3OR1A

Crystal structure of dissimilatory sulfite reductase i (dsri)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
435
structure length
435
Chain Sequence
KHPTPMLDELEKGPWPSFVSDIKQECDNRAKNPKGLDYQIPAECPDDLLGILELSFHEGETHWKHGGIVGVFGYGGGVIGRYCDQPEMFPGVAHFHTVRLAQPAAKYYTAEYLEAICDVWDLRGSGLTNMHGSTGDIVLLGTQTPQLEEIFFEMTHNLNTDLGGSGSNLRTPESCLGISRCEFACYDTQLMCYQLTQDYQDELHRPAFPYKFKFKFDGCPNGCVASMARSDFAVIGTWKDDIKIDQEAVKAYVGGEFKPNAGAHAGRDWGKFDIEAEVVGLCPTGCMTYESGTLSIDNKNCTRCMHCINTMPRALKIGDERGASILVGAKAPVLDGAQMGSLLIPFIAAEEPFDEVKEVIENIWEWWMEEGKNRERLGETMKRVGFQKLLEVTGTKAVPQHVSEPRHNPYIFFKEEEVPGGWSRDISDYRKRHMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Sulfite reductase alpha
publication title Structure insights into the enzyme catalysis from comparison of three forms of dissimilatory sulfite reductase from Desulfovibrio gigas
rcsb
total genus 122
structure length 435
sequence length 435
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01077 NIR_SIR Nitrite and sulphite reductase 4Fe-4S domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3or1A04
3.30.70.2500 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3or1A02
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 3or1A03
4XK8C 3MMAB 3GEOA 1DURA 2GEPA 2V4JB 3B0JA 4S3DA 3VM0A 2V4JA 1SIZA 3MM7B 2ZVSA 3MM7A 1KEKA 1SIWB 6FDRA 6GEPA 1DFDA 3VKTA 2PA8D 1B0VA 3PNIA 5BYSA 5CH7B 3B0MA 1DAXA 1AOPA 4S23A 1RGVA 1Y5NB 2FGOA 1FXDA 2FJDB 1H98A 1BD6A 1FRKA 1G3OA 1GTHA 2V2KA 5BYQA 1VJWA 4S39A 2AOPA 1B0PA 1H7WA 1SJ1A 2C3MA 1F2GA 3EUNA 1C4AA 2PMZD 1FRLA 5BYRA 1CLFA 3VKRA 4XDDA 4S3AA 4S38A 2WAQD 3OR1B 1ROFA 1FDDA 2Y0FA 3OR1A 2FDNA 4ID8A 1D3WA 1FRMA 1FTCA 3C8YA 1BQXA 4G38A 2WSEC 3MMCB 8GEPA 3VKQA 4CI0B 3MM5B 1FDAA 3MMCA 2VPZB 1C4CA 2GMHA 3MM5A 4S3FA 2FJEB 4OV1A 1BC6A 4S3EA 1BLUA 2Y0SD 3VM1A 1A6LA 5E7OB 4AOPA 7FD1A 3MM6B 2WSCC 3VLZA 2XSJA 4KT0C 3MM6A 3MM9B 3MM9A 2C3PA 4S3CA 1PC4A 1PC5A 1IQZA 1F5CA 1WTFA 3IR6B 2AKJA 3VKSA 4AYBD 2FD2A 3VLXA 1H0HB 1H7XA 4GEPA 1GT8A 3OR2B 3B0NA 4G39A 1XERA 2PDAA 4YDDB 3OR2A 3B0HA 1AXQA 4DHVA 1HFEL 1K0TA 5CHCB 5GEPA 4XDCA 4S3BA 3IR7B 3B0LA 2C3YA 4HTRA 3EXYA 1FDNA 3IR5B 4OMFG 2FJBB 7GEPA 5AOPA 2IVFB 2XSJB 3VKPA 1B0TA 1KQFB 4Y28C 1FF2A 1FXRA 2C42A 3MMAA 6FD1A 2VPYB 1ZJ9A 2O01C 4L6V3 5FD1A 1JNZB 2Z8QA 1GTEA 1Y5LB 3VLYA 7FDRA 1GAOA 1R27B 2WB1D 3NOYA 1FRJA 1KQGB 1FD2A 1FEHA 1G6BA 3MM8B 1Q16B 1FERA 1Y5IB 2VPXB 3MM8A 3MMBB 3AOPA 2VKRA 1FDBA 3B0GA 1JNRB 2UZAA 1FRIA 2VPWB 1JB0C 3MMBA 1BWEA 3EGWB 1Y4ZB 2C3OA 2FJAB 4G9PA 2C3UA 1F5BA 1FCAA 1ZJ8A 1IR0A 5L8RC 4RKUC 1FRXA 3HKZD 3GYXB 3LW5C 2GMJA 1FRHA 2WSFC
chains in the Genus database with same CATH superfamily
4RZRA 1KBRA 2XI3A 2BJ7A 5CZXA 2P8IA 2AT1B 4NX9A 2KL8A 3D68A 4N76A 3DI6A 1NJWA 3ILLA 4E98A 2ZNYA 1KSPA 2QX0A 4DDFA 3FSXA 2HPUA 3CULA 2BJ9A 4U7UK 4LF7F 1H2TZ 4JI2F 4QW9A 1MMNA 1A6LA 2M0GB 4P74A 2N3OA 2W2NP 2J6TA 5A0YA 5KFRA 2DNNA 2M70A 3PO4A 4LF4J 2NXEA 2V34A 2HWTA 5HAOA 1X4FA 1RK8A 1OJ4A 1QUVA 4J91A 4Y00A 2VKZG 1PYTA 1NDKA 1V9OA 1YJ7A 3GE9A 4HVZA 4TY8A 4LSZB 4K4UA 5D4LA 1GMUA 1LQ9A 4IRCA 1OS5A 1AT1B 1VJQA 5F8JA 1HHSA 1HBUA 4ZLJA 3AAWB 4QJVA 4X64F 3EDQB 2V4JA 2ZH3A 1VQSA 3M7VA 1U1KA 1L3KA 3K8WA 4P52A 5GAEU 4QIGA 1X9WA 1XR6A 3V4MA 2YNGA 1V3ZA 1U1MA 1VJWA 1YLXA 2JVRA 3MCOA 2R42A 4KJIA 1UJ4A 1FDDA 4EK2A 1MSWD 2CQDA 4ZJLA 1RWUA 1S1UA 1Q95G 1U45A 2RE1A 5BJRA 2XGPA 4NA1A 2L9NA 3D6FB 3KLIA 2RH3A 4C7QA 3RU0A 2LVWA 2OEKA 1PC4A 1PC5A 4F50A 2DO4A 2H51B 2PEBA 3BBBA 3VLXA 1X4CA 2VA2A 2MQOA 2HNZB 4RW6A 4Y6IA 2OPQA 1HNZF 1NK0A 3VZHA 3MCNA 3M8QA 4NRUA 4F0HA 3HDSA 2GIQA 2B7BB 3D6HB 7AT1B 1X4GA 2IC3A 2HBYB 2XWYA 2Q43A 3OW2R 3U27A 3SDEA 4JI4F 4CO4A 2IY5B 2HFNA 1SJQA 4WXOA 2XBPA 4O3PA 4ZVEA 2WONA 2DGQA 3F0NA 1RT5B 2CJAA 5F8MA 1EHWA 4WFXA 5CH7B 3B0MA 3IFEA 4M5HA 1VS3A 1UAWA 4I7FA 2ZBIA 4RR5A 4TU8A 4Y3CA 5KFSA 3MAQA 3BO3A 2B8QA 3GB0A 2AD9A 4J37A 2OP5A 1VQ5S 4B3TF 3CMES 2ROGA 2FLLA 4OJ3A 2KFNA 4CT8A 4ZCIA 1T7PA 1OYEA 4WF9Q 2BYCA 3MM6A 1RT2B 2EKNA 5CYMA 1WTFA 4KGXB 2KI2A 3UDEA 4ILLA 3CC4S 4OX9J 1PGZA 2B4OA 1R7IA 3DOMA 4M5DB 4A48A 3ELHA 2OELA 4H4MB 3BBCA 2RKIB 3MPUB 3NY0A 5DETA 5IT0A 2KJVA 3BV8A 4EI2A 1LXJA 1RA6A 1HNVA 1QD1A 2ZHBA 2RS8A 1S6PB 1RWVB 4LRDA 4UOHA 1IQTA 3PO5A 2Z2MA 1M5VC 1MLAA 3GTYX 2CQCA 2P5VA 3O1LA 1RCXB 4UF4A 1X5TA 4MAKA 2H3EB 2Z4PA 1C0UB 5K8PA 5E0OA 3JQKA 2AYMA 2IJNA 2DCLA 2CZ9A 2WW8A 3DI6B 3M1VA 2NPFA 2XLKA 4DX8H 4J9RA 1I5OB 1IWGA 3O5TB 3JXOA 4RNMA 3VKRA 4MYTA 3CW2C 4KH0B 1IWAA 3IN5A 2QLWA 2WRMA 2YPZA 5ADZA 1SL0A 2NXNA 2N82B 4M63A 2WSEC 3DXBA 1BE4A 2GO9A 5HN0A 2HW3A 1KOHA 4HI2A 4DR5J 2AHOB 2XY6A 3M2UA 4I6AA 3HPOA 5A0YB 2OEMA 1T9VA 1XEZA 2YNIA 2HHXA 2GHWA 5A8RA 3MR5A 3GSIA 2HHVA 4FXDA 4OMFG 3LGNA 2J9CA 2O67A 