 4DR1J 2IC3B 3QLHB 2O1PA 4B3OB 3NAHA 3VF0B 1CQMA 2W1BA 3SXLA 1T05B 4YOEA 1S6QB 5HBMB 4ED8A 2QE5A 4MTPA 4JI5J 1ZOTA 2DR5A 4A8WA 1IKXA 5I3UA 1HHTP 4C9DA 4E8UA 1U1LA 4XPEA 4DL0C 2JLGA 4UTGA 2KT3A 2HFVA 1KLMB 5KT3A 3IG1B 1AZSB 2FLOA 1P9QC 3QT7A 2YNGA 1HMVA 4DLEA 1CVJA 4CLSA 3RG6A 5M2UA 1RSCA 4JI5F 4CIOA 2MLZA 3DDIA 2UXBJ 2K8GA 1VQMS 3S1TA 2W2PP 2VFRA 4KPYA 3WC2A 3T41A 1RAFB 3U27A 1HWIA 1H2TZ 1EETA 3LP2A 2B56A 3QAUA 2CJKA 1Q81T 4HACB 2M8HA 4C8NA 3KLGA 3CCTA 2G2OA 1IKWA 4G1IA 1SXLA 5H1SV 3VHQA 2UXBF 5IV4A 5J1EB 1TV6A 3L95X 1ZETA 3HVTA 3UDEA 4CH7A 1U0HB 2VC1A 2VPWB 4J91A 3X1LB 2R2UA 4ZJOA 4RNFA 1IUJA 4J9UE 1D8ZA 3UPFA 2XZDB 3CMES 2LA6A 1KHVA 1JLBA 1VBZA 1VQSA 2WVBA 4NCGA 1JLFB 3MM6B 3MCNA 4RPFA 5CAAA 4DV1J 3BSNA 2J8AA 4EBCA 3GIJA 4HT5A 1FF2A 5LT5A 3KJVA 2AJQA 1N33F 4NLPA 3ENAA 3CCZA 2J0WA 2OD6A 1I51B 2DHHA 3UR0A 4M95A 2V0NA 2YWFA 2ZD1B 4IG0A 1H73A 5CCMA 3U02A 1UFKA 2RDDA 4MIAA 1RTIA 1QSLA 2OO4A 3OBIA 2XMAA 3MAAB 1BGXT 2RU3A 4QU6A 3AFGA 3B0NA 4O23A 3KK1A 2AX1A 3VQTA 1RU1A 1FRIA 1PJ6A 1X9SA 1DAXA 2HNDB 1FKAF 5KG6A 2AQ4A 1ZJ9A 4DX5A 1KN6A 3EWGA 3QGIA 3NY0A 3TO8A 2XB2D 5KFZA 1F9FA 3CJ5A 1WC5A 3H5YA 4ED7A 1RTDA 4LR7A 3FKBA 3PIOQ 2NYIA 1ZA2B 2GJFA 3GONA 1XTZA 5K14A 4V19J 3U7JA 3W2WB 4OMFG 1F60B 2PMZD 1VHIA 2MYFA 2Y1LB 3M8ZA 4MIBA 1U1RA 1N5TA 5AE3A 4RW9B 3HCXA 4PABA 2NXJA 4UZCA 5IS2A 2XNRA 5HMYA 2EG1A 4UT4A 2BUNA 1SJRA 1IBMJ 4ICLA 2LXUA 2P2CB 2RMLA 1PJ7A 4P75A 4LSNA 3HVWA 3D7SB 1HBUB 4PQUB 3QWPA 1TQLA 5FJ4A 4KTQA 4F2SA 2AKWB 3N01A 3PRBA 4DPWA 1SJ4P 2E9RX 4DN0A 1IBMF 4BHQA 3H5SA 1NEEA 4DV7F 4GVBB 3AJ2A 3MM5A 3QYYA 5KT5A 2J9EA 1JNRB 3HMJG 3W5XA 3B0MA 2GVZA 2V2ZA 2X1BA 3RJMB 1C0UB 2HRYA 2LDYA 3T1AA 4NZ6A 5CZXA 5EGYA 5HJXA 3FFIA 4ZA1A 4I4BA 2K06A 3MM7B 3FBBA 4K0KF 4PAAA 2G2ZA 1X4DA 4NASA 1W25A 3VGSA 1HLWA 4DUZJ 3LP1B 2G9OA 2IAJA 3D5MA 4KBIA 5HQMA 4P52A 3R5AA 3C8YA 3QAEA 2FJWA 2ZOFA 2MJNA 2HPUA 3QIDA 3SZ2A 3QO9A 1S0OA 4KRWA 3ET6A 4KIAA 1DLOB 4CYUA 4LIRA 5EX3A 4LF7J 4C4WA 1DHMA 2QYCA 1IM6A 1KD1T 1G6BA 1B4SA 3W64A 2XULA 4YS2A 3OLAA 4DUZF 3JQMA 4FXVA 2HNYB 1HNVA 3K5NA 1X0FA 1SUQA 4TY8B 5HMZA 2ABYA 3FNNA 1I1GA 1IKYA 4XK8C 3EXCX 1OY6A 2AV5A 1DTTA 3UCGA 4DSEA 1ZM3A 2HZVA 3GFHA 1MN9A 3LO3A 1D1UA 4CZCA 4YB1P 4IRCA 1NK6A 1QE1A 5B09A 2EW9A 1YRXA 4ZS6A 5D78A 5DLFA 1UZHA 3MCSA 1FNXH 1GMWA 2YKMB 3R6LB 1CC7A 2Y8YA 1X9WA 2R9LA 3HD1A 3Q89A 4ZHRB 4QYZK 3I9ZA 4I2QA 2UXDF 4JYAF 1R8CA 3Q8PB 3KLFA 4WE1B 2KFZA 3IBCB 3TZWA 3D1OA 5IZHA 2R7SA 5L9XA 4QWBA 4ZIWA 3RB6A 4ANEA 3FQKA 1RADB 5GAGU 4ZK7M 1RWPB 2HVZA 3ZTSA 4JP8A 2RAQA 2E1CA 5A8WA 1AT1B 4KGXB 3JB9k 4N47A 3E01B 1U2FA 5C42A 3GEOA 1SB6A 3UN3A 2E7XA 3EPGA 4KFBA 1LWEB 2VG5B 4PWUA 4EBDA 2DNMA 2NXCA 4TU8A 1EB0A 3FRYA 2DVIA 1JXLA 2BJ1A 4AXJA 2HFOA 3HFZB 1REVB 3PO5A 4ECQA 2BANA 5KFHA 4KV8A 5T7LA 1K1QA 2DH8A 2XZWA 5EN1A 3TX0A 4OZ2A 4G65A 2DXDA 5RUBA 1HWLA 4HI1A 1RT1B 1CJKA 1K0TA 2IDEA 2JEFA 1EHWA 3W9HA 4RNMA 2ACYA 2IC3A 3QLHA 1OQ6A 4B3OA 4H4OB 3GIRA 1QM9A 5GMDA 1ZS6A 3MDFA 2CVIA 2CJAA 3TI0A 1FE0A 5KFXA 3FSYA 2PD1A 1T05A 1YX2A 5HBMA 1UVJA 1FRHA 1FJCA 2A2DA 3EJMA 4URQU 3UD4P 2PDAA 3ITHB 1XR5A 1NNDA 8ATCB 3B4MA 3MEDA 1Q79A 4L6V3 5B7WA 3IM9A 3C6UA 1PAEX 3ZXWA 3CCJS 3NXZA 4UY8T 1RT5B 3PM9A 2RQCA 1O8BA 1V3SA 2MZRA 3IG1A 2HHHJ 3WX8A 1ZYQA 1UZDA 2BKNA 5M2PA 4RL1A 4C3KA 2KXFA 4KJIA 4CO1A 4WFZA 1Q4RA 1DRZA 2HHSA 5FDLB 1RLCL 4K7QA 1MSWD 3HZEA 3G6XA 4IOAQ 3RAQA 2AJ1A 2KYZA 5K9FA 1ZAWA 3KJFB 2LQJA 4GO5X 2YKNA 1E6YB 1YGYA 4ZVFA 2GQ2A 2HHHF 1BWVA 3MM9B 2LMIA 4UW2A 4EK2A 3JQKA 4HACA 4J9PA 1JLCB 5AJ3J 3JSMA 3KG4A 1IBKJ 5JVGQ 3RBEA 1W26A 4JI2F 1Y7PA 5J1EA 4F0KA 3PHTA 2DYAA 1P1LA 1U0HA 3L7PA 3P96A 2BYCA 2XMWA 2ZJPQ 1KNZA 3GYXB 4F3QA 1FKOB 2U1AA 2VOPA 2WRMA 4NEYA 3KK2B 4PG7A 4A8XA 4WU3A 1D8YA 1IBKF 1JLFA 4WPAA 3MM6A 2C2MB 1UP1A 4CNZA 5DS7A 3ZTOA 1JXEA 1ULRA 2X1AA 5EDWA 1LV5A 2JEGA 4CT8A 2GCFA 1RA6A 3R5BA 4Q8EA 3AODA 1HNZF 3SYZA 3HKWA 3QRPA 4KY3A 2YQ3A 1RI7A 4USVA 1Q86T 1O5JA 1R7IA 2Q6CA 1BD6A 2NREA 3MAAA 2HSEB 3LWMA 2WW4A 1UPPA 3BQ0A 