4GVBA 3BDEA 3VLYA 1RTDA 1TKXA 1JLBB 4TY8B 1FERA 5D0EA 4NWBA 4QPTA 1RT6B 3CEDA 3KUHA 5B7WA 5CYJA 1HBUB 2GHPA 2V4JB 2VJVA 2W8LA 2AYBA 5HJYA 2JLGA 4QR1A 2I6WA 4DU8A 2CPJA 2EFPA 2QZ8A 3QZ8A 2VV5A 3IRXA 4DV6J 5KG6A 1J5OB 1KHVA 2RRNA 4CLUA 3MPDA 1FRLA 1S72S 4K59A 4ICLA 2F5GA 2HQCA 2AJ1A 1G1XA 3M9MB 3ZZRA 3PJXA 1VRUA 3LGMA 3OQ2A 4CI0B 1RTIA 4X65F 3KLIB 2HS4A 1FO1A 2JEIA 4CO1A 3NEKA 1DLOA 3AQPA 4OYMA 3NGSA 5L9XA 3W7BA 5EWEA 2YWFA 2E9RX 2LXIA 3IBFB 4Y2MA 3PR4A 3GP9A 4P73A 2B4VA 5T7LA 4RW6B 3N4WA 1E6YA 5AOPA 4TKTA 4OZ1A 2VIHA 1TK5A 2BMBA 4ECZA 4USHA 3UD5A 3BKUA 1S1WA 1UW9A 3DRPA 3SDEB 3A4TA 2AP6A 1RLDA 2RF2A 3PJWA 3OFFA 3W5ZA 4KE5A 2WONB 2O1PA 5CXTA 2V8DA 5DG7A 4CDIA 1CPZA 1P6TA 4I7FB 2QA4S 3TVKA 5HROB 3PX6A 3TAMA 4IOBA 1XR7A 2MHNA 1RHJB 2NR0A 2GVDA 2I1RA 3CO9A 1G7CB 2CVEA 3TARA 5H9EJ 4L3NA 2CQIA 3KLFA 3MM6B 4ZPTR 5CYMB 5HVFA 1SH2A 4ZA1A 3VZIA 2C3PA 5GAEI 1IBLJ 3N5FA 3A3NB 4C8KA 2VJUA 2YNHA 1F5AA 1I51B 3DOMB 5KG5A 3B0NA 2IDLA 1K8AT 1WI6A 4M95A 1MWZA 2VQEJ 4EO8A 5C2CA 4QWEA 3CWJA 3PYGA 4HH1A 2IVFB 5E3AA 1NH8A 3DOLA 6FD1A 3I32A 1RTJA 4EFAC 3TEGA 2XS5A 3B6BA 1KNZA 2CJBA 3CJQA 1HNVB 3VHQA 1HPZB 5J2NB 4RUAA 5E33A 3QYYA 1RA7A 2YVSA 1NJXA 4EWTA 4ZN3A 3OBIA 4DV4J 1I1GA 2BQUA 3CB4A 5C2GA 5KFXA 2DISA 1HI8A 3MM7A 4WZQA 4KRWA 3ETOA 4JYAF 2BE9B 3TAPA 1VFJA 1SH3A 1FFSB 3BQ1A 5ITHA 4F26A 1G3OA 3P6YC 5BYQA 1P8GA 3P4UB 1NLKL 1RWXB 2A2CA 2IYGA 4RNNA 4QU6A 4MMOA 2E66A 2CJXB 1RACB 2JLFA 1JLGA 4OHVA 2E5GA 4G38A 2B43A 2MPUA 2CNKB 5DDOC 1X5OA 4C2MA 4UZBA 2R7VA 1NO8A 3M2UB 4X84A 4ER8A 1VI7A 3SV4A 4WFBQ 4QWCA 2J9DE 3FCVA 3G82B 2ALZA 3OTDA 2YNIB 5L1LA 3OFGA 3OR2A 5A8RB 2FHOB 4ZVOB 4YR3A 1P1LA 5KG0A 4DR6J 3RB6A 3U1MA 3DGVA 2OJ3A 1NUEA 2ZVIA 1TKXB 2UXBJ 3OJUA 1OSCA 3D1HA 2CQ1A 4PXDA 2V2ZA 3TJ9A 2OI2A 3MAHA 1FRHA 5M2UA 2YX7A 2DHSA 3CJSA 1XWLA 3EPIA 2XCPA 1EAYC 3U7JA 3PZPA 2V2VA 1TAQA 1NDPA 1Z2ZA 1VCTA 1PO6A 3KKFA 5J2PA 1PIEA 1BQMA 3AHPA 1LKZA 3DRRB 3ILJA 3K2YA 4ICLB 1KN6A 2M8HA 2YKOA 3CIZA 3BS9A 1UVIA 1NSAA 4UW2A 3QFHA 2CPZA 1D1UA 1SKSA 3Q8PB 1KTVA 3VCDA 4IH5A 3MDFA 1DLOB 1WG4A 5C42A 4GO7X 4QIFA 5D77A 2G13A 3TX0A 4B3SJ 1W7WA 2AYGA 3JTPA 5T7LB 5KFVA 3TW0A 1E6YB 3PW7A 1FDNA 4O4GA 4Z37A 2W9CA 1NCLA 4ED8A 3D0IE 3C66A 3Q8VA 4DFKA 2KT3A 1S1WB 4LFBF 4ZLNA 2NYIA 4ZMMA 1QVFR 1XMOJ 3EGZA 3HZEA 2ZNZA 2BKOA 2RRBA 5J1PA 4AL7A 2RF2B 4DQQA 4GO5X 1M5HA 3D7SB 4K8RA 2DYAA 2DITA 1V5VA 4F4YA 1UWBA 2DK2A 3D6TB 5DQHA 4ITSA 5KT5A 2HS0A 1T03B 1DJ0A 2U2FA 2BANB 3FBCA 5HL7Q 2MQMA 2WK4A 4ZIWA 2GVDB 3G86A 3KLHB 4KHMA 3HFVA 1W26A 4ID8A 4NCBA 4G6VB 1UFKA 1C4CA 3KLFB 1WC3A 2OTLS 4HTIA 1X4EA 3BGUA 1Q8IA 2HURA 2KJWA 2VBXA 1S1XB 2BRKA 2W01A 3K17A 3AFGA 2HNYA 2YNHB 1GMWA 3IR6B 1U1OA 4GEPA 3RJMB 3A12A 4BWJA 2V5HG 1CS4A 5JXSA 4N56A 1X0PA 3FKBA 2NXJA 1LXNA 2V0NA 2WBMA 2AWZA 1OPZA 3FUYA 2RDJA 3DOLB 2CXEA 1B0TA 1RTJB 4A8MP 3JYTA 4WKYA 2E5LF 1VQ4S 1G4CA 3RRHA 3AOPA 1RWWB 2FJAB 1R43A 4PAAA 4Z7YA 5ETMA 3F73A 1IBCB 5EX0A 3MM7B 1HHTP 1PKUA 1KEKA 2RDIA 2IM2A 3OD2A 4A8YA 2EKYA 3SQGA 4F7VA 4ZPCA 3G4SS 3W5YA 3H40A 2QT7A 2CJKA 1MN7A 1ZZNA 1IN0A 1XK8A 3GQCA 3B4MA 2J0QD 4QYRA 1RT4A 2ABYA 4WFAQ 2MKCA 5IOLA 3FDSA 4FBTA 2M7SA 3Q83A 3ZTSA 2KG0A 4GKJJ 2C2EA 2A18A 2NLWA 4DV0F 3UN3A 2EWHA 4KO0A 1AA1B 2KVQE 2Y1RI 1RT7A 4X4RA 3KG4A 2C22A 3OR2B 4FPIA 1NHVA 3BPDA 4ILMA 1K0TA 1FVQA 2BJ8A 3P3DA 2RDDA 2DPIA 3EPGA 1D8ZA 4C0HA 2ZKTA 2H65B 5KFFA 2VUGA 4RWWA 4O3NA 2WCXA 4C0BA 2HBZB 3F44A 3RAXA 1TKZB 1WKLA 1T9UA 5AE3A 3TZWA 4JI0J 4DV3J 2CQGA 1HYSA 4HR2A 4CLPA 5J2PB 2JFDA 3V5RA 1F6TA 2BQ3A 1B99A 1ICEB 3OHBA 3EUNA 4DN9A 1JQGA 1HR0J 2KRRA 2RJZA 3G9CA 4ETXA 1VIOA 4QIEA 4WPAA 4RW4B 4IFVA 4FYDA 1VBZA 1S7HA 5K8MA 3KNGA 1NSPA 2F9DA 3W62A 1ACMB 3T1HJ 1FJGJ 3HHDA 4LF4F 3BKFA 2Y1LB 4OFZA 4O4GB 5IT4A 1CEZA 2H5EA 4I2PA 1KQFB 1VQ9S 4U6PA 4MKAA 2VB6A 3O8WA 4TNOA 3KHHA 1NKEA 2QLXA 2UVVA 3N9UC 4NCAA 4P9SA 3GIJA 4FKXA 2FYXA 1H3DA 2KDOA 1P27B 3CMQA 4FVCA 4N41A 3T19A 2VICA 5F9LA 2HHPA 3CJRA 2JRSA 4QR0A 4YR0A 3L7OA 4BBYA 5KG2A 1HARA 1UWBB 2KTQA 2MLYA 1KWMA 2K7JA 4P72A 1NEEA 3MFHA 3UD3P 4NMLA 4DR2J 3MOJB 3Q8SB 1RISA 2VA3A 2ZD1A 1OSDA 4O3OA 3AB2B 2HHTA 4M5LA 4DL0C 2VFRA 3ILIA 3KYLA 3T5LA 4MIBA 1T0TV 4F4WA 2VONA 4A8KA 2NXCA 1N5TA 2MJUA 4PQUA 4C8MA 3GJQB 2HNYB 1R8HA 1CS4B 1JLCA 3JS9A 1BGXT 1SQEA 2UXCJ 2E5JA 4PYAA 1N4LA 4LF5J 4I68A 2Y8WA 2MZ1A 2CFXA 3HVRA 2DGSA 2H5JB 2XMVA 2BJ3A 1U6BA 1BWEA 3JAMY 3G71S 5L39A 2NZCA 1FRXA 1D9FA 4FP9A 5CQGA 2DCUB 2HFUA 3UVJA 3P96A 1S4FA 1S1VA 2CG8A 3SQGB 2EG2A 5IS2A 1IJFB 1JKHA 1NPKA 1TZ0A 3F41A 4LSNA 3TUZC 2HKEA 1S5ZA 4B9SA 2AKWB 2XG8A 3VTIA 2MSSA 3MOZA 5L38A 1PCAA 4USWA 2XM3A 2HQ3A 2GV1A 2G2OA 1SL2A 1RBOB 4C3KA 2KM8C 2ZBQA 1RAAB 3KLVA 5GAHU 4HHHA 1HBOA 3POTA 4OX9F 3THTA 2ZJPQ 1N5YA 1W2BR 4F2SA 1S57A 2B9XA 2CRLA 4GC7A 3G8QA 1DZ5A 3UCUP 2QYGA 4ANCA 2IPOB 1P9YA 3RTVA 3VKPA 4J5OA 4J9VA 2DXEA 2V50A 3FZBA 2VQFJ 4ANEA 1CJKA 3NP5A 4AL6A 5LT5A 1UP1A 4UOCA 1RWPB 2B6AA 2QC3A 3LW5C 2WBRA 5H9EK 2ASYA 1DURA 2HBQB 2ERRA 2JEJA 1J27A 3CXCR 1YK9A 4TN2A 2GMLA 4MKBA 1GX5A 1XBWA 2OH2A 1SKWA 4ES2A 4BLGA 5L46A 2FJDB 3FEZA 3SCIE 4DPYA 1SJ3P 3FBFA 3R7SB 2DEIA 1HBNB 3H90A 2FZCB 3W66A 3C16A 1O5JA 2AU0A 4IFVB 3VR1A 4DR5F 3VM1A 4CNYA 1WTBA 1AFIA 4CRJA 2OMOA 3LH2S 1REGX 3IA0A 5E5NA 1N6QA 3M8SA 3A13A 4G39A 2MKHA 3OJSA 2QN6B 5KFHA 3R2CJ 3OL6A 4ZPDA 1LK5A 2E1RA 4I2PB 1KC8T 4DI6A 3QPIA 1X0FA 4XIUA 3MMBA 4ED4A 2MZSA 3QO9A 4RUHA 1VQ6S 4FZVA 5I42A 2YNFA 5IT9U 2W25A 3T1AA 4RUBA 2KH9A 4C8OA 1S99A 3E01A 5CD4H 1Q1KA 2XULA 2R7UA 2DH8A 6GEPA 3HVAA 1EARA 4DV6F 5G4DA 2ZD1B 3K5MA 5HBMA 1T3NA 4WZMA 1U2CA 2HS3A 3R5DA 3WIVA 2R3VA 2CA9A 3O3LA 1FD8A 2OO4A 3FMWA 3G6YA 1RU1A 2DO0A 2J76E 1DHMA 1WACA 2ZOMA 1JLCB 2E9ZA 3FSIA 1KDNA 2J7UA 4DL7A 2ZZNA 1LWFA 3OTOJ 1FF2A 3D54A 4U9RA 1LW0B 3OL8A 4TYBA 3R8YA 2MQPA 3WHIA 1YJNS 3NG8A 1YI2S 2D74B 4YB6A 4DUYJ 3HSDA 3QWPA 1UJ6A 1FXLA 3UVJB 3GONA 3FEYB 4ZIVA 2APOA 1WOSA 3ETMA 5LJ3Y 4LSNB 4F3MA 1WHVA 4ANDA 1N52B 3ENVA 2KKHA 2CQHA 2JJ4D 4NLYA 1RHRB 3SMZA 4OYAA 3R9LA 1YDLA 1JLEA 1FFGB 5ETRA 1V3RA 4CO0A 1EQ0A 3DYAA 3CDUA 3KLGA 3ISND 4DPTA 1IBLF 1Q8KA 2G1HA 2RS2A 4XPEA 4QWBA 5DM7Q 1N5YB 1SC1B 3HX9A 4X62F 2W2PP 3HD1A 3H98A 1NXIA 3D1QA 3O6QA 1N5QA 2VFUA 5LMNJ 1RJJA 1B4SA 2CAJA 2ZJQQ 1CJKB 4HHUA 3BDPA 2Z58B 4I0WA 4R0EA 5L8RC 4KGZB 4DV4F 3GEOA 4K0KF 3MR2A 2L9DA 4QZVB 2G0JA 2HZAA 3LTOA 2ASJA 2V2KA 4DG1A 3I96A 1KTQA 3W2VB 2JLEA 2YX4A 3SV3A 2PMHA 1AUSL 1FWKA 2K06A 2W2QP 2RQCA 3AJ1A 3HHLA 2V4QA 3RBEA 3MEGB 2VDIA 3LP0B 3FK4A 3PKYA 4AYBD 2XMTA 4WP8A 1XQIA 3CJTA 2E44A 3HLUA 1KR4A 4DR6F 4LF2A 5KFNA 2IYIA 1XJWB 3PR5B 2KU7A 2DH9A 1ZJ9A 3OL9A 5GAGU 2AJQA 4BDPA 5DDRC 1SKRA 3MMBB 2AX0A 4W90B 4ECTA 3GR1A 4AQYJ 3DLKB 5I42B 5GAHI 1X4BA 2JSXA 1U48A 4S0MA 4CTAB 2H48B 3C6TA 2CWXA 4ED1A 3VAFA 3K89A 5GADU 3BREA 1ZPVA 2YWWA 2Z2ZA 2RU3A 2MLZA 4ELTA 4F0MA 2PEHA 4L75A 4LRFA 1RWKB 1IR1A 3C2PA 1U1QA 1IUJA 2XB2D 5HBMB 1Y00A 2VG6A 1VQ8S 1Q81T 1QLNA 4TXSA 2FDNA 3OLBA 4JI5J 4OI2A 2YWGA 3ZTPA 4NLWA 2BE7D 3PYEA 2GNKA 2HVZA 3T5JA 1YSJA 4B3SF 2CQ2A 3WC0A 1SKUB 1S6UA 1VRTA 2CVIA 2VC1A 2GFFA 4URGA 4DX7A 2IIHA 1C1BA 3PIOQ 1H0HB 3QRPA 2ZOFA 4DMZA 2XMUA 3S7RA 2L41A 2C3YA 3DGPB 1LWFB 2XSJB 2OAUA 2O01C 3QZ7A 3JQJA 1KFSA 2XMJA 4MK7A 4MYUA 4K4ZA 1FDBA 3Q22A 1XMOF 3L4BC 3ZTQA 4BCAA 3RB4A 2MQQA 3W9HA 4JV2A 2XZDB 1HKAA 5B08A 4LT6A 1BY9A 3ZZZA 1WI8A 2QLJB 3NCPA 4ES3A 3BH7B 3IM9A 1R0AB 2C2KB 5HLFA 2E7WA 2OFGX 4PABA 1JLEB 2QE5A 1F1BB 4N47A 2J0WA 4KGMA 3KLGB 3SBMA 3BKTA 5D4NA 4PUOB 4Z2XA 2HHUA 4IFYA 2GO8A 1F3VA 4OJGA 1N32J 3EJMA 4YP3A 3T3FA 3G96A 4WFZA 4XDCA 3LWLA 7GEPA 3PEHA 3AXMA 3FFIA 1OPIA 3GJRB 2HFSA 1W2IA 4X4UA 3A3OB 2FLPA 3IXQA 4NLXA 4Q0BB 1TK0A 4WJBA 4RKUC 4TQSA 4A8XA 4DF8A 3QGPA 1VBXA 2C2OB 4OLPA 2VOPA 4H4KA 3SEOA 2LU2A 3D4JA 5DG9A 3SYZA 5ETOA 2OEJA 1JWWA 4PXBA 3ONQA 2LA4A 3W8GA 2BJ1A 4NEZA 4ZVHA 2ACYA 3HHLB 4M5MA 1RWMB 5KT4A 5I3QA 4GKJF 2JHEA 3UPFA 2HMIA 1MROA 3NS7B 4EO6A 2UU9J 3Q86A 3ZZOA 1X60A 3N6MA 5DQGA 1KVIA 1H7XA 3M9NB 2YKPA 2Q6BA 4DSKA 2OHDA 2ZH5A 2AEJA 2BJDA 3QT5A 4C9DA 4RUCA 2CPEA 2FZKB 1U0HA 4URSA 4X66J 2VPYB 4RBUA 2PI4A 1CJTA 4UUXA 5C24A 2VFSA 1TL4A 3RUBL 3R7NB 3ET6A 2V8HA 1IR0A 4DUZJ 3C6TB 3MR3A 3CCZA 2DRBA 3BPSP 1UPMB 1RXOB 2YPYA 4ENOA 4TQRA 2HHHJ 4JI0F 4DV3F 4ZVFA 4ZCMA 1VR6A 2E1PA 3MXHP 3RR7A 1BXNA 3M2RA 1NK7A 1HR0F 4HT7A 5KFEA 2VG6B 3R2DJ 4OYXA 1UVNA 3DDNA 2LDIA 2CJQA 4MIWA 1K9MT 1YZ7A 3DLLQ 1HA1A 2BE2A 1VRTB 3T1HF 3QFWA 1FJGF 2CKWA 4B9LA 1C1BB 5DLFA 3SIPB 1QE1A 4OHXA 3BGRA 3CJ0A 1F3FA 2CQ4A 1M1HA 2B5JA 2HYIB 2YKMA 3B82A 3PDNA 1T05A 1X7VA 4KY3A 2E1CA 1SV5A 4OX8A 3CCMS 2GS8A 5IV3A 4K5RA 1F5BA 1R8BA 2PD1A 4UY8T 4V19X 1AZSA 4CQ1A 4JOUA 3CD7A 1JJCB 5IC6B 4WK3A 2IMWP 3CJKA 4ZN1A 2V8PA 5HJXA 4QCLA 3I82A 4FXVA 1ZA1B 4B3OA 4DR2F 2EC0A 1MMDA 3DM2A 5GAGI 2FVSA 1FRKA 4X65J 2F9JA 3HHNB 4ED3A 2LQ5A 3HF5A 5HLFB 4UOGA 2AEMA 3OR1A 4DL3A 5IM0A 3VKQA 3DRSB 3W9IA 4YQWA 2R8KA 5E3QA 3KK3A 1BC6A 2ATLA 3HD2A 4IG3B 2ROEA 2JOQA 1Q8LA 2EK1A 3CCTA 3M32A 2OFHX 3BYRA 1ZH5A 4EYIB 4YOEA 2NREA 1NK8A 2UXCF 2KYXA 2VG5A 1TV6B 2MKJA 4LF8J 4LSLA 3CPWR 2HRTA 4PWWA 4C8ZA 3LGHA 2FVRA 2F8HA 4CLTA 3PTWA 4Y2IA 3IAS9 2JL9A 1RT3B 2XEXA 3ENQA 1C0TB 2DHGA 2QMWA 2GQQA 1JLAA 2DHAA 3TA1A 1HNIB 3VGTA 4O0NA 2F40A 2QMUB 4IQXA 1NMEB 4FBUA 2J6UA 4YY3J 5T14A 8RUCA 2PO4A 3MCSA 1T9WA 3NOCA 3CDEA 4M5NA 1U7LA 1JX4A 1T8EA 3SSQA 1MROB 2DPJA 3JSYA 3UN5A 3DLBA 4HH0A 1GQEA 4A8OA 2I5JA 1Q7YT 3K58A 3RZAA 1U0HB 1YJVA 4DZ6A 3MD1A 1CQNA 2D3O1 2W4CA 2VQFF 1H2UX 3TVZA 5C24B 2QA2A 5KFMA 4YB5A 4DPWA 3RAMA 4NLOA 4U8VA 5B0FA 