4XIUA 2F9JA 2FLLA 5F9NA 2I6WA 4L74A 2HWTA 2PIIA 1HQ2A 2HNDA 4TU7A 2VKZG 5DDRC 5SUHA 3NWGA 3K59A 2CPZA 3C15A 4ED4A 1T7PA 1HHQA 4AL6A 2IHR1 4KGZB 4CI0B 1OJ4A 2BDPA 5C25B 4LQ9A 3K57A 1IQZA 4S39A 1DQ8A 3ISZA 1Q5VA 2F63A 4EFAC 5DQGA 3DGVA 2MGZB 2XMTA 4CLZA 4F36A 1WKKA 2VBXA 3W2WA 2CDQA 3VLYA 3VR1A 2UV8A 3VKSA 3J7ZT 4OHWA 4AD6A 3D0GE 3I6PA 4Y2AA 3P8BB 3I4HX 4HHHA 2IBKA 3JYTB 4RW9A 1WHYA 1RWNB 4JI7F 3ZZ0A 4EUVA 3G4SS 1RYSA 1PKUA 1RHUB 4QIEA 4LSLB 2D3UA 4YY3J 5EUHA 2MKJA 5L1IA 2HVIA 5LSLA 2R2TA 2BOAA 1B0TA 5HSPA 4DSKA 3I0RA 4OZ3A 4X4UA 5DDQC 2YH0A 3U1LA 2Y3YA 1HBUA 2DR8A 2DNRA 4F50A 2ZBIA 4PQUA 4B9UA 3VM1A 4DPOA 1TMJA 2D3OR 2KB2A 1MU2B 6FD1A 3O8WA 4F0MA 3FMWA 2RH3A 4U7UD 3DLKA 3HHKA 1NZAA 2B51A 2W01A 4DZDA 4KHPJ 1S10A 5EWEA 3MTJA 5AT1B 1GAOA 1C0UA 5LMNJ 2JFKA 4XTTA 4I68A 4CH1A 1EAYC 2PN6A 1R8AA 3MM7A 4IRKA 4DR2J 4DSFA 4WP9A 3A3NB 4CM0A 4JI6F 3J81Y 3LP1A 3BM7A 4ZJLA 1X5TA 2HWHA 3Q83A 3G2XA 3BSOA 5LMNF 4YP3A 3G8QA 4FPIA 5DZ6A 4TVAB 3M05A 2LEBA 4WYLA 1DLOA 1SI9A 4DR2F 3DGPB 1PYTA 3R7NB 4N7TA 4EEYA 3HPOA 4U96A 2HNYA 3W5ZA 4TY8A 4Z37A 2Z2MA 3UE2A 4OJGA 2DCUB 2DNOA 2V68A 1X4CA 1UCNA 4E98A 4E0DA 1TAUA 1U6ZA 1IM4A 4NL5A 2XHCA 3SFGA 5A8KB 3IAS9 2K7KA 3U1NA 5L38A 3BPDA 4OZLA 4ER8A 2CPFA 3A4TA 2QFJA 1WI8A 1NK7A 5BJRA 3BEGB 4ZKAA 4QIFA 1LK7A 3KOAA 2HGLA 4OJ3A 4QW8A 1C1BB 3IN5A 2P9EA 3H0PA 3N9UC 2YKMA 3D2WA 4EGLA 5KFQA 4W90B 4PXBA 5KFJA 1B7FA 5CYQB 4GKJF 4ZHRA 4HKQA 1BQMB 3T3FA 2BJDA 4NXMJ 4ZCMA 4WE1A 2NS1B 4P6QA 2RQ4A 5D0HA 3LF0A 2A10A 4YN3B 3G87A 2AJ4A 4ELTA 3MHYA 3J7AN 4R8UB 2XCAA 5GAEU 4OYOA 3PEHA 1UA1A 2B0GA 3OFHA 1KS2A 4FVMA 2OGUA 1XNQJ 1VLOA 2IY5B 1F3VA 4QR1A 5B0EA 2HVEA 1F0XA 1FFSB 2JVRA 5DG7A 3E01A 1ZM9A 2CPHA 3MD3A 2KN4A 3W61A 1J5EJ 1SIWB 4LQ3A 2MKKA 1VDHA 4F4WA 4M5JA 4Y65A 1G3OA 2YXLA 3DCAA 4WCEQ 2WZ1A 4DQRA 1XNQF 3ZZYA 1REVA 1L3TA 1T9UA 3NCQA 2R42A 3BR8A 5MAOA 4MJKA 2M4MA 2Q66A 3DLEB 1J5EF 5F8HA 1RT1A 1YWXA 2OSQA 3PG9A 1FWLA 3GR0A 3GSIA 1JLQA 1H98A 1T9WA 2KM8C 3BSAA 3QT5A 1VC5A 1HD0A 1V3RA 5E41A 3KLVA 4QWDA 2PA3A 4LF8F 2EK6A 2F1FA 2UUWA 4J7CA 3BJYA 2K1RB 4RWWA 3ITHA 4ZPWR 3PTWA 3PFEA 4ZJQA 2RUGA 3B0JA 4X4TA 2W9CB 1RT5A 1VQKS 5KFYA 3DMJA 4U8YA 1GXTA 1FDBA 1YJWS 4Y2CA 4NYZA 1PILA 4IOBA 2V5HG 4ED1A 4RJVA 5K20B 1RKIA 3NGTA 3S6EA 2DISA 2AZ1A 2J0QD 2IFXA 3MR3A 1FNOA 1X5PA 2UUCJ 1C2PA 3DC2A 4LFAJ 1E6YA 2FHJD 2V6AA 2P9GA 3MM9A 3B0LA 3AH6A 3EUNA 2HEKA 1JLCA 4OYBA 4ECXA 1FERA 4J90A 3VGUA 4OL8A 2OEKA 3DU5A 2LA4A 3M30A 2JJ4D 3SSSA 1U1NA 1T9XA 3R9LA 2UUCF 5IQ6A 2QZ8A 2O5DA 2AD9A 3HFKA 4DPUA 5F0WA 2CQHA 1FKOA 3J7Z5 3SEOA 4ETZA 4ATNA 4HVZA 1WEYA 1Y0HA 2ZKUA 1CG2A 2AKJA 1WDDA 4DU7A 2DR7A 2OI2A 2V2KA 2QC3A 2YX4A 4KB7A 4ANDA 2ZHOA 1GTHA 4FYVB 5LMUF 4IKAA 5JJBA 3GLJA 3FK4A 5KG5A 3ISNC 4X66F 1PSDA 5D77A 1S76D 1IWAA 2ZWPA 1I5OB 1IBCB 4IOCQ 2QO3A 3VVTA 3K5PA 5K8OA 3HM9A 4DBQA 4PKDB 1QUVA 5JMNA 3V6DB 4ZLLA 3RAXA 4QR0A 3ULHA 4X65F 1TL4A 2COLA 1NDCA 2DHXA 3EDQB 2ZBCA 3GJTB 4EI2A 2APOA 2FC8A 1Y11A 2F7VA 3VAGA 2HQGA 5F3TA 3HF5A 2CQ4A 3PRVA 3N5BA 3TARA 4B9SA 1FTCA 4ZVPB 2MLYA 2JWNA 3AB4B 2LXIA 2GHVC 2HHQA 5CCLA 4QWCA 2ZM6J 1QD1A 4RNHA 1YBUA 2M9KA 3CB4A 3H5XA 2WK4A 3UNYA 2ZUAA 5AXMA 1IJFB 1IJEB 1JX4A 5C25A 2FGOA 2KL8A 4PG5A 1TAQA 2E7WA 5A2QU 2MGZA 2OIHA 2GQCA 3BV8A 1URRA 2E66A 3BYPA 2VQEJ 1S1WB 4WYWA 3J7YU 1KDNA 2ZM6F 1N32J 4FBUA 4DL2A 3TUZC 2CNLB 3GE9A 3D9BA 4N76A 3JAMU 4LSLA 2XO7A 3V81B 1JJ2R 4FN5A 2QJ3A 4ZOSA 5BXIA 2XI2A 2L3MA 4YFUA 2HFNA 4ES3A 2YX1A 2DO4A 2VQEF 1GMUA 2XGPA 4HLBA 5I4MA 3BR9A 1N32F 2NPFA 1ZTTA 3HXMA 2CQPA 4HI2A 1TFWA 4Q0BB 1RCXB 1EKSA 2XY6A 2PGCA 1RACB 1DARA 2Q3PA 4RUCA 1FX2A 4ZPCA 1S6UA 1VBKA 1S59A 3EVMA 4X2BA 4LRDA 1NLKL 2MMYA 2B4UA 2MQLA 1K1SA 3A8EA 1WORA 3C14B 2BE9B 4MYUA 4X64J 1YKWA 4M5HA 4DX7A 2HQ3A 1H38A 1T9VA 4AQYJ 3QGHA 2YPYA 1Y5IB 2JSXA 5F8IA 4TXSA 4FP9A 4KH1B 1KVKA 3NS5A 3V2UC 5HAOA 4P7VA 5ETRA 2I1RA 3I5BA 4ED0A 4TLQA 1QTNB 2CVEA 1ZTWA 1RHKB 2FDNA 2ADBA 4X64F 2O3DA 4JOUA 1K44A 3GR1A 4Q7AA 5HVFA 2ZNZA 1PYSB 4IR1A 3L9ZA 