4KR0B 4IO1A 1KOOA 3KHGA 2CQ3A 2HK3A 4RLEA 3S1TA 2K1RA 3M2VA 1TTHB 3N6NA 1T94A 4ZVSB 3CDAA 1S0MA 3U02A 2VHGA 4RJVA 1TL3B 2F4FA 1FTRA 4OZJA 2DY1A 1BD6A 2HHWA 3AOBA 5LM7E 2UVRA 1QAXA 1WSVA 4XDDA 4OHZA 2I38A 1ZA2B 1PBAA 3EDRB 1GFWB 3KK2A 4DOZA 2HZCA 2XLIA 2ZC4A 3GCXP 3RRKA 2WOMA 3UDVA 4J9KA 1MW7A 4JBCA 2NQPA 3R5AA 2RUGA 4B02A 3OVSA 2FLNA 1KRPA 4WK1A 3ISNC 4J9PA 2X1BA 1N5VA 2DJWA 3MTKA 1HI0P 1SPBP 4FYVB 5GEPA 1LWXA 2HG4A 4I2QB 5F41A 2YKMB 3BN7A 4J9MA 1SV5B 2MQNA 2DTJA 1NU4A 3DHXA 1NH7A 3P45B 3GMGA 2IJRA 1VQYA 5LOQA 4O3RA 3H7HB 4I56A 1JJ4A 3D5MA 3KUEA 3VAJA 3R6GB 4F0KA 1AZSB 1ZOTA 2HFVA 1VIXA 4PWDA 2ZH1A 3HHLD 1VQ7S 4KGVB 3E8OA 2SXLA 3I55S 4DSFA 3I9V9 4Y2KA 3KLEA 3KDNA 3DM2B 3DLHA 5G0RA 3FRYA 5A76A 4B9NA 3X3UA 1SH0A 3DDIA 4UQGA 4ZP7A 3OR1B 1WOPA 3KHRA 3H8YA 1VDHA 1R89A 2XMMA 1EETA 2BV3A 1U02A 4I6WA 1EKSA 3KK3B 2DNLA 3V4IA 1FEEA 2OPPA 3BH6B 1NHUA 2HHQA 1YKWA 3M32B 4LREA 5J1EB 2PDAA 2YQ3A 2COLA 4LFBJ 1SQGA 3OSNA 2IA6A 2VG5B 3OTOF 4DN0A 4LSLB 2OKQA 2F7VA 3T41A 5KFJA 2KFYA 4X4SA 1FRJA 4ED7A 3KTQA 1G6BA 3BGOP 4DUYF 3AJ2A 5FLXU 4ZJOA 2WVBA 4NA3A 4NI2A 3OHAA 3C6UA 3MMAB 3L7PA 4K4SA 2ZVSA 4K4XA 3BEGB 2NXUA 1KD1T 2W8KA 5HVGA 5JVGQ 2Y1JA 5EHHA 1T9TA 2BM0A 2M8DB 1K1SA 3AODA 4USKA 2ZKUA 5EUHA 4DR1J 4ZHRB 3OXGA 3MUMP 2J8SA 1YIJS 2KXFA 1LW2B 3A1YG 4OV1A 2HNZA 2C2MB 5E7OB 2EBEA 2J8AA 4P7VA 3MHYA 2AV5A 4MT1A 4RW7A 4KBIA 1HWJA 5KFQA 3MF5A 3EX7B 1KQSR 2I9SA 3MI7X 3ZNJ1 1S49A 1XERA 2F63A 2RU9A 2I5JB 1RTHB 3PACA 3LP2A 3GR0A 5LMNF 3CC7S 2MEWA 3TYTA 2K2PA 3H4BA 2JC0A 7FDRA 2KHCA 2YH1A 1X4DA 1JLQB 4WWSA 3E3XA 1D9DA 4CH0S 3VQTA 3RB0A 2G9OA 3WIUA 4J9QA 2KZZA 3M30A 3NCQA 4C98A 2K1RB 5KFLA 4O4RA 4TU9A 4GVLA 1SUQA 2IMOA 1L3VA 4MFBA 5F3TA 4ZPVR 5D3GA 2QG9B 2XZWA 2BR0A 1CJVA 1RGVA 1PYSB 2FGCA 3CE8A 1RT2A 4DV0J 5IQ6A 1VOMA 3AT1B 3KK2B 1TL7A 3NLCA 1HWIA 2YXLA 4MIAA 4M5DA 1KVKA 2RIJA 2VPZB 3AXKA 4P7TA 4CT9A 5EGYA 4NRTA 4H4MA 4HDHA 7FD1A 4O3SA 4DX5A 1T11A 3THPA 2RAQA 1PSDA 2QFJA 1RB0A 2IJFA 5EWFA 1SJ4P 1K0VA 1FWLA 1YGYA 1YJUA 3PYFA 2BRLA 3QIDA 1VQMS 4B08A 1R6VA 2HLTA 3PV8A 3KNAA 4UTGA 4K2JA 3KG0A 1R27B 4Y2CA 2QV6A 4WXWA 1VHFA 1C0UA 4AQYF 3MM8A 1M5KC 4DLGA 3V6HA 3H42A 2HRUA 3KOAA 1S59A 2LA6A 4RW9A 4EEYA 1XIQA 4PWDB 3EM1A 4HT5A 3OVBA 3MECA 3UDLA 1WG5A 2DGVA 3KLEB 5G0RB 4YFUA 2ZEJA 1X31C 3GIMA 1HHQA 1J5EJ 4S39A 1VYAA 3J7AN 4Q43A 2ZH2A 4DR3J 4ED6A 5F8HA 5RUBA 1O8BA 3TZXA 4JI5F 3I5BA 1F9HA 1EETB 2V8GA 3UCZP 2EW9A 3PRDA 3V4IB 2OPPB 3VLZA 2VASA 2YBVA 5GVQA 3TANA 1NK9A 4QIWD 4CO5A 3VKSA 4P6QA 1JLBA 3N01A 4NCGA 2AJ0A 1DQ9A 2LCWA 4EZ6A 2B4PA 4A8SA 1S79A 1RT6A 3QJJA 5KOWA 1HWLA 3H0PA 4KIAA 4PRFA 1GAOA 4OIXA 2HQGA 3M6WA 3BQ0A 3D2WA 4NI2B 1LFWA 1J5OA 2MGZA 4J90A 4IR1A 3C6UB 2YH0A 2RQMA 1S1TA 1TL1A 2AZ3A 1KLMA 3RW7A 1SCJB 1B0VA 1OQ3A 4Q45A 2YX1A 3C14A 3WBZA 1U8WA 1NDCA 3GU0A 1HWKA 2V69A 1PG5B 4N77A 2JEGA 1VQNS 1NDLA 5HO4A 3J7ZT 3MM5A 1EZZB 3MAAB 1FI4A 3ICLA 2UUTA 4RW7B 1F5CA 2MY8A 1N32F 4FN5A 4Q7AA 2VG7B 5KT6A 4FS1A 3EVMA 3HCXA 3W2WB 2LQ8A 2YWKA 1WC0A 2AEFA 5CABA 3LP2B 5A2QY 5L9NA 2K7KA 3HKWA 4ZVRB 2CPDA 2Q3PA 4KB7A 3VAKA 1WHYA 3CMAS 4DFMA 4OI4A 4NEYA 2XYGB 4WIIA 2DNHA 2PMWA 4X4NA 3HMJG 2HAIA 3M8PA 3ZXWA 1FKPA 2XS2A 3HO1A 3M30B 5HROA 2MB0B 5FLXY 5KT3A 4L74A 1SUQB 4KHPJ 5E41A 1SIWB 1KQKA 4MFBB 1TFWA 1F0XA 5D3GB 4IKAA 4LFAJ 3US5A 1CJVB 1QSYA 1UEUA 1B70B 2ZFHA 2U1AA 1OQ6A 3NAIA 4J9SA 4DV1J 1MNEA 3DC2A 1MU2A 1TL7B 2WVCA 4RU2A 4ELUA 2KXHA 3DCAA 1Q5YA 4O44A 2UU9F 2DNGA 3RR8A 5GMKa 2DIVA 3HI9A 1JXVA 2DGTA 1Y10A 2FD2A 1PILA 1HPZA 5J2NA 5CHCB 1H73A 3CCQS 4DQIA 4X66F 4NXNJ 2O66A 4YEAA 3I9ZA 1LWEA 1GTEA 4PXCA 3LUYA 3MM8B 1FRIA 1KHWA 4DUZF 3DKDA 4RW9B 4AL5A 1FFWB 2CPXA 3MPYA 1NK5A 2BKPA 1F9FA 2BW2A 4PG5A 3I4HX 5LSRA 3MECB 3QMQA 2HHHF 1RSCA 2W1BA 2XHCA 2H5IB 1URRA 4IQMA 3ZZUA 3IBCB 2C28A 3ZC4A 4DLEA 4I67A 2FC8A 3PW5A 2Y8YA 3H2UB 1DY3A 3KXDA 4ED0A 4BHQA 3G82A 2BA9A 2N3LA 3D67A 4ECVA 1D3WA 1JJHA 3M8ZA 4CLFA 4ZVTB 1CC8A 3M05A 1R3NA 2DNKA 1YBAA 2G2ZA 4NCGB 4EBDA 3QSIA 1U1NA 3KUGA 4GKKF 3QGGA 3H4DA 3EXYA 1KKHA 1Q8BA 1S6QA 3S01A 3VALA 3QQCD 1XMQJ 1YZ6A 3PVXA 2EEYA 4ZOSA 2OSQA 2MGZB 2XO6A 4FF3A 1EX8A 3DRRA 2J0XA 1S1TB 4LR9A 1TL1B 2QJ3A 4JI8J 1NB2A 2DNPA 4C8LA 1KLMB 3M6UA 2BOAA 3AA9A 3TJ8A 2ZC3A 3HFZB 3UR3C 5HANA 3C14B 4NL5A 3J81U 1NJYA 5KFZA 2BZ2A 1RYSA 4KSEB 3OT9A 5F0WA 3DOKA 1E6VB 3O2IA 3MM5B 1NSKL 2FHJD 2ZH6A 2UXDF 2MKSA 2MZTA 3P49B 4MJKA 3OUYB 2HVIA 3DLGA 1ELOA 1YJ9S 2MKKA 4PG7A 2MDAA 2D3OR 4TYAA 4LF8F 3RB3A 1XMBA 4H4OB 1FHTA 4EU0A 3IP0A 3ZTRA 1TL5A 4LF1A 3PW4A 1YWXA 3WC2A 4K4TA 3M8PB 1FKPB 2C3OA 4TU7A 4DPXA 3S8SA 2AJ4A 1T03A 2BANA 3ZZTA 1IKYB 5KOXA 2CQBA 3D9BA 1XNQJ 1OYDA 1R8CA 2XHWA 1YHQS 3FZ2A 1Q7LB 2ZUGA 3KLHA 1HNXJ 1HQEB 3QLHA 2IDEA 3MWBA 5DRKA 1TKTA 2R7TA 2ZH8A 4YY3F 1S1XA 1LOUA 2DNZA 3ISZA 3HK2A 1MU2B 4ECWA 2LP4A 4J9OA 1BQXA 2X1GA 4O44B 4X62J 3KJFB 3GV8B 1U26A 4ZVGA 3PIPQ 1M1KT 4ECQA 2PN6A 3J7YU 1R8PA 2UVUA 1HI1A 4AFFA 4USVA 1URNA 2VBZA 2ILZA 3GIRA 1ITPA 1LWEB 4K0KJ 5K20B 2YY3A 2XCAA 1KONA 3TQ1A 1S48A 4WP3A 4YMEA 2XY7A 5JVHQ 1L5UA 3BN4A 4DV5J 4ZVPB 4JI1F 1U09A 2FY8A 3NNCA 3NMAA 3KJVB 2HWIA 2OTJS 4U96A 2LU1A 4J9LA 2BUNA 2PFDA 1N48A 1S6OA 1FJEB 4RWXA 3OFEA 5AXKA 2OPRB 3K0JA 2GW8A 3QIPA 5KG4A 4P75A 1HNWF 4ZITA 5CA5A 3DN9A 2HIQA 3SFGA 3ZZ0A 2XO7A 4PG4A 1U1RA 1WG1A 4NYPA 2P9CA 3KK1A 4P2XA 2L08A 1S6QB 2HFZA 4F2RA 3MCMA 1RHKB 5B0BA 1TKZA 3EGVA 3NOYA 5D0GA 3FCHA 1MWQA 1AROP 2QLFB 3EGWB 2XWXA 3EVOA 3FEXB 5E2QA 2DNOA 3BBFA 2FVCA 4UZCA 1HL6A 4WBFA 1S77D 3NS6A 4ZKAA 3FSYA 1UA0A 2BX6A 4DL5A 3NNAA 4RW4A 5CAAA 1LWCA 2FGOA 4LIRA 2W7OA 2MZRA 3IC1A 1TUWA 2RMLA 3NKYA 3PCOB 2KHDA 2Y0FA 3DOKB 2HQDA 4CO2A 4OX6A 2QL7B 4CO3A 1MMLA 3NNHA 2BABA 1FDAA 3R7BB 3C3LA 2A3JA 3V6KA 3JAMU 2XGQA 3DLGB 2NCKL 2W7PA 4LQ3A 3BSOA 4ZP6A 4HI1A 1DARA 1RAHB 2W2MP 3R5CA 4I6YA 4CP5A 1FNXH 3V81B 3HVWA 4PCQA 2Q66A 5HMXA 5ETSA 5F8IA 1YQHA 4FKYA 2ZHAA 3GG1A 3ZFVA 2G2YA 4H4KC 1Q16B 4NLVA 3K59A 4FF4A 5DQIA 1KS2A 3UNYA 3ZTOA 2OPSB 3QLHB 3CCJS 4KHRA 4F02A 3HSGA 4NOHA 1TKTB 1FXDA 4B3MF 2M3DA 3MD3A 2R9LA 3RBZA 1P9QC 3J81Y 2DGWA 2VBYA 4DR1F 5E3PA 1DRZA 3TR5A 1RI7A 1RLCL 4F8RA 3I31A 8GEPA 2LECA 4W98A 2FJEB 4LBPA 4S3EA 4MK8A 5I3PA 2FPHX 2F4VF 4K4VA 2EK6A 2LQJA 4K4WA 3W3SA 3A8IA 3CIMA 4PXEA 2MTLA 4DR7J 2DR6A 2RUSA 4Y28C 1QAJA 1NJZA 3H59A 5A6WA 4UQTA 3M8YA 2ATCB 4YB1P 4YHHF 2VKRA 2HWHA 3Q23A 4L72B 3K5NA 3UCGA 2ZBPA 2KRBA 5H1SV 4U7CA 4P2SA 3GFHA 2DXDA 3FBEA 4C48A 1FX2A 2QRRA 3K8VA 3PRVA 2GGPA 3GV7B 4F04B 2KXNB 3GYGA 3R97A 3GG0A 4S3AA 3TNVA 2WAQD 3WZ0A 3TUPA 2L9WA 5CCLA 3PXGa 4HTJA 1S12A 4YUDA 5HMWA 2EFOA 3GFZA 3QIPB 2Y0SD 4DV7J 1HMVA 3GSDA 4KFBA 4DL6A 3CCLS 1H2VZ 2CG4A 1CULB 3BF4A 1UFWA 4DFJA 4HYKA 1M90T 4OZ3A 2XI2A 2G0CA 5DS7A 2MKIA 3KK1B 1O6XA 3I87A 3GJSB 3G6VA 4WE1A 2HQFA 2V9WA 3PW2A 4EUVA 2BKNA 1CJUA 4WKRA 4CLYA 1JMTA 2OMLA 4C8YA 1FK9B 4ED5A 1GX6A 4QR2A 1UPPA 2C3UA 1NNDA 2UUWA 4J9NA 4CCHA 5EX3A 4ZLLA 4XK8C 4HKQA 2D3UA 2ROPA 1HBNA 3B0JA 2RQ4A 4R5PB 3TVYA 2BQRA 4KV8A 3TX8A 4F4KA 1LWCB 1J5EF 4ELVA 4E8UA 9ATCB 4DR3F 2RVJA 1CBKA 3T5HA 1RHMB 3HJVA 1VK3A 1APSA 2NUUG 2VH7A 2GX8A 1SXLA 2J7KA 2V63A 2IM1A 4NYZA 4A47A 2ZZMA 2L3MA 3QSYB 3HVTA 1FNMA 1WC1A 2UUBJ 1WC6A 2KT5A 4OLOA 3WDOA 3VGUA 4FYYB 3I0RB 3TWZA 2ZM6J 4J9UE 1Q86T 3AD7C 5HQ8A 4N7TA 4JI3J 3FVYA 3TAQA 1ZPWX 3EZUA 5KTQA 2HVEA 3WQPA 3T9NA 1HQUB 1S9FA 3LALA 4IH6A 2OUGA 3OXLA 2L48A 3C19A 3CD0A 1JK9B 2CPFA 2YKQA 3TA0A 4BC7A 4USIA 4ERDA 1R0BG 4F3OA 2Z2YB 3N28A 2XYHB 4ECSA 1IBMJ 4H54A 3AB4B 1LW0A 5AE1A 2B7CB 3IWLA 5KFYA 1DQAA 2AKJA 4KAIA 3TUJC 1WHXA 5L1IA 3HULA 1SBRA 4AT1B 5F8GA 1TP7A 2NUHA 5B09A 2EG1A 3CJ4A 6AT1B 4TVAB 4B3RF 3D6MB 3I6PA 4BS2A 2DXFA 4M5GA 5M2RA 3OTEA 2HVDA 1VRQC 5HQLA 2GIRA 3FRZA 4LBIA 3FNNA 2BDPA 1RAJA 4ZLPA 4KHPF 2A6OA 4FF1A 4LFAF 3KG1A 2ZH9A 3I0SA 4OZ2A 5CZVA 2GGPB 2QSFA 4PQAA 2HGMA 4XPCA 5C25A 4DV1F 4V1Ak 1U6ZA 1QM9A 3MURP 1T95A 3SCKE 1DTTB 3CCSS 3Q8RB 2PIIA 3B8HA 4YDXA 2GQ2A 5F0UA 4RNFA 1HMVB 4DSJA 4KFBB 1D9AA 3DMJA 5MAOA 2ASDA 2XYPB 4YS2A 1OY9A 1K44A 4IH7A 4Z7CA 4R25A 4PWUA 1TFYA 4AD6A 2FJWA 4NXNF 3G8TA 4DSIA 4YB7A 4WE1B 2E5HA 1NB7A 1CJUB 3KHLA 2JZ5A 1RCOB 4OL8A 4CLLA 1TMMA 2HGLA 2EPIA 2F3JA 5KG7A 3C46A 2JEFA 2C2NA 4DBQA 3NGDA 5F8LA 4DEZA 2HSEB 2ZDPA 2LKZA 5T41A 3W2VA 4A8FA 2AJ2A 4OZLA 1YJWS 4KV8B 4B9VA 2HVHA 4P2MA 4ZVUB 3Q89A 1GXTA 3MEGA 4C3MA 4LRCA 3LP0A 5BYRA 5JJBA 5BXIA 3MEDA 2M88A 1ROFA 2NPIA 3AA8A 2F65A 3PRBA 1TVRA 5K8NA 2HEKA 4DS5A 1VGYA 2EFQA 4QU7A 4KYZA 4NLTA 2O3DA 4QYZJ 3HVTB 1KFDA 1NPRA 2BXJA 2BEFA 3TOQA 3DLKA 3VVTA 4E0DA 3W5XA 3FQKA 4CTAA 2X51A 2B3TB 1X5SA 2CDQA 5GMEA 5ETLA 4BC9A 3FBBA 1XMQF 3GV5B 1ZZFA 3GJTB 2C1EB 4WYWA 4OJ1A 2AGOA 4JV5J 1Z1ZA 2QTWA 4GRSA 3NS5A 2VFVA 3R1HA 5A8KA 4JI8F 2QGFB 1RAFB 2F8EX 2I0XA 2MSTA 5ETVA 1Q78A 4USMA 1QTMA 3D1OA 4Y0FA 3P5BP 2CJ9A 1RP5A 3Q2SC 4QQBA 4MKVA 2MZQA 4ATNA 5IWAF 3MUVP 3TZZA 2DEJA 2KN4A 1ULRA 3ENAA 2BBEA 2EC2A 4ECXA 4TLRA 4D3HA 4RBVA 3VGSA 2MYFA 2P2CB 3W61A 1S97A 2DR8A 2YNGB 4I1TA 5K9FA 4NLDA 3RBDA 5KFPA 4PPDA 4WYLA 3DGPA 2C2RA 2XSJA 1TR0A 5B0EA 1FESA 4MKYA 1HW9A 1S1UB 2GJ2A 2B8PA 2IM3A 3W65A 1LEOA 2PSZA 2DR5A 3OFHA 2ZITA 2LEAA 4NXMJ 2DHHA 2IAJA 3I4PA 1XR5A 4DQSA 3P5TL 2M5YA 1KQGB 2VU5A 1RKIA 1NK4A 2JH3A 1SC6A 3A8JA 1GH8A 3VAHA 2OPQB 2XQCA 1R0AA 1XNQF 3RW6A 3M8QB 2WB4A 2HGNA 1U1PA 3V6JA 1RYRA 3CC2S 1HNXF 2UP1A 3W60A 1AB8A 4LVNP 2AGQA 3I0SB 2R8JA 2M4MA 1H38A 4JI6J 5C25B 4EZ9A 2IC3B 4WP9A 4KTQA 3PEJA 5MLCV 1SJ1A 4PUOA 3X1LB 5DGBA 2HAFA 2V8VA 3OL7A 1SC3B 3DLEA 3THVA 4S38A 4QOTA 2B56A 1KP6A 2CADA 2ZH4A 2P6TA 