3IC1A 3DGPA 3VAMA 4J9KA 4C8ZA 4AQYF 1URNA 3VAHA 2AJFE 3LTOA 3NS7B 1V3ZA 2PO4A 2HBRB 2ATLA 2CNOB 2GC8A 2KZMA 3DOMB 3MEEA 3TP2A 3CJTA 3SBMA 2BRLA 3P3DA 1ZJ8A 2Y9HA 4H4KC 3CPWR 1CPZA 2VODA 3GV8B 1LWFB 3VZIA 5BYQA 2J8SA 2WOMB 4XPCA 3G6VA 2HYIB 2W9BB 3UDLA 1NSAA 1KTVA 2IRXA 2J6UA 4K8RA 2F5GA 1WG5A 5JXSA 2B8PA 4QPTA 3H8YA 2AIRB 2ZZMA 5FIIA 4OLOA 4UUWA 2KI2A 2EFQA 1WHXA 3C2PA 1Z1ZA 5DG8A 5J2MB 2BABA 4GKKF 1RU2A 4ALZA 5CYQA 2UVRA 4S23A 3ISND 4NCAA 4OI3A 3LGNA 2A0FB 2KG0A 5DDOC 1YITS 3EZOA 1IN0A 1B0VA 2OKQA 1S99A 4OHVA 1EIYB 2R7XA 2H5EA 2V67A 3OVAA 1ZAVA 2YY3A 4R8UA 1ROFA 2IRUA 4YR3A 1SKSA 1JLEA 2DGXA 3Q86A 3TVZA 1VQ4S 4DS4A 3W3SA 5KFOA 2M70A 2V9WA 2J7KA 2MY7A 2ROGA 4ZVQB 3GG0A 5KFGA 2F8EX 2KZZA 2VFUA 1XR6A 3I31A 1KEKA 1RBOB 3M8PB 4HEA9 5ETKA 2VPYB 3CWJA 4NWBA 2CQ2A 3EPIA 2MQPA 3PFOA 3KKFA 1M1KT 4I6YA 4DOZA 2FB0A 4HTIA 4ECVA 2QA2A 4XAKA 3KWMA 2QEXS 4C0OC 3DHXA 1CLFA 3IS9B 5KOXA 5HROB 4LR9A 4TLRA 3WZ0A 4OZJA 1PBAA 4UOFA 4IQMA 4GVLA 4J9QA 4OI1A 3DU6A 1DFDA 5MLCV 2DEJA 1TFYA 3QMQA 2DIUA 1TKXB 4PCQA 2MY8A 2N4DA 4M5NA 2V4QA 1SH0A 3I9V9 1GH8A 2MKIA 1VC0A 4JBCA 2IM0A 2K1RA 7GEPA 2OJ3A 3EYZA 3LQVA 2JLEA 1WKJA 1XJWB 2WBMA 2Q79A 2L08A 1HFEL 2W9CA 4QWEA 2H5JB 3DI6A 2W2NP 2RT3A 3I4PA 1HI1A 2QX0A 3Q22A 2HMIB 4YDXA 4ZPTR 1CJVB 4I7FB 3I5AA 2B9EA 4FZVA 1TZ0A 3CCSS 2QYGA 3OL8A 1OPIA 2ZOGA 4Z7CA 2JFDA 1YTYA 4ZPBA 4LF1A 1D9DA 5D3GB 1U09A 4Z2XA 1C1CB 4DQIA 3M32A 2V4JB 3CTRA 2XSFA 3N5FA 4AXIA 1H2UX 3M2UB 5KFWA 3W9JA 2NYHA 1Q8KA 2W8KA 3EICA 3CDBA 3HHDA 4WFYA 5J2PB 3TYTA 2WTFA 3J81U 1X5OA 4DG1B 2VB6A 4IFVB 4NMXA 2EXUA 3GJSB 4UOCA 1HPZB 4RU2A 1UTAA 1ZA1B 4C7QA 4A8OA 4X84A 3JSRA 5ADZA 2OTJS 2CPEA 5L9NA 2FJAB 3EDRB 4RNNA 3GV5B 1WC1A 5H9FJ 2CQDA 3W7BA 3FBCA 3V6DA 2PA8D 1HR0J 3GJRB 3SI8A 2I5JB 4PUOB 2MZ1A 2R8GA 1ZH5A 3PYDA 3P5BP 5ETMA 1P9YA 1YG0A 2VH7A 1FEEA 1UEVA 3MGJA 3OSNA 2RRAA 3AD7C 1FDDA 3VKPA 3HX9A 1SKWA 2M3DA 2BE2B 1WEZA 3KLIB 4USTA 1FRJA 5HO4A 4RW8B 1HQEA 2C2NA 4OZNA 3TJ8A 2KXHA 1SVDA 3AQPA 5HMXA 3FBEA 1F9HA 4H54A 2DHGA 3W66A 2G13A 1RUSA 1B70B 2YNHA 1SQFA 3M6WA 2I8EA 3TEGA 1Y4ZB 2FYXA 3R5GA 4TKTA 3K17A 3TQEA 1S1WA 3KMQA 3ZTQA 4QR2A 5DQHA 4J9LA 3GJQB 2ZUGA 3CIZA 3T1YJ 3P49B 2DKOB 1TL5A 4S3DA 4ZCKA 3UD5A 4AL5A 1FCAA 3CXCR 4R5PA 4A4JA 3D0HE 5H9FK 2HFUA 3IR7B 1RP5A 1TL7B 3WC0A 1X60A 2EPIA 3O44A 1U1KA 3RTVA 2C2EA 5KT4A 1RWWB 3KXDA 4RZRA 4Q0BA 2ZH5A 5F41A 1T9YA 2MHEA 3D4JA 2WVCA 1S79A 4Z7YA 1UW4A 4WK3A 2VV5A 4JI8F 3CCWA 1OQ3A 2DNPA 3ZNUA 1S4EA 5D0RA 3IR5B 3PACA 4ZMMA 2QG9B 1JQGA 1FEHA 2UVVA 1ACMB 1SC6A 3RBZA 4QU7A 1SH2A 3C14A 3ONQA 1SJ1A 5LSOA 3PRDA 4Y2KA 2IBOA 2P5VA 2BJ7A 2RF2A 3BB5A 5KG1A 2QL5B 2AHOB 3KUEA 3IP0A 3MXHP 2YNFB 4A8QA 3EGWB 3OVBA 1XEZA 2CNNB 2VBZA 1S9FA 5CYMA 2KG1A 4DQQA 1F5AA 1R0BG 1HNXF 3SIPB 5F8JA 3KMSA 4HHUA 4N8OA 2PEHA 1K8AT 2ZITA 1YRTA 3SQGB 3B78A 3I96A 1R8PA 4S3FA 1EETB 1OY9A 2RS8A 4DL5A 1LOUA 1WSRA 1RT6B 3Q8RB 3DOMA 1IKWB 1Y5LB 2WSFC 4V1Ak 2BJ3A 2ERRA 1IR0A 2AW0A 1BHNA 2C3YA 2R8KA 1TV6B 4Q5VA 3Q24A 4DZ6A 3HVTB 1LWFA 5HP1B 2WOMA 5C2CA 2W9BA 5THWA 9RUBA 4HT7A 4M5KA 2VFVA 3T6BA 3EX7B 2HRUA 5J2QB 1TKTA 2X51A 1R6VA 3I0SB 2Z2LA 3VTIA 4P72A 2IVFB 5KT6A 1HWJA 2BJ8A 3KG0A 3QQCD 1R3NA 1FJEB 2RQKA 4OYMA 3E3XA 3KJVB 4M5LA 4CO4A 4K2XA 3KFWX 1WG1A 2V8PA 1N34J 2IA0A 3CO0P 2HLUA 4A48A 4K59A 4DUTA 3O6QA 2QA4G 1SBRA 3KDOA 5AXLA 5CD4A 5DETA 2CQ1A 5IWAJ 1N6QB 1BQNB 1YIJS 1R31A 4DEZA 3PKYA 3HVRA 1N5YB 2VQFJ 4MH8A 2CG4A 3BQ1A 3CCMS 5ETSA 4F26A 2V8VA 5DM6Q 3NGUA 1HW9A 3KK1B 2H4YB 1N34F 3D1HA 2VASA 1MG7A 2HVDA 3KYLA 1WC4A 3JTOA 1F1BB 3PW7A 1FJGJ 2HWIA 5IWAF 3PYGA 1YLXA 2ZE2A 5L8RC 4DPTA 1KONA 1Q78A 1E6VA 2VQFF 1NKCA 2VJVA 5L1JA 2QLJB 2DGQA 1RTDB 2MZQA 1Q8BA 4M5MA 1FX4A 5DRKA 2G1DA 1K0VA 2D9PA 2PT0A 1RGVA 3ADAC 5K14B 2R8JA 1FTRA 3IS9A 4QIGA 2V63A 5HROA 5DGBA 1KTQA 3OHBA 3MM8A 4NI2B 1Y3KA 4PPZA 3VM0A 4ZVHA 1VQ6S 1GK8A 1NH7A 2BXJA 1HI0P 2MZTA 1TKXA 1RWUA 4DR5J 2E5GA 1WD6A 3WHIA 4NLYA 1JNZB 4CLUA 4URSA 1QDUB 4ICLB 3LOUA 3LPEA 1X9MA 2HVHA 2DNGA 4D3GA 5IC4B 4X4NA 3F41A 2MZSA 1FT8A 2AX0A 4ECTA 1F6TA 1ITPA 4ZP6A 1WF1A 4DR7J 1KR4A 2YWGA 1RTHB 4DR5F 4IDKA 2XY5A 4P9SA 3UW1A 1CJVA 1Y00A 4I7FA 4NA1A 4PXCA 3F73A 2GVZB 1VCTA 3OR2A 4LF9F 2UVWA 2XMKA 4RLEA 2JX2A 3FFIB 2D9OA 1KOHA 3S7RA 5KFMA 4RUAA 2J9DA 5D3GA 1VYAA 3MR6A 2Z58B 1HKAA 3PVXA 3K5LA 1WC6A 2ZC4A 1BY9A 3PY8A 2V4JA 1VRUB 2VUGA 2KHCA 3W60A 4ES2A 4OHZA 5H9EJ 1KRPA 3M2UA 2W24A 1W2BR 4F4ZA 1KVJA 4EU0A 2ZH9A 1T02A 4OI6A 2WHOA 2CAJA 4WJBA 2UVUA 4RUHA 2H65B 5J2PA 1EZZB 1JKHB 2XZTB 4FNHA 1AFJA 4DUYJ 2B6AB 1S1VB 1ZBTA 1TKDA 4IFVA 1NKEA 4KT0C 2BJ9A 2WB1D 3GSDA 2D69A 1T94A 1UVMA 4OYIA 1LKZA 4CM2A 4JI3F 4I2PB 3T5HA 5G0RA 5KG7A 4NE9C 4JV5F 3ETOA 5IT9Y 2R7OA 4DUYF 2V8DA 1S97A 4DWIA 3ELHA 1QE1B 3TEHB 1ZZFA 2HRTA 1CC8A 4LR8A 1R43A 3MEGB 1RAGB 1WDTA 3AQOA 5IFMA 4RR5A 1WJ9A 4DMZA 2B8QA 2GGPB 4YR2A 2ALZA 4PUOA 4NXNJ 1R8HA 4USHA 5AE2A 1M5HA 3UNGC 4I2QB 4LUBA 2Y8WA 4J9VA 1F3FA 3KLFB 2LYVA 2J0SD 1M5SA 2HIQA 5H9EK 1Z4UA 1A9NB 2RIJA 2BE2A 4F4YA 3IBFB 1LK5A 3OTOF 3A3PB 4RW8A 2EKYA 2EFGA 2JNJA 3KHHA 2E1PA 3M9NB 3NGRA 3K0JA 1NHVA 1Q53A 3BO2A 1FK9A 2CRLA 5JVHQ 2V8HA 2YVSA 2B7CB 1KOOA 1RB0A 3G71S 3R5CA 4ANCA 2BMBA 1YJ9S 1TL3B 2GIFA 4EO8A 3QFWA 1IBLJ 3QJLA 2IRYA 2VFSA 1NDPA 2PI5A 5EX0A 3OFEA 1NSPA 3OL9A 1WTBA 1WACA 5KFUA 2H5IB 3M1VB 3AXKA 4WWSA 1Q5YA 3VVUA 2VIHA 2NZ4A 1CJUB 2HNZB 3KNAA 1CJKB 2UUBF 2XY7A 4P2SA 2FIUA 1NK4A 3HVAA 4D3HA 2EBEA 2P8IA 2X3DA 1ZM2A 3L7OA 5D4LA 2E44A 4OX9J 5ETVA 2YNIB 4PZVA 1WUUA 3A13A 4MK7A 4KSEB 1LW0B 2MQMA 2DY9A 4F04B 3Q0AA 1F5CA 3MEDB 4F4KA 1HL6A 3V6JA 1S49A 2FZCB 3M6UA 4QOTA 1G1XA 3CJRA 4LBIA 1I94J 3K2YA 3Q8SB 3C6UB 2G0JA 4B3MF 2H3EB 3R5JB 3DM2B 5GADI 2V9KA 3OJUA 4OX9F 4K4YA 2HFZA 2YNFA 3W8GA 2X3GA 1N0VC 4XDCA 3FJ2A 4NX9A 5B08A 4FPRA 5C2GA 1U8WA 2ASJA 1U6BA 1DBDA 2CJBA 1I94F 1RYRA 3CJSA 2YKNB 3VAIA 4M5GA 4OI4A 1PC5A 3SQGA 2KT2A 1YJUA 1NJIT 2E1RA 3CJ4A 1UL3A 3DFEA 5L39A 1RT6A 4KHMA 2W4CA 3JSMB 5E3QA 3R2CJ 1OYEA 5BR8J 2B43A 1AXQA 3VKRA 4KPCA 2XO6A 4I67A 5KTQA 2YX7A 1WG4A 5HP1A 4KGKA 4Y00A 1K9MT 1RWKB 3MOJB 1N33J 4P2XA 4RBTA 4C6AA 2UU9J 3T9ZA 5J2QA 4LRFA 2FQQB 1NK8A 2ZVIA 3I0SA 4TQRA 3K5MA 2WCXA 4IR9A 5BR8F 4BS2A 4S3CA 3K89A 3UDVA 5CD4H 3ENVA 2QSWA 2UP1A 4FF2A 3BN4A 4PWDB 3CE8A 2QT7A 2OH2A 4IUFA 3HULA 2UU9F 2OEMA 5F9LA 2CZVC 4AOPA 4L72B 1AUDA 1PYOB 2QSFA 2ZNYA 2VF3A 5I3PA 2VDIA 4QW9A 5K8PA 3DKDA 1XQIA 1N6QA 1BQNA 2BX6A 2ZBRA 1HD1A 1N5YA 3CCQS 3H90A 2AGOA 2B4PA 2BZ2A 4I1TA 2R7RA 1FXLA 3Q8YA 2BR0A 1N8RT 2EC2A 3UI3A 1Q8LA 4OJ1A 3GFXA 3NGKA 4KKOA 1CULB 2QN6B 3C15B 4C2MA 1YSJA 2DIVA 5KAKA 1M90T 2N3OA 3JS9A 3X3UA 3MR5A 2EC0A 3J80Y 4LF5F 2AYMA 1YJ7A 4DPXA 4R25A 4WTYA 1M5VC 4ILLA 2V2QA 1WF2A 4ZPVR 4ID5B 3K8WA 1X0PA 2MSTA 1OYDA 3GIKA 4OFZA 2WSCC 1OPZA 1KQKA 1NJZA 5ETQA 4NI2A 1CSJA 4ZN1A 4AL7A 1YJVA 2IYIA 4DR3J 3BGFA 5FD1A 3KJQB 2DNYA 2V94A 1RTZA 3N28A 4DV7J 2QA1A 3SSRA 2XYGB 2LEAA 3M6XA 3I0RB 3ZZPA 2QMWA 3HSGA 2AYBA 3H2VE 1A6LA 1FO1A 2GIRA 3MUMP 5D4OA 4DR3F 2XLKA 3VAJA 2X7IA 2RHSB 1PO6A 4K0KJ 4W98A 3G6ES 1RTHA 1MMLA 2K3KA 2SXLA 1IQTA 3AJ1A 3OXLA 5LXRA 3NWRA 4O3NA 3SQOP 5KG0A 3DLKB 5DQIA 4JI4J 2C2DA 1NK9A 3BDEA 3SMZA 3TJAA 1RT7A 3NS6A 3MOZA 2DD8S 3R7SB 2PI4A 4HR2A 5KFLA 4DV0F 3VALA 3KUHA 2CG8A 4L3KA 3KHGA 7AT1B 1WOSA 2FVPA 1BLUA 3EE3A 1VRUA 3MUVP 2ZOMA 4JI4F 4DCPB 4BCAA 4QBUA 2RVJA 3MR2A 2NLWA 3THPA 2ALYB 2GJ2A 3OQ2A 5KFAA 2JC1A 4MAKA 2OPSB 4LT6A 1FHTA 2ACMA 2Z2YB 2FZKB 4URGA 1DQ9A 1U1QA 5BYRA 1N4LA 1JKHA 2DGTA 2VG6B 3KK3B 5KT7A 2B6AA 1MLAA 1S1VA 4NLRA 1D09B 3NL0A 2X1GA 3KJNB 2WSEC 1WOPA 2HHTA 3NCPA 4HDGA 3G9CA 3PW4A 2VZ9A 1AYEA 4NLQA 3NKYA 4FXWA 1M0SA 4N77A 1SQEA 1M5KC 1L3SA 5KFEA 4I2PA 2BW7A 1SL0A 4O3RA 4RW7B 2UXDJ 4JYAJ 2E7VA 8RUCA 3QSIA 3TUJC 4DV6J 1I6JA 3PW0A 3R7BB 2WVEA 5KG2A 4JI0J 3MEGA 3SV4A 1CEZA 1X5SA 4DV2J 2GGPA 1UWBA 5GAHI 2VG7B 2DNKA 4BLGA 2FLNA 3V5RA 4LVOP 1Q1KA 4Q43A 5HQLA 2ZDPA 3BGOP 2FJEB 4DV6F 1MN7A 4LFBF 4FBTA 2CQIA 4JI0F 4DFMA 1UW9A 3EMTA 3JTPA 3HT3A 1AFIA 4DV2F 4HYKA 2VBWA 2HQCA 2WVFA 1TUGB 4PQAA 2NPIA 1HW8A 4XO0A 