3FQLA 1F9EB 3BYPA 3C15A 3A3PB 3QNWB 2FJVA 3N0VA 2NSBA 1CVJA 2MKYA 1S0NA 2Z56B 4EYHB 1QAYA 4OI1A 3MM9A 2QSWA 1Q0NA 2LQBA 3DMJB 2DVIA 1WHWA 3OLAA 4YDDB 1RKJA 1XNRF 4Q0BA 3Q8QB 3UW1A 2JX2A 4ZDNA 3DNCA 4O0IA 2E29A 1LFPA 3TA2A 5HVHA 2BACA 1JNZB 4ILRA 2UUCJ 1N33J 1Q4RA 5CCMA 2ZJRQ 5I3UA 2VPWB 3PKMA 4KC5A 1SB6A 3CGIA 1N0UA 4DV5F 1RADB 1FJ7A 2G1DA 1SI9A 4KPYA 1F60B 1K1QA 1XN9A 5D6GA 4KPCA 2FQQB 2QA1A 4P71A 1N8RT 3MEDB 4WIQA 1L3SA 3R3TA 1S0OA 1TVRB 1SJRA 4Y2AA 2AW0A 1M5OC 4W4MA 5K14A 2BOPA 3M8RA 3H25A 3WX8A 3M1VB 3BSAA 4CM2A 4L73A 4A8QA 3VVUA 3KMQA 4C4WA 5JUMA 3FC9A 4Y34A 1UVLA 3PM9A 1WDTA 2IRYA 2KZMA 3LOUA 1IVZA 2N7YA 5ETKA 3I56S 2R8IA 4R0JA 2GIFA 5KT2A 4TY9A 4IR9A 2ZZTA 5H9FK 3R5BA 1B7FA 3T6BA 1K73T 2CYYA 4XAKA 1GEHA 5A8KB 2JVOA 4FNIA 4GVBB 3R6LB 1RAGB 8AT1B 4LF9J 3LAKA 5A6PA 1RBLA 3HP6A 3K57A 1RTDB 5B0CA 2Q79A 2CQPA 3EZOA 4JB8B 1RAEB 1ZAVA 4URQU 3QWUA 2E5IA 2CNNB 1N0VC 4RNHA 3NAHA 4OHWA 3BJYA 4X4OA 1EIYB 2X3DA 3LP1A 4E2FB 1V3SA 4PZVA 2XS7A 3UDCA 3EYZA 3V2UC 3VAIA 3IRXB 2Y1IA 3G87A 4ZCLA 4AOPA 2VZ9A 3VQSA 2WSCC 5K5MA 5ETTA 3PX4A 3L09A 2HK2A 5D0RA 2XNQA 4ZPWR 2PA3A 1U25A 3N79A 3D0HE 3EMTA 5GMDA 3T1YJ 1VRUB 5D78A 1RTIB 1IBKJ 1WELA 3RAQA 3P8BB 4X2BA 1VHIA 2XMWA 1EP4A 3CNQP 2YKNA 2IAJB 2CDRB 4G1IA 1T3OA 4PPZA 1NRKA 1IJEB 1QAIA 3KFWX 3TZYA 3VWSA 4FPRA 3VM0A 1N36J 2ZH7A 1Y0HA 4PR6A 3FJ2A 5BYSA 4FS2A 1XTZA 1WKKA 4XTTA 3DRPB 3DRSA 1EJ7L 3CF5Q 3GPAA 2YWEA 2JC1A 4IG3A 1M1GA 2CNOB 4JV1A 3LPYA 1C4AA 2PMZD 3DLEB 3T5KA 1HQ2A 2WVDA 2GA7A 4K5SA 1H72C 5DJBA 2DHXA 3PYDA 4G3IA 1FTCA 3C15B 4F4AA 3K5PA 1WOOA 3DDKA 3RGIA 3UI3A 1TV6A 3MM9B 3TAMB 4U95A 5I4MA 4NLPA 1TUVA 5IC4B 2XLJA 1Y3KA 3I5AA 3CCVS 2KYZA 3CJ3A 5CD4A 1VLOA 4FYWB 2X3GA 4IDKA 4DR7F 1UVJA 1RT3A 1C0TA 2FJBB 4QWAA 2PI5A 5F9NA 4X4PA 2LMIA 3Q8UA 1MG7A 1UFLA 4LFCJ 5DZ6A 4CH7A 1U8SA 3CVKA 3AD9C 2LEBA 3UO0A 4HDGA 1QSLA 3IO1A 1HNIA 5I3UB 3MEKA 2MY7A 1JXLA 4B17A 1JB0C 4L3KA 2ADCA 3AOAA 2IHR1 1X5PA 2RNEA 3W63A 2GEPA 3ADAC 2K8GA 4P10A 2IA0A 3Q0AA 3QAEA 2AX1A 2PT0A 3SI8A 1U2RA 2QL9B 2ZDOA 2W7AA 4QWDA 1UEVA 1NZ8A 2D3ZA 1DBDA 1REVA 2FLOA 3BR9A 3TJAA 1PYOB 2PGCA 1PJ5A 5K14B 4C11A 1AFJA 4DV7F 2GAGC 5D15A 2RILA 2DY9A 3BR8A 1ZS6A 1N88A 4NMXA 4JP8A 5IXUA 4KT0C 1RQ0A 2HQIA 1BQNA 2MLXA 4PEOA 1SJFA 2E1MC 4ALZA 2JDJA 3QT8A 1JLGB 2D41A 3IRWP 2MQ8A 3RBXA 4EGLA 2J0SD 4RL1A 1HFEL 4ETZA 3D28A 2MMYA 1G2EA 2HIYA 2FC9A 5LMUJ 4LIWA 2CZVC 1N54B 4FF2A 4USJC 1Y5IB 4RU9A 3AD8C 1TL3A 1RE1B 3GYXB 3LAMA 2R7XA 2DNRA 1N34J 3TQEA 1SIZA 3O44A 5KFIA 3ZNUA 3MR7A 2QA4G 2IFXA 2MZJA 4WFNQ 2W9BA 3PX0A 1TUGB 5HMZA 2D9PA 2FHKA 3NL0A 3CJ8A 3LP1B 2F1FA 3BB5A 5EN1A 4JI7J 1PAEX 5D0HA 4ZVQB 2Z2LA 1UMJA 4I2QA 4GKKJ 1BQMB 4WCEQ 3G8SA 3NGTA 3GFXA 4RX6A 2NYHA 2X7IA 2UUBF 3DLJA 2K3KA 2ILYA 3QJLA 5KAKA 4CLZA 5LJ5Y 4IG0A 4DL2A 2E9TA 5C42B 1A9NB 1RWOB 1EP4B 3RYLA 2RRAA 2YKNB 2AF6A 2ZM6F 3W64A 4AXJA 4Q8EA 2IBOA 5FDLA 3G2XA 1DQ8A 4JI3F 2UZAA 2VD3A 2R7RA 5ETPA 1TQLA 1ZBTA 3BQ2A 1UWAA 3MGJA 2W9CB 1DTQA 4F3QA 2WZ1A 2KVIA 4R8UA 4X4TA 2R7SA 2XNRA 4QYZK 4CLWA 4AXIA 3J80U 1VLYA 2AMCB 2FVPA 4FXWA 2ZBCA 5KFTA 3PHEA 2P6SA 1H98A 2W2OP 5GADI 2UXDJ 2A2DA 2QL5B 2VL1A 4YN3B 1CLFA 2KG1A 3PY8A 4F4ZA 3JSBA 5J1EA 5A8WA 1IBMF 4RO0A 4M1KA 1D0EA 5J1NA 3IAM9 1QTNB 3VV2B 2LDYA 1VQOS 1U49A 3H2LA 3MUTP 4DS4A 3QAUA 3EGNA 1CQMA 1BUXA 2DKOB 4IDKB 1FE4A 4OI3A 5FIIA 4CZCA 4OZ0A 4CNZA 4L76A 5DDQC 3VAMA 3SXLA 3OXFA 3MMAA 2CZ4A 4L6V3 1IR2A 1WORA 1Q79A 3ZZPA 1FKOA 2B9EA 4OI6A 2V67A 4V19J 5J2QA 2RSQA 4CLKA 3R5JB 4GMKA 4M5KA 2Z57B 3JYTB 2GQCA 1NSQA 4WU3A 3BM7A 1OMSA 3CUNA 1FWPA 3JB9k 4RW8A 4CWBA 4B9UA 3UFCX 4ZHRA 4LUBA 1AOPA 1WEZA 1LW2A 3JSMA 1YX2A 1D8YA 1REVB 2I2YA 2BM1A 5IQQA 3HHEA 2I8EA 2W9AA 1LNQA 4C11B 4J7CA 4O3QA 1RTHA 1OY6A 2ADBA 3GYNA 1HBMA 1BQNB 3MR6A 2V94A 4OHYA 1RT4B 1JLQA 4DPOA 3LWMA 2F8MA 3K7RA 4DHVA 1NAQA 4WFYA 5E3CA 4HHJA 4DJBA 5HSPA 2IVYA 1PJ7A 3U1NA 1ZTTA 3NGUA 4KO0B 1ZM4A 1RT7B 5KFBA 5KFDA 4USUA 2N7CA 4JI1J 1YBUA 3M8WA 3TP2A 3GIKA 2AJFE 2UUAJ 1WKJA 2DRAA 2GJIA 4DQPA 2VDHA 1GXLA 4MTPA 4GC6A 3LPEA 3KMSA 2DNMA 4S23A 2W9BB 1Y5NB 1HD1A 3B78A 4KGKA 1RDRA 1H7WA 2FHMA 4Q5VA 1HNWJ 3CD5A 2A6MA 1AYEA 1QJHA 1IKXA 2B9YA 2PFFB 1HYSB 4ECUA 4K4YA 1J2VA 5IFMA 4NLSA 5KFCA 3VGVA 4DWIA 1RZMA 1ZAWA 1P1TA 2FHJA 1RAIB 2ALYB 4IG0B 3BGLA 1CC7A 2DNQA 1YRTA 3IR5B 4DV2J 4C3LA 5LXYA 2FTRA 4LF6J 1X9SA 3K5OA 5FDLB 2Z8QA 2QLBB 4C8NA 4JV5F 2UV8A 3ZO7A 1MWYA 4LMZA 4DFPA 1A0OB 1C2PA 1QY7A 4U8YA 2GMJA 4WU2A 1DTQB 1GK8A 4R8UB 1GMVA 5DGAA 3CD6S 3MPWA 1M5PC 3PFEA 1TMJA 1DFDA 3LF0A 2WVFA 3ENWA 4A8WA 3QT6A 2PE8A 5DG8A 3Q2TC 3DU6A 2AOPA 2YQ1A 3W1YC 5A2QU 5A8WB 5BR8J 1IM4A 1K47A 3SCLE 2GVZA 3FCWA 3HT0A 2A0FB 1U2FA 1Y11A 2HNDA 5K8OA 1UTAA 2KB2A 1H6KX 1YVFA 2VOOA 4F36A 4DX6A 5KG1A 3AY0A 4NYOA 