3OTDA 3N6NA 1UFLA 4IH7A 1TTHB 1UVNA 1S1XB 3OR1B 1TL3A 1QTMA 3FZ2A 2XYHB 3QIPA 2ZBQA 4ECRA 4A8FA 4FKYA 1UJ4A 5K8MA 1O6XA 3NGSA 3LP0A 3M1VA 1RAJA 5E3PA 3EGNA 4NYPA 1Y3JA 1CJUA 2HNZA 3DRXA 2GZOA 2WW8A 4HTRA 2UXCF 1H74A 2Z0GA 1CQNA 1JLQB 3WBZA 2YWEA 2AU0A 4QIVA 4QPXA 4XDDA 1FDAA 2OFGX 3PW2A 4S3BA 1B3TA 3SV3A 2YNIA 1CJTB 3GWCA 4O3PA 4U8VA 1LW0A 5E7OB 2QLXA 1YI2S 1S1TB 1HA1A 3OSPA 4YMEA 3MTKA 1RK8A 3RW7A 1MW7A 3L09A 3HJFA 2XS5A 2HQFA 2P6TA 3IWXA 1NDKA 5K5MA 1YBAA 2RNEA 3BGUA 2DY1A 3DMJB 1VISA 3DM2A 1W7WA 3SCKE 2OPRB 2FVSA 5FLXU 2K7JA 4OI2A 4I64A 4LF4F 2LU2A 1T03B 2L41A 2F8HA 2J9DE 2ZWOA 3P5TL 3HP6A 4JI2J 3OFFA 4AE5A 2E29A 2PEBA 1RABB 3RB3A 1UVKA 5AXKA 1N5VA 4DFPA 1JIHA 2C3PA 4LMZA 4PXDA 3T6JA 1RT4A 1S57A 2E5JA 1GQEA 5CXTA 2CJQA 1D9FA 3M30B 2MTLA 2DK2A 1EQMA 4X4OA 1F5BA 3CMAS 3TX8A 2QA4S 3KHRA 2LDIA 1HNZJ 4LRBA 4OV6A 2B5JA 4B9VA 2OELA 4DSJA 1YJRA 1S9GB 3H5UA 1XC9A 3LALA 4DDFA 5K8NA 2BA9A 1RAHB 2ATCB 4ECWA 4DFJA 1DURA 3S01A 1UJ5A 5GAGI 1FE4A 4DX8H 2DT9A 5E33A 9ATCB 1VRTA 4PWDA 5IV3A 4IFYA 2PE8A 4K5SA 5HMWA 1X4EA 4PR6A 2DGSA 3G82B 4ZITA 4RW6B 4K4XA 2CZ4A 2ILYA 1A7GE 2NUHA 5CQGA 4K4UA 3PR4A 4A46A 3GV7B 2AGQA 2ROPA 3JSBA 1A0OB 5ETLA 4USWA 4CRJA 3AJDA 1N54B 1XMBA 2W25A 2DEIA 5KFNA 3V6HA 2KVIA 1XMQJ 4WBFA 2XWYA 4ZVEA 3N4WA 2VHGA 1CULA 2RRBA 1X7VA 1UJ6A 5F8NA 2A18A 3ILJA 1UEUA 3AOCA 1H0HB 1JXVA 2RSQA 1T0TV 5L46A 3D68A 4JI7J 5DG9A 3DOLB 3WDOA 2KXNB 4CNYA 3DYAB 1LWXA 2BJEA 4MT1A 4ID5A 4C48A 3PJWA 1JLAB 2KHDA 1SQGA 1XMQF 4RNOA 1UA0A 3QRQA 2R8IA 3G86A 1NM2A 5GADU 4Q44A 1VQLS 2JZ5A 1JK9B 1CS4B 2XWXA 1KFSA 1UVIA 4LBPA 3FGVA 4DF8A 1REGX 4S0MA 3PXGa 3IO1A 2B7BB 2Y1JA 1CBKA 1TKZB 3M2VB 2XQCA 2KTQA 1WELA 4B3TF 1Y9OA 2H4WB 2E1AA 3UR3C 2Z4PA 2W2OP 1YVFA 3HDSA 2XCPA 1EQ0A 3RW6A 3CCRS 2ASLA 2BRKA 3D3BJ 3RRHA 4JI6J 3O3LA 4QWAA 3EGVA 4MKBA 4FF3A 1H7XA 3CD7A 4OYXA 2HZAA 4WXOA 1NSQA 1NPPA 3IWNC 4F4XA 2DRBA 4A8KA 3B0HA 2AEFA 3O5TB 1SCJB 4NLVA 1X4FA 1H6KX 3OXGA 2CPDA 4ZIVA 4DR6F 2WB4A 4X4VA 3WQPA 4W92B 4S38A 2OMLA 4X4PA 1MWQA 2MKHA 2Z57B 2AWZA 2EFNA 2R7UA 1NJXA 2OPSA 1YJNS 2DJWA 2BOPA 5F8MA 3FCHA 1F2HA 1S0VA 4YHHF 2VD3A 2RU9A 2VG6A 3KK3A 3GILA 3TZZA 1S0MA 5JUMA 3KLHB 1SKRA 3MEEB 3RRGA 1P1TA 4USIA 1XNRJ 3C6TB 3QZ7A 5D4NA 4CH0S 3GG1A 3PHEA 1GMWD 5HN0A 4DPYA 1GXLA 5LL6d 2GAGC 2ZH8A 4A8YA 2Z56B 2VA3A 5KFVA 2WAQD 3CJKB 3ZZUA 4GKJJ 3M4XA 3ZZRA 2X1FA 4LREA 4RW7A 3ZFVA 1S6OA 2CYYA 2BVZA 1KKHA 3RAMA 4ECSA 2HGNA 3DRRB 3FDSA 2XNQA 1XNRF 2BW2A 5E3AA 4ZLPA 1TVRA 3SSQA 2OSRA 4KAIA 4CO5A 1VLYA 3N0VA 4B08A 3SCJE 1RHRB 2VG7A 3RR7A 3I82A 1S12A 4RBVA 2HQIA 1NHUA 2CQ0A 2ZVSA 4MIWA 4G6VB 4WKYA 1WC0A 1R0CB 1UVLA 1N56A 4DR1F 1S72S 3CF5Q 2LXFA 3FRZA 1JLEB 5KG3A 2KH9A 2GVDB 2CA9A 2R2SA 2HK3A 2YTCA 4QIWD 2R4FA 1UEKA 3AOPA 3IGNA 3WX4A 2AYGA 5L1LA 4ZP8A 1S1XA 3OR1A 1Y10A 4ZLNA 4NOHA 3LPYA 2K2PA 3CJ3A 4G1QB 1TUWA 3QT8A 1HARA 4C8LA 3R1HA 4NPOA 3H20A 3TAMB 4ZN3A 1OY8A 2Q43A 3FZBA 4NLUA 2RS2A 1UKUA 2C2ZB 2H9ZA 3PX4A 4LF8J 2HHPA 3BO3A 1B99A 4JI1J 2ZJQQ 2HS4A 5T41A 5C7PA 3AOAA 2F4VJ 2GIQA 3NNAA 3D67A 3J80U 3JQJA 3NOGA 4K4VA 2OHDA 4DS5A 1JB0C 3VKQA 5KG4A 4WFXA 2QL7B 1BQXA 7FDRA 4JI1F 3AD9C 1SL1A 1CJTA 4H4MA 1VS3A 4RW4B 1S1TA 3BKTA 1TL1B 4C8YA 1GT8A 5KT2A 2RDJA 2F4VF 2IVYA 1RDRA 2V50A 1JLGA 3BYRA 2BQRA 4BWMA 3TRGA 2IPOB 4I0WA 3DI6B 3Q8VA 5AOPA 4A47A 1VC6A 2KYXA 2OPRA 2VJUA 2KKHA 1T03A 1J27A 2Y0FA 2XSJB 3OVSA 2CPXA 4UQTA 2ZBPA 4DV1F 4FF1A 2HIYA 5HLFB 2JEJA 1GNKA 3FEZA 3I5CA 2XLJA 5IC6B 4G3IA 2VKRA 3L7UA 2FHMA 5CABA 1G4CA 4GO7X 4DCOB 4C0BA 3M32B 2LKZA 3MUTP 1RWXB 4NLXA 1OO0B 5L1KA 4IRDA 5F0UA 5GAHU 2VICA 3W1YC 3GYGA 4X4RA 4FXDA 3I55S 3LUYA 4ITSA 1AA1B 5LMUJ 1RWOB 2CWKA 1OSDA 4X66J 3SDEB 2QRRA 5DLGA 1RWVB 3HK2A 1IXKA 1S9GA 1JJHA 3H59A 2AOPA 2YQ0A 1Y5NB 4M1KA 2HHUA 2FD2A 3DOKB 3CCVS 4X65J 4O3OA 3TA1A 5GAEI 3LANA 4HH1A 4FYXB 3M8SA 1NUEA 2J76E 3MCOA 3T19A 4YUDA 2FC9A 1WHVA 1NSKL 2HLTA 2W2QP 3TNVA 3ZZTA 4FYYB 2O01C 3G82A 4RW6A 4JV2A 4OYPA 4OZ0A 2D41A 4DQPA 1EJ7L 1XR7A 5KFBA 1HYSB 4M5DB 