2RHSB 2H1YA 3GCWP 1FA0A 4OYOA 2DT9A 4ED2A 1U0SA 2CNLB 4NXMF 1NZAA 4PQUB 4X4VA 5M2PA 1RUSA 1FKOB 2IRUA 2R4FA 2HHSA 3M6XA 5J2QB 2AYEA 1I3OB 1Y4ZB 4N5SA 2CJYB 4CYUA 1UW4A 2N4DA 4DF4A 1U6FA 1VMBA 4B3MJ 1Q5VA 4PG6A 1O51A 2MJNA 4NPOA 4C97A 4M5JA 3D3CJ 3N5BA 1T02A 4RW8B 1EB0A 4K50A 2XZTB 3VKTA 4JI6F 4IUFA 2FJXA 1NJIT 3CJ2A 3JSMB 3ITHA 3J80Y 1OO0B 1WF1A 3MAAA 4AE5A 5SZTA 2VG7A 2F4VJ 1V5IB 1S1VB 3W2WA 4DUTA 1GXUA 4IYQA 1I94J 1JKHB 2IVMA 1WD6A 3IM8A 2DD8S 3QGHA 3GZ7A 4DXLA 1HBMB 1NHKL 4D3GA 1R6YA 1RWNB 5AJ3J 1S9EA 4C0OC 3QT7A 3B0HA 3OVAA 4YHHJ 2CPYA 3OPKA 2EXUA 3NMRA 3B0LA 4M94A 4OZ5A 1X8DA 2ACMA 2YQ0A 3UWTA 2DR7A 3BO2A 4HL9A 2C42A 2UUCF 1HBOB 3POTB 1N33F 2A1BA 1AW0A 5F3ZA 4LRAA 3B0GA 2VQEF 5HQMA 1N5SA 3HSZA 3EXCX 4FVMA 3R5GA 2C2ZB 1WF2A 3BSNA 3AJDA 1WDDA 4KH1B 4NLUA 3IWXA 3SCJE 4RPFA 3J7A1 5DM6Q 2B6AB 4TLQA 1RHQB 2O5DA 2EFVA 3UNGC 3S6EA 2M52A 3EWGA 2HRYA 3SQOP 1IKXB 1F2HA 4CM0A 2FY1A 3Q8YA 4JV0A 3CCES 2HFOA 1GMWD 2DGOA 2ZBRA 5D8HB 3IMQJ 2R2UA 2DB1A 5HP1A 3IBWA 3D3BJ 5LXRA 3C16B 1EKRA 3DRXA 5DO2A 2AQ4A 1WUUA 4DR4J 4X4QA 2XC9A 2BVZA 2ZOGA 3AH6A 2ZHOA 3IR7B 3H20A 4DCPB 3B54A 4NLGA 2K3IA 4LJMA 2J9EA 1SL1A 4I4BA 2D7SA 1N6QB 5KT7A 2A10A 2CIMA 3K5LA 1LK7A 1U4BA 3F56A 2CPHA 3DU5A 2Q1LA 1XC9A 1YITS 4LF9F 1YBTA 4ES1A 4DZDA 2UXBF 4OYWA 2W4DA 6FDRA 3WX4A 3DRYA 3LO3A 4ECYA 3QO9B 2C2DA 1PAUB 2YNFB 3GILA 3E01B 2WW4A 1RTZA 1R31A 1FT8A 4WTYA 2QYCA 3QATA 2GVZB 4IOCQ 2V68A 4U67Q 4LF7J 4JI2J 2WVEA 3CDBA 1WEXA 2HNDB 1OWXA 1FE0A 2P9EA 3T1YF 1IBKF 4EBCA 5KFOA 1Q53A 1OIAA 1RU2A 4OV6A 4ZP9A 3H5XA 2RT3A 3UN2A 3ILOA 5DLGA 1FVSA 2POKA 4PYDA 4CYUB 1L3TA 2OD6A 5U47A 4O23A 1VBYA 2QMXA 1IKWA 5KFWA 4CIOA 3CCUS 1N36F 2DRDA 1UETA 4Q2MA 2H9ZA 2LEPA 3MEEA 4Y65A 2XMAA 1SC4B 4X64J 4U7UD 3H5UA 3A8KA 1E6VA 5LL6d 1ZTWA 3ITHB 5EDWA 3LANA 3UE2A 4MK9A 4W92B 3KJQB 2Q6CA 4RBTA 3E2EA 2C3MA 2FUG9 4HEA9 3H5SA 3SSSA 3CCRS 3OUYA 5IT9Y 1RHUB 4LR8A 4HACA 2MHEA 2LXUA 1WC5A 2V4RA 2GMHA 3G6ES 2ZWOA 2H4YB 4H4OA 1VC6A 1S9EB 3H5YA 3V6DA 2M2BA 5AXMA 3TUIC 4B3RJ 3DYAB 3GFYA 1TK8A 1W25A 2FVQA 2IM0A 4ID5A 1U24A 4LFCF 1HNZJ 1IKYA 1LV5A 4WTOB 1HQEA 1WJ9A 4QW8A 1NPPA 2G4BA 1ZJ8A 4I69A 3CJ5A 2JWNA 2DNYA 5DDPC 1X4HA 2ZE2A 4JI4J 5AXNA 2EI5A 3TI0A 2PA8D 4QIVA 3PNIA 4OJHA 3OSPA 2OLWA 4FYXB 4UY85 3HSJA 3SZ2A 4AUKA 2FB0A 3L9ZA 4NZ7A 4CLSA 1Y3JA 2R7QA 2FZGB 5ETQA 1VISA 4DL4A 4A46A 4P2FA 5IZHA 4B3TJ 2E7VA 2J5AA 1BLUA 5LSLA 2UV8G 4DG1B 2IBKA 5D4PA 5HP1B 1IKVA 1QDUB 1YRXA 5AT1B 5ETNA 1GT8A 2XSFA 5SUHA 4S3BA 2JNJA 3CO0P 4HTRA 4ZS6A 5LMUF 2QEXS 1TAUA 1TU0B 5FD1A 2EVZA 4DCOB 2D1CA 4XO0A 2WB1D 3Q24A 1HW8A 5J2MA 4LQ9A 4G1QA 3KJVA 2B0GA 1NM2A 1N34F 1WF0A 4OYIA 4OQJA 2XMKA 1RT1A 3OV7A 2NZ4A 2OPRA 4C6AA 3PJ9A 1GTHA 5KFKA 2LLZA 3QGIA 1F2GA 1ZETA 1UA1A 4ZCKA 3QRRA 1WSRA 3SFUA 4JI7F 1BHNA 1FRMA 4CH1A 3C8YA 2KT2A 2R2TA 3NGRA 3EVWA 2W4PA 3MMJA 1JIHA 2VC0A 2R8HA 3OTBA 4ZP8A 4KQZA 2DIUA 2RD5C 1S9GA 1QVGR 2R7WA 1TKDA 3W9JA 1HD0A 3QBCA 4HLBA 2DH7A 4M5IA 4IOAQ 1IM6A 1RBAA 4YR2A 1WEYA 5F8NA 4ZK7M 1UVKA 3IGNA 2OSRA 3L3CA 3LA0A 1B3TA 1Y5LB 3HZGA 3VF0B 1R0CB 1RAOA 1FKAF 2J7WA 4F67A 5HI7A 3A8EA 3J81j 5IWAJ 1IKWB 3FGVA 2WSFC 3JSRA 3M9OB 3MEEB 2VF3A 3UR0A 1V6HA 9RUBA 4EBEA 3NWGA 1R8AA 3BSCA 2LQ9A 1ZAXA 3HT3A 4QPXA 1VK8A 1X4AA 3CT9A 4NE9C 1WWHA 4DSEA 2ZUAA 5HATA 4HACB 2RB7A 4F25A 4K2XA 1HIYA 4LRBA 2OIHA 3V81A 1JLFA 3DFEA 3V6DB 1NBEB 4DU7A 4NLQA 1MN9A 2EFGA 2R7OA 1VC0A 5DZ7A 2WHOA 4ECRA 2DGUA 4MH8A 4ID5B 4ZPAA 1ZM3A 4Q8FA 4IFYB 1T9XA 2OPSA 1FD2A 2LFVA 2X1AA 1D09B 3HHLC 4IRDA 3GLJA 3IS9A 2Z0GA 3MZIA 2GJFA 1YJTA 3FFIB 4LF5F 3PG9A 2ZE2B 2H4WB 3MPVA 1VQLS 2HZVA 4KKOA 2MQLA 1YJRA 3HFKA 3UQSA 2LYVA 2VFTA 3CCWA 3T9ZA 4OI0A 3PHTA 5HMYA 4UUWA 1FX4A 1T9YA 1UEKA 1M0SA 2R8GA 5B0AA 1KVJA 1B7YB 3KDOA 1B64A 3MMCA 1XNRJ 2NS1B 2R2SA 2VODA 5EWGA 1UJ5A 1ZM9A 1IKVB 1L3UA 2V2QA 4M8LA 4OYBA 1ZYQA 1BMQB 1A7GE 3PW0A 2Y3YA 2HMIB 2AGPA 1WC4A 5CYQA 1FXRA 4BWMA 5C5JA 3I5CA 1BWVA 3EE3A 5J2MB 1S76D 4G1QB 3NBPA 1Y7PA 1QUPA 1U47A 4QBUA 2UUAF 2NSCA 1PJ6A 2CUYA 1RT1B 1CJTB 4NZ0A 3D66A 3ET6B 4JYAJ 1CSJA 1WNEA 2GHVC 2GZOA 2MXYA 1C1CA 4LVOP 1KLNA 2GCFA 4G1PA 1CULA 2YKAA 4FNHA 2M9KA 1X9MA 3L95X 2XTJP 8ATCB 2QFIA 2V9KA 3M2RB 3L7UA 2W24A 4FDFA 4PG8A 3NXZA 1S9GB 4B9TA 5E3RA 4NASA 3U1LA 5IV4A 3M6VA 1FK9A 1AXQA 3QJPA 4USTA 3R1LA 1NKBA 4DV2F 2DGXA 5FJ4A 4UT4A 3G6XA 1S10A 1Z4UA 4OYZA 4LF6F 3BGFA 2BE2B 4NLRA 3CSKA 4ZJQA 3KWMA 5B0GA 2H54B 2RHQB 4R5PA 1FJCA 1QE1B 1RABB 1JNRB 4DCJB 3BGRB 2P9GA 3AOCA 1UZHA 3IG1A 2Y0BB 2B5JB 3HKZD 3QRQA 1T05B 1ZM2A 4OZNA 3ULHA 4S3DA 2BW7A 1VQKS 3GIIA 2YWHA 3BO4A 2D69A 4F4XA 5KFUA 1IXKA 2X1FA 3NRBA 1HLWA 2QO3A 4DQRA 2AZ1A 3NGKA 2G0IA 3E51A 3CJKB 3CDWA 5BR8F 2XY5A 2WTFA 1S7IA 1SQFA 4I64A 2JFKA 3SSRA 4B3OB 1Y9OA 2KO1A 3NCRA 3D0GE 4OYPA 