3MFHA 1WF0A 1LNQA 2YWKA 3CW2C 2AP6A 4EYHB 1KWMA 3ZO7A 2YKOA 1M5OC 4C0HA 2JC0A 2KM8B 4YDDB 4M63A 5ETNA 2FZGB 4PRFA 2EWHA 4WIIA 1HQEB 3LA0A 3J81j 3DRPA 4QZVB 4J9RA 1HBMB 1KLNA 5DZ7A 1VIOA 4QYZJ 2ZH2A 4I6WA 1HBOB 4LJMA 1PJ5A 3DOLA 3DYAA 2YNHB 2DNNA 2XMVA 3N79A 2FY8A 1QVGR 3E8OA 1JLAA 3A8KA 2PFDA 1VRQC 4DU8A 1V5VA 1NJYA 2HHXA 2E9TA 3BGRA 4A8MP 1GEHA 2OAUA 2JH3A 4ERDA 1PGZA 1CS4A 4ECUA 1JJ4A 4UF4A 2C28A 4LF2A 5A6WA 3QNWB 2E5IA 2MEWA 2KT5A 4USKA 2ZH3A 4R5PB 2PMHA 1V5IB 3KNGA 2DCLA 2OPPB 1TKZA 4IG3B 3M2VA 4C8OA 4ZLJA 3AT1B 3M8RA 3A3OB 2ILZA 2M88A 4LF7F 5D0GA 1HQUB 3OFGA 3PO4A 3B4DA 3CC2S 2H48B 1U02A 1RT3B 1VQ8S 2VPZB 4U95A 5G4DA 3BGLA 4N8NA 4R0EA 1FXDA 4HTJA 1RBAA 1Z2ZA 4J9MA 1JMTA 5B0DA 2DXFA 3GFZA 4X62J 2RUSA 4DSIA 2XEXA 1IWGA 3OTCA 2OEJA 1J2VA 3UVJA 2RF2B 4KO0B 1NJWA 1Z2LA 1RTJA 1WEXA 1L3KA 5E2QA 5A2QY 2Z2ZA 1T9TA 3GMGA 1B64A 3EZUA 4X62F 1PIEA 1RBLA 5CYMB 3TANA 4U7UK 1N0UA 1NHKL 3FSXA 4O4GA 5A0YA 3OUYA 4O3QA 3KHLA 2YKAA 1SC3B 4DL3A 3ENQA 2D74B 4QQBA 4P71A 3JAMY 4X4SA 3ETMA 3CT9A 3OL6A 3BSCA 4PXEA 2KFYA 3CO9A 2XGQA 3POTB 4ELUA 3BBFA 1TU0B 3KLHA 3SCIE 4NCBA 4GEPA 1NBEB 1R89A 3C6TA 2GHPA 4L3NA 2CKWA 1WKLA 1QLNA 5EWGA 2NQPA 2EVZA 2JHEA 3D6MB 1KSPA 2LFVA 4V19X 4GKKJ 2JOQA 3CJKA 1TK8A 2WVDA 2YWWA 4JV0A 1TKTB 3DRRA 4E2FB 2DH9A 3R97A 4CWBA 1HHSA 4FF4A 2N4CA 2DNHA 3R1LA 3OV7A 1VR6A 1HWUA 2GAHC 4NA2A 3QZ8A 1KP6A 1NXIA 1S6QA 4RKUC 4ED2A 5CZVA 3H40A 3H2UB 3L4BC 3DLLQ 4BDPA 1NMEB 4KR0B 1FVQA 4DXLA 3A8JA 3PYFA 2BM1A 3MAHA 2XS2A 1S1UB 2FGCA 1UWAA 3Q2TC 3OD2A 3DRSB 1EX8A 3D28A 3J7YI 3CDEA 1RAIB 1KLMA 4MKAA 2GVDA 3QPIA 4P2FA 1FD2A 3Q2SC 1AZSA 2GMLA 2MQQA 3GCWP 2AGPA 2FHKA 4ZVSB 1U2RA 1EKRA 2OFHX 4G1QA 2GW8A 1VBXA 1RHJB 2DITA 1VQ9S 4KGMA 4MYTA 3TAMA 4K4TA 1HNIB 2ZE2B 4OX8A 4O44B 2LU1A 1E6VB 4ECYA 3FSIA 3M8WA 3TVKA 1S6PB 3E2EA 1RXOB 2XBPA 2RQMA 2CNKB 2Y0BB 3IRWP 3US5A 2MXYA 4OHXA 4Y2MA 4P7TA 3PW5A 5HANA 1U45A 3MM8B 3EXYA 2FHJA 4WZQA 3AY0A 5D6GA 4NA3A 5F3ZA 2HS3A 3UO0A 2Z8QA 1IVZA 1O0PA 4DN9A 1VQ5S 1TR0A 5AJ3F 3D0IE 1WTFA 2KO1A 1DQAA 2MKSA 2KDOA 4J9OA 3MPYA 4BWJA 5DJBA 3TR5A 1YZ6A 4RW4A 1TL1A 5AXNA 1H2VZ 4JB8B 3BREA 3NNCA 1U24A 1N48A 2MQNA 4HH0A 2CQBA 4IDKB 4NZ0A 2LQ5A 3TAQA 2ZD1A 4ETXA 2LLZA 2ADCA 4O3SA 3QFHA 2BQUA 2XSJA 4FVCA 3VWSA 5D15A 3K58A 5IXUA 1EP4B 3IRXB 3OR2B 5HLFA 3W5YA 2V34A 1RISA 3NEKA 3IAM9 2YKPA 2LEPA 3TA2A 2VL1A 3CJQA 4KHRA 1C0TB 1Q8IA 5U47A 3F0NA 4DSLA 2C2RA 1AROP 3NBPB 3THVA 1F2GA 2GFFA 1T11A 3IFEA 3PYEA 5KFCA 5B0CA 3TVYA 2QL9B 2BBEA 1BC6A 1XERA 1SL2A 3JSYA 3M8QB 2XMUA 1D3WA 1PG5B 1NU4A 1FFGB 4L73A 3SDEA 4LSZB 1TUVA 2OTLS 2K3IA 1NRKA 2LQBA 2GA7A 3V4MA 1LFWA 2ZH4A 2AEJA 1TELA 4P2MA 1M5PC 4S3EA 3DOKA 4K4ZA 5CHCB 2I2YA 2AMCB 1DY3A 1FKPB 2H51B 1QAYA 5BYSA 4MFBB 5G0RB 5ETTA 3VQSA 2ZZNA 2I38A 2LQ9A 3AOBA 2IA6A 3SFUA 1QAIA 1NPKA 3A12A 2F40A 5GEPA 2RKIB 1VOMA 3V6KA 4PG6A 2C2OB 1D9AA 3LH2S 1WC3A 1TK0A 2V2VA 1OWXA 4M5DA 1HYSA 3OXFA 4YY3F 3TW0A 3N6LA 4DV3J 1JJCB 4DFKA 2CJXB 2V4RA 4GVBA 4F4AA 3I56S 4FNIA 3NP5A 4WXWA 4B3RJ 1KVIA 4WU2A 4WP8A 4CDIA 2J5AA 1FVSA 2EEYA 4F67A 4ED3A 2IM2A 2HGMA 4CLTA 2N7YA 1HBMA 2NXUA 5AE1A 1U48A 4DI6A 1YRUA 2RRNA 2QTWA 5KFTA 4DV3F 1HBOA 3QT6A 2B9YA 5E5NA 5IOLA 5J1NA 5DGAA 3D6FB 4TNOA 4TQSA 1FK9B 3CJ0A 4USUA 1X31C 2XTJP 4KHPF 2FY1A 4B3RF 5CH7B 2M8DB 1MROB 3PDNA 4PG4A 3FQLA 2KRBA 3RRKA 4K4SA 1SIZA 3RGIA 1R0AB 3L3CA 1U7LA 3HI9A 5HL7Q 5J2NB 2V8GA 2CWXA 2FVCA 1BMQB 2OPQB 2B4VA 3AA8A 2OPPA 4IG3A 1H7WA 4JI8J 4L76A 2YQ1A 4CLPA 1FA0A 4OZ5A 5IT4A 2M52A 3EVWA 1HQUA 4QCLA 2CQCA 3MMJA 4WIQA 4ILRA 1RT3A 1LEOA 4EMDA 5CYJA 1YK9A 3HT0A 2DNQA 5HI7A 1OSCA 3UWTA 2VFTA 1WHWA 3PR5B 4PPDA 2DNZA 4KQZA 1H3DA 3AA9A 1DZ5A 2FPHX 5HK4A 3NMAA 4CCHA 1HNXJ 1NKBA 3LAKA 2MDAA 4KO0A 4NLGA 1LQ9A 7FD1A 1Q95G 3NGDA 2MHNA 2P9CA 4DV4J 3P45B 2OP5A 4ILMA 4UY85 2VC0A 4X4QA 3GB0A 1U2CA 1RT2B 3R6GB 1JWWA 2NR0A 2C1EB 2XHWA 1VHFA 1L5UA 2FVRA 3RB0A 2B3TB 2CFXA 2DPIA 4NXMF 3ILLA 1GXUA 4ZP9A 3IGVA 1X4AA 3IXQA 1G2EA 2GEPA 1VQ7S 3MAQA 2IJRA 3MMAB 4DV4F 4I69A 2W7OA 3R27A 5IM0B 5E3RA 3POTA 3PJ9A 1LWEA 2MKYA 2VG5A 1SC4B 4PG8A 3F56A 1P27B 3HHLB 4MKYA 2F65A 4RBUA 1MMNA 3NLCA 1X4GA 4CO0A 3VCDA 1RAAB 2QV6A 3CJ8A 1YZ7A 3A1YG 3W65A 1QAXA 1SJQA 3E51A 3HLUA 1J5OB 4TYBA 1SJ3P 2WBRA 2WONB 3NAIA 4G39A 4H4OA 3TUPA 1TK5A 4K50A 3CSKA 3H7HB 4C11B 3OHAA 2KU7A 4Q8FA 2Z30B 2Y1RI 3FEYB 1FNMA 2IDLA 5E0OA 4M5IA 1HIYA 3H2LA 3PZPA 2VDHA 4CLLA 2HAFA 1KBRA 1N36J 4UZBA 1S1UA 3OLBA 2HURA 3DRSA 3BF4A 2F9DA 1APSA 3MCMA 3JXOA 5KFFA 2DGUA 3PX6A 4M8LA 2HBYB 2RB7A 2A6MA 3CC7S 3B8HA 2AEMA 3D6TB 4NYOA 3QGGA 1SKUB 6FDRA 1N36F 4GMKA 5FDLA 4TYAA 3CD0A 2XLIA 2G0CA 4ID8A 4OI0A 3G8TA 4NLWA 4JV1A 3DLHA 3W8PA 3Q8QB 4B3SJ 3CULA 3HSZA 4KKOB 3CUNA 2VONA 1U4BA 2R8HA 1HNIA 4F02A 3A8IA 4O44A 2HHVA 2R3VA 2FTRA 5DM7Q 2C42A 2C22A 1S6PA 3GYNA 3QSYB 1N5QA 1BWEA 1UFWA 1AB8A 1FJ7A 5ITHA 3NCRA 1RAEB 4I56A 4M94A 3THTA 3ICLA 4B3SF 4LFAF 3RBXA 1BE4A 4F3MA 1HBNB 1UMJA 4C98A 3MPVA 2YPZA
chains in the Genus database with same CATH topology
2Y0SD 3CJ5A 4PR6A 2DGSA 3CCSS 3TUIC 5D4PA 3H5YA 4ED7A 2MJUA 3KK2A 1RTDA 3OL8A 3MECB 4ZPDA 1OPIA 2ZOGA 4RW6B 3PIOQ 4K4XA 2NYIA 2CZ4A 2ILYA 2JFDA 1YTYA 1A7GE 2NUHA 4ZPBA 2OLWA 1XTZA 1D9DA 5D3GB 1U09A 5K14A 5F8GA 3U7JA 5CQGA 4V19J 4Z2XA 3W2WB 4K4UA 1C1CB 3VZHA 3PR4A 4IQXA 3GZ7A 4OMFG 4DQIA 4A46A 3GV7B 1D0EA 3M32A 2AGQA 2V4JB 3CTRA 1F60B 1VFJA 2XSFA 3S8SA 3N5FA 2PMZD 4AXIA 1H2UX 1V6HA 2ROPA 2MYFA 3JSBA 4MIBA 1HI8A 1U1RA 1N5TA 5AE3A 3M2UB 4RW9B 2E5LF 5KFWA 1N54B 4KC5A 1XMBA 4FYDA 2W25A 5KFNA 5IS2A 2XB2D 3B82A 2KVIA 3V6HA 2XNRA 1NK5A 3CD5A 4H4KA 5HMYA 2EG1A 1OIAA 2W8KA 2XWYA 4ZVEA 3N4WA 3CDBA 2MQOA 2BUNA 3HHDA 1SJRA 4WFYA 2YH1A 2RILA 2RRBA 1X7VA 1UJ6A 5F8NA 2A18A 5J2PB 1UEUA 4ICLA 2LXUA 2W9AA 1H0HB 1RT7B 3H25A 3TYTA 3B0GA 2RSQA 2WTFA 4IYQA 4ED5A 2RMLA 2HS0A 1X5OA 1EP4A 2B9WA 4DG1B 3IRXA 3N6MA 5DG9A 2VB6A 3RR8A 4B02A 1QJHA 2EFPA 4IFVB 3DOLB 3WDOA 3MMBB 2KXNB 4LSNA 4CNYA 4C3MA 3HVWA 3DYAB 4UOCA 1HPZB 2R7TA 1X4BA 2UZAA 1HBUB 2BJEA 4PQUB 3QWPA 4ID5A 4RU2A 1TQLA 1JLAB 3PJWA 5FJ4A 4KTQA 2CPYA 1U8SA 4F2SA 4C7QA 2KHDA 4A8OA 3N01A 3PRBA 1XMQF 4X84A 4RNOA 3JSRA 5ADZA 2KJVA 1UA0A 1SJ4P 1C0TA 4DN0A 2R8IA 1IBMF 4U67Q 3G86A 2E9RX 2OTJS 4BHQA 3H5SA 1NEEA 5GADU 4DV7F 2CPEA 2GHWA 5L9NA 4Q44A 3AJ2A 3MM5A 3QYYA 2FJAB 5KT5A 2RJZA 2J9EA 5KFSA 1VQLS 2JZ5A 3PIPQ 1JK9B 3NBPA 1JNRB 2XWXA 3HMJG 1KFSA 3B0MA 5KFRA 1UVIA 4B9LA 2X1BA 1C0UB 2HRYA 2LDYA 4RNNA 3T1AA 3GV5B 3FGVA 4DF8A 4MMOA 4NZ6A 5CZXA 2CQDA 5H9FJ 5EGYA 3W7BA 3PXGa 3IO1A 2B7BB 3FFIA 4ZA1A 4I4BA 2Y1JA 2L9DA 5C5JA 4ELVA 4F2RA 3M8QA 3MM7B 3V6DA 1QSYA 1TKZB 2PA8D 4K0KF 3M2VB 2KTQA 1X4DA 1WELA 3SI8A 1AOPA 1W25A 4O0IA 3DRYA 4B3TF 2I5JB 4PUOB 1Y9OA 2E1AA 3LP1B 2G9OA 2MZ1A 3UR3C 4QYRA 2R8GA 2IAJA 2Z4PA 3D5MA 4KBIA 1P6TA 3QWUA 4U6PA 1ZH5A 3R5AA 1YVFA 3HDSA 3BO4A 3C8YA 3QAEA 3JYTA 2XCPA 1YG0A 2VH7A 1VK8A 4CQ1A 2FJWA 1FEEA 1UEVA 2IMWP 2ZOFA 3CCES 2MJNA 3MGJA 3OSNA 3LW5C 3CCRS 1FDDA 2RRAA 2HPUA 3HX9A 1U49A 1FKPA 3QIDA 2ASLA 3VKPA 1SKWA 2M3DA 2BE2B 2BRKA 3SZ2A 1WEZA 3QO9A 2CQGA 3HZGA 3KLIB 3OTEA 4KRWA 3RRHA 4Y34A 1S0OA 1FRJA 4KIAA 1DLOB 5HO4A 1QVFR 4LIRA 3O3LA 4MFBA 4RW8B 1HQEA 1B0PA 4OZNA 5EX3A 4C4WA 1VQYA 4QWAA 1DHMA 2KXHA 4MKBA 2QYCA 5EWFA 1KD1T 3AQPA 4NLSA 5HMXA 4FF3A 1G6BA 1H7XA 3CD7A 2XULA 2XS7A 4OHYA 4H54A 3OLAA 4A8SA 2DHGA 4DUZF 1FXRA 3RBDA 4FXVA 2G13A 1HNVA 2HNYB 2UUTA 4WXOA 3K5NA 1SUQA 1YHQS 1X0FA 4TY8B 2N82B 4F8RA 2RKIA 5HMZA 3IWNC 5I3QA 4F4XA 2YNHA 2DRBA 4A8KA 3B0HA 2ABYA 5J1PA 3FNNA 1S0NA 1IKVB 1I1GA 1IKYA 4XK8C 2Q1LA 2I8EA 3M6WA 3O5TB 1RJJA 3EXCX 1Y4ZB 4NLVA 2AV5A 1LXNA 1U1PA 1UWBB 4TKTA 1LFPA 1DTTA 1Q82T 1MU2A 1H6KX 1X4FA 1XK8A 2W4PA 2CPDA 3OXGA 3UCGA 1RA7A 1S1WA 3KMQA 4QR2A 4DSEA 1ZM3A 4DR6F 2M7SA 2WB4A 1LWCB 3CVKA 5DQHA 4Q2MA 4X4VA 3GFHA 4W92B 4S38A 2OMLA 4X4PA 2AJ0A 1L3VA 2MKHA 3LO3A 4J9LA 1D1UA 4CZCA 4YB1P 3M9OB 4IRCA 1NK6A 2D1CA 2ZUGA 3CIZA 3MPWA 4Y3CA 3P49B 2AWZA 2EFNA 1QE1A 1S77D 5B09A 1DJ0A 2EW9A 1TL5A 2R7UA 3V4IB 1YRXA 4ZS6A 5D78A 4S3DA 4ZCKA 1NJXA 4AL5A 5DLFA 1FCAA 2OPSA 3MCSA 2JL9A 3CXCR 1FNXH 4R5PA 2DJWA 2YKMB 4A4JA 1YJNS 2U2FA 2BOPA 5F8MA 3D0HE 3FCHA 4DL7A 1S0VA 1CC7A 1O51A 3IR7B 4YHHF 2VD3A 1RP5A 2RU9A 2VG6A 3KK3A 3GILA 1NK0A 1S4FA 1X9WA 3WC0A 2R9LA 1S0MA 5JUMA 2EPIA 3IWLA 3O44A 3KLHB 2N7CA 1SKRA 4ZHRB 2F3JA 3I9ZA 1U1KA 3RTVA 3MEEB 4I2QA 2UXDF 3RRGA 1P1TA 4USIA 2C2EA 4JYAF 1R8CA 5KT4A 3C6TB 3Q8PB 3QZ7A 2HG4A 5D4NA 3KLFA 4CH0S 4WE1B 2KFZA 3GG1A 2IMOA 2FJXA 3D1OA 4RZRA 2IM1A 3K8VA 1MROA 3PHEA 3TOQA 2ZH5A 5HN0A 4Q0BA 3HHEA 2ZHAA 5IZHA 1GXLA 5LL6d 2R7SA 5F41A 2ZH8A 4A8YA 5L9XA 4QWBA 1SH3A 3RB6A 2VA3A 3FQKA 5KFVA 2VOOA 3QIPB 2MHEA 1R0AA 4YB5A 2WAQD 3CJKB 3ZZUA 1S79A 3QGPA 1UW4A 3M4XA 2VV5A 4WK3A 4JI8F 3ZZRA 2L9NA 3CCWA 4DHVA 3ZFVA 4RW7A 2X1FA 2CQ3A 4F25A 3IR6B 1OQ3A 2DNPA 5GAGU 3KTQA 1S6OA 4ZK7M 5J2NA 2CYYA 2HVZA 3IR5B 3PACA 4ZMMA 2BVZA 3Q23A 1FEHA 3RAMA 2UVVA 3RB4A 4ECSA 1SC6A 1NB7A 4IH6A 2HGNA 3DRRB 4QU7A 1SH2A 2OD4A 3FDSA 3ONQA 2E9ZA 2E1CA 2OPQA 3LP0B 5A8WA 4DL6A 2XNQA 1XNRF 1SJ1A 2CIMA 1Q16B 2BW2A 3PRDA 4Y2KA 5LSOA 5CA5A 2IBOA 2P5VA 4WFNQ 3JB9k 2J6TA 2RF2A 5E3AA 4N47A 3E01B 1U2FA 4ZLPA 2KJWA 3BB5A 1TVRA 3SSQA 5C42A 3GEOA 2OSRA 4KAIA 1SB6A 3MF5A 5KG1A 3BS9A 2E7XA 4CO5A 1VLYA 2IVMA 3N0VA 1MMDA 4B08A 3EPGA 4KFBA 1V9OA 3SCJE 2IJNA 4DQSA 5A8KA 1LWEB 2VG5B 1T3NA 3MXHP 2YNFB 2VG7A 3MMCB 4PWUA 3RR7A 4EBDA 3I82A 2J6SA 2DNMA 2W7PA 4TU8A 4A8QA 3FRYA 2HQIA 3EGWB 1NHUA 2CQ0A 2ZVSA 4MIWA 4RBVA 1XEZA 4CTAB 2VBZA 1JXLA 3OVBA 4AXJA 4G6VB 1S9FA 1VMBA 2HFOA 5CYMA 4WKYA 4DF4A 1REVB 3PO5A 5F8LA 2KG1A 4ECQA 2M2BA 4EZ6A 4DQQA 2BANA 5KFHA 1UVLA 1F5AA 1HNXF 1C1BA 4KV8A 4J5OA 5T7LA 4DR1F 3CF5Q 1S72S 1K1QA 2R2RA 2LXFA 3KMSA 1N56A 5F8JA 2DH8A 2XZWA 4N8OA 5EN1A 3DXSX 2PEHA 1K8AT 2ZITA 1YJTA 1YRTA 3FRZA 3DLBA 2XMMA 3SQGB 1JLEB 1HWLA 4HI1A 1RT1B 3B78A 3I96A 5KG3A 2DH7A 2KH9A 1R8PA 4Y28C 1K0TA 5LJ3Y 2R2SA 4QIWD 1EETB 2YTCA 4S3FA 2R4FA 2JEFA 2XG8A 3ZC4A 2AYEA 2RS8A 2XC9A 4DL5A 1LOUA 3AOPA 1RT6B 3IGNA 3DOMA 3WX4A 3Q8RB 1XMOF 2AYGA 1R27B 3BZQA 1BQMA 1IKWB 4RNMA 3NNHA 1Y5LB 2ASYA 2WSFC 2ACYA 4ZP8A 5L1LA 2IC3A 3QLHA 1OQ6A 1S1XA 2ERRA 4B3OA 4H4OB 1IR0A 2AW0A 1QM9A 3OR1A 3MDFA 2C3YA 2CVIA 1TV6B 3GIIA 2R8KA 4NOHA 4Q5VA 2CJAA 3C66A 3Q24A 3LPYA 3HVTB 3TI0A 1LWFA 3UDCA 2K2PA 3CJ3A 4G1QB 5HP1B 1FE0A 5KFXA 3FSYA 2PD1A 1T05A 2DGOA 2WOMA 2FJVA 3CCUS 1HARA 5GMKa 5HBMA 4C8LA 1RT2A 3R1HA 2IYGA 4NPOA 1UVJA 2W9BA 1FRHA 3H20A 3TAMB 5THWA 1FJCA 2A2DA 3CJ2A 4I6AA 4HT7A 2VFVA 4URQU 2Q43A 3UD4P 2PDAA 3DLGB 1MNEA 1P8GA 3FZBA 4NLUA 3ITHB 3TA0A 1ZZNA 3T6BA 3EX7B 3NMRA 2RS2A 2HRUA 2R7VA 1UKUA 5J2QB 1XR5A 1TKTA 1KFDA 4EZ9A 2X51A 1NNDA 5IQQA 2H9ZA 3I0SB 3B4MA 3MEDA 3O1LA 3PX4A 2Z2LA 3VTIA 2MKCA 1Q79A 4L6V3 5C24B 5B7WA 3C6UA 2HHPA 3BO3A 3J7A1 3CCJS 4N56A 2IVFB 2ZJQQ 4UY8T 1T3OA 5KT6A 1RT5B 2LCWA 3PM9A 2RQCA 1O8BA 2HS4A 3CEDA 3MMAA 5T41A 1V3SA 2MZRA 1HWJA 3IG1A 5IM0A 2MB0B 3KG0A 1FJEB 1R3NA 1ZYQA 2RQKA 3E3XA 3KJVB 1RT4B 4CO4A 5M2PA 2GIQA 3NNAA 4K2XA 4ZP7A 2KXFA 4C3KA 4KJIA 2I9SA 2ZH6A 1S9EB 4CO1A 1VI7A 3G6YA 3HHLA 3F44A 4WFZA 1Q4RA 3KFWX 3DHWC 1WG1A 2YKQA 4K4VA 4DS5A 1DRZA 1JB0C 2HHSA 5FDLB 3VKQA 2QIFA 5KG4A 1KQSR 2IA0A 1N88A 1MSWD 3T5LA 3HZEA 4WFXA 3G6XA 3H4DA 4IOAQ 3RAQA 3NOYA 2HLUA 4A48A 4K59A 2AJ1A 2PSZA 2KYZA 1BQXA 3O6QA 5K9FA 7FDRA 4JI1F 1ZAWA 2QA4G 1SBRA 5AXLA 2LQJA 4GO5X 2YKNA 5DETA 2CQ1A 3DLEA 1SL1A 1E6YB 1YGYA 2GQQA 4H4MA 4ZVFA 5LXYA 1VS3A 2GQ2A 1DTQB 2HHHF 3MM9B 1N6QB 2LMIA 1BQNB 1YIJS 4RW4B 1S1TA 1R31A 3NRBA 1TL1B 4DEZA 3PKYA 1J5OA 2B5JB 4UW2A 3HVRA 4C8YA 1GT8A 5KT2A 2RDJA 1N5YB 2F4VF 2IVYA 1F9FA 4MH8A 1JLCB 1RDRA 2CG4A 3BQ1A 4J9PA 1JLGA 2WONA 1HWKA 4Y6IA 3CCMS 4F26A 3JSMA 1KQGB 3KG4A 3BQ2A 2V8VA 2BQRA 5DM6Q 4OJHA 4BWMA 3TRGA 1HW9A 5JVGQ 3T5JA 4BC9A 3KK1B 4I0WA 1N34F 3D1HA 3MEKA 3DI6B 3RBEA 3OPKA 4FS2A 1MWYA 2VASA 5AOPA 1XWLA 4A47A 4JI2F 3KYLA 4C11A 1Y7PA 5J1EA 4B17A 1VC6A 2DR9A 3AB2B 2KYXA 4OX6A 1P1LA 2OPRA 3JTOA 3PW7A 4NZ7A 1Q7LB 2HWIA 2KKHA 5E3CA 3L7PA 3P96A 2BYCA 1VRTB 5IWAF 1VQNS 3PKMA 2XMWA 1T03A 2Y0FA 2ZJPQ 2XSJB