3I0RA 1JLFB 1UVMA 3CTRA 3HXMA 5IM0B 2B9WA 2HBRB 3VAGA 3ZZYA 3N6LA 2AIRB 5C7PA 3HHKA 1VQPS 1N56A 2EBGA 1YTYA 1HQUA 3OTCA 1I6JA 4IO9Q 2CPIA 2Y9HA 3IS9B 1FCAA 3MFIA 1Z2LA 3RRGA 4IRKA 4JUZA 4KKOB 3DHWC 5D4OA 3LQVA 3GWCA 2GC8A 2IRXA 1NKCA 2R2RA 5AXLA 1UCNA 2EFNA 3HM9A 4RNOA 5KG3A 3TEHB 2CWKA 1CG2A 3UD4P 1JJ2R 1PBUA 2RQKA 1JLAB 4K7QA 1I94F 3BZQA 5KFGA 4OX7A 3MMCB 1GNKA 1NK6A 3EZ5A 1Q82T 1EQMA 3B4DA 2YTCA 5AJ3F 4S3CA 1HWUA 3JTNA 1H74A 2N4CA 2J6SA 2B51A 2BJEA 2Z30B 1M5SA 2V6AA 3MTJA 4NZ6A 5CYQB 2VBWA 1S4EA 5THWA 3TO8A 5JMNA 1U1LA 1UL3A 3H2VE 4G65A 3R27A 2VPXB 3NBPB 2CQ0A 2E5LJ 2PC6A 5AE2A 3JTOA 4G9PA 4LBHA 5HK4A 1YG0A 2ASLA 1VBKA 4LR7A 1YRUA 3NOGA 3HJFA 2DR9A 2J9DA 5H9FJ 2D9OA 1DTTA 3NWRA 2KFZA 1JXEA 4DSLA 1RT5A 1DAXA 3KJNB 1S0VA 2UVWA 1C1CB 3TRGA 1B0PA 1O0PA 3M2VB 4N8OA 4EMDA 2HLUA 3IWNC 2E1AA 4NA2A 1UZDA 3AQOA 4Q44A 1UKUA 5L1JA 4N8NA 3FMBA 3M4XA 3PFOA 5L1KA 1QSSA 4S3FA 5LSOA 3RG6A 1SVDA 2B4UA 4ZPBA 1IQZA 4DR4F 2OGUA 4PKDB 3DXSX 4UOFA 2E7XA 2FIUA 4DPUA 4Q2LA 2QIFA 1FNOA 3J7Z5 2WOMB 1OY8A 2RKIA 2GAHC 2KM8B 3EICA 3T6JA 3J7YI 1AUDA 1TELA 4A4JA 5KFAA 3W8PA 5B0DA 2LXFA 1FEHA 3IGVA 2OD4A 4B9MA 1S6PA 3IG1B 3JQMA 2ZWPA 1VC5A 2DBBA
chains in the Genus database with same CATH topology
3ZZTA 4RZRA 3GEOA 4K0KF 1DTQA 4F3QA 2KVIA 4R8UA 1IKYB 5KOXA 2CQBA 2XHWA 1R8CA 3MR2A 1YHQS 4X4TA 2L9DA 2XNRA 2R7SA 3FZ2A 1Q7LB 2ZUGA 4AXIA 2XI3A 3KLHA 1HQEB 1VLYA 3QLHA 5CZXA 4QZVB 2FVPA 4FXWA 3MWBA 4NX9A 5DRKA 2ZBCA 2ASJA 5KFTA 3PHEA 2P6SA 4N76A 1TKTA 1H98A 2R7TA 3DI6A 2V2KA 5GADI 2ZH8A 1NJWA 4E98A 4YY3F 2A2DA 4DG1A 2VL1A 1S1XA 1KTQA 1LOUA 2DNZA 2ZNYA 3I96A 3ISZA 1KSPA 3W2VB 2JLEA 3HK2A 4DDFA 2KG1A 1MU2B 4F4ZA 4ECWA 3PY8A 2YX4A 3FSXA 3SV3A 2HPUA 2PMHA 3JSBA 5J1EA 5A8WA 1IBMF 3CULA 4J9OA 1BQXA 4M1KA 4U7UK 2RQCA 2X1GA 4LF7F 3AJ1A 3HHLA 4O44B 1D0EA 1H2TZ 3IAM9 5J1NA 4JI2F 2LDYA 4QW9A 2V4QA 1VQOS 1MMNA 1A6LA 3GV8B 3RBEA 1U49A 1U26A 2M0GB 4ZVGA 3PIPQ 2N3OA 3MEGB 3H2LA 3LP0B 3PKYA 1M1KT 3MUTP 4ECQA 3QAUA 4DS4A 2PN6A 3EGNA 1CQMA 4AYBD 2XMTA 2J6TA 5A0YA 5KFRA 3J7YU 1R8PA 2UVUA 1HI1A 4AFFA 4IDKB 1FE4A 2E44A 3HLUA 2DNNA 1KR4A 2M70A 4OI3A 5FIIA 1URNA 4DR6F 4CZCA 4OZ0A 4CNZA 5KFNA 2VBZA 3PO4A 2ILZA 2IYIA 5DDQC 3VAMA 3SXLA 3PR5B 3OXFA 2KU7A 2DH9A 2HWTA 1ZJ9A 3MMAA 3OL9A 5GAGU 1LWEB 1X4FA 2CZ4A 1RK8A 4L6V3 1QUVA 1Q79A 2AJQA 2YY3A 3ZZPA 1FKOA 2XCAA 4BDPA 4Y00A 2VKZG 1V9OA 3GE9A 5DDRC 4HVZA 1KONA 3TQ1A 4TY8A 1S48A 4OI6A 3MMBB 1SKRA 4V19J 2AX0A 4W90B 4ECTA 4K4UA 3GR1A 5D4LA 5J2QA 3DLKB 2RSQA 1CLFA 1LQ9A 5I42B 4YMEA 1X4BA 2JSXA 5GAHI 1U48A 4GMKA 4CTAB 4IRCA 1OS5A 3C6TA 2XY7A 5F8JA 1HHSA 1HBUA 4ED1A 5JVHQ 3JYTB 3VAFA 2GQCA 3AAWB 1L5UA 4QJVA 4X64F 5GADU 2V4JA 3BREA 4WU3A 1ZPVA 3BM7A 3BN4A 3CUNA 2ZH3A 1VQSA 3JB9k 2RU3A 4RW8A 4ELTA 4B9UA 1U1KA 1L3KA 3K8WA 5GAEU 4QIGA 4JI1F 3UFCX 4ZHRA 1U09A 1X9WA 2PEHA 4LUBA 1AOPA 1XR6A 3V4MA 3NNCA 1WEZA 2YNGA 1V3ZA 1LW2A 3JSMA 3NMAA 1U1MA 1VJWA 1D8YA 3C2PA 3KJVB 1U1QA 1IUJA 1REVB 2HWIA 2XB2D 5HBMB 2I2YA 2JVRA 1Y00A 2BM1A 2VG6A 5IQQA 3HHEA 2OTJS 4KJIA 1VQ8S 1Q81T 1UJ4A 2LU1A 1FDDA 2I8EA 1MSWD 2W9AA 1QLNA 2CQDA 1RWUA 4TXSA 1S1UA 2BUNA 2FDNA 4J9LA 1U45A 3OLBA 2RE1A 4C11B 1N48A 5BJRA 1S6OA 4OI2A 1FJEB 2YWGA 4NA1A 4RWXA 4O3QA 3OFEA 2L9NA 2XGPA 5AXKA 1RTHA 2OPRB 3K0JA 2GW8A 4NLWA 3QIPA 2ADBA 3KLIA 2GNKA 5KG4A 2HVZA 2RH3A 4C7QA 3RU0A 2LVWA 3GYNA 1HNWF 1HBMA 3T5JA 1YSJA 4B3SF 5CA5A 2CQ2A 3WC0A 1BQNB 1PC4A 1S6UA 1VRTA 1PC5A 2CVIA 3DN9A 4F50A 2VC1A 2HIQA 3MR6A 2DO4A 2GFFA 4URGA 2V94A 3SFGA 4OHYA 3VLXA 1C1BA 1RT4B 3PIOQ 1X4CA 3ZZ0A 1JLQA 1H0HB 4DPOA 3LWMA 2F8MA 2ZOFA 3K7RA 2XO7A 2VA2A 4PG4A 4DHVA 4DMZA 2XMUA 2MQOA 1NAQA 4WFYA 1U1RA 3S7RA 5E3CA 1WG1A 4HHJA 4NYPA 4DJBA 2HNZB 2P9CA 2C3YA 4RW6A 2IVYA 2L41A 4Y6IA 3KK1A 2OPQA 1LWFB 2XSJB 3U1NA 2L08A 1ZTTA 1HNZF 1NK0A 1S6QB 2HFZA 4F2RA 4KO0B 1ZM4A 3VZHA 2OAUA 3M8QA 2O01C 3QZ7A 4NRUA 1KFSA 5B0BA 1RT7B 1TKZA 5KFBA 2XMJA 3HDSA 4MK7A 4MYUA 5KFDA 4K4ZA 2GIQA 3NOYA 3FCHA 2B7BB 1AROP 2N7CA 1FDBA 3Q22A 1XMOF 3EGWB 3TP2A 1X4GA 4BCAA 2XWXA 3GIKA 3RB4A 2IC3A 2XWYA 2AJFE 2Q43A 3FEXB 2MQQA 3OW2R 3U27A 4JV2A 5E2QA 2DNOA 3SDEA 4JI4F 2FVCA 5B08A 1HL6A 4LT6A 4CO4A 2DRAA 1BY9A 2GJIA 3ZZZA 2HFNA 4DQPA 1SJQA 1S77D 3NS6A 1GXLA 4WXOA 1WI8A 2XBPA 4ZKAA 4O3PA 4MTPA 4ZVEA 3FSYA 2WONA 4GC6A 2DGQA 1UA0A 3KMSA 1RT5B 2CJAA 5F8MA 2DNMA 4WFXA 5CH7B 3B0MA 4DL5A 3IFEA 3NNAA 4S23A 2W9BB 4RW4A 1Y5NB 1LWCA 2FGOA 4LIRA 1HD1A 3B78A 3NCPA 4KGKA 4ES3A 1VS3A 2W7OA 1UAWA 2MZRA 3IC1A 1RDRA 4I7FA 2ZBIA 1H7WA 2FHMA 2RMLA 1R0AB 4Q5VA 4TU8A 4Y3CA 3CD5A 3NKYA 5KFSA 3MAQA 3BO3A 5HLFA 2KHDA 2E7WA 3GB0A 2AD9A 2OFGX 1QJHA 1JLEB 2Y0FA 3DOKB 4J37A 4CO2A 1IKXA 2B9YA 2OP5A 4OX6A 1VQ5S 2PFFB 4CO3A 1MMLA 2QE5A 4B3TF 3NNHA 3CMES 2BABA 1HYSB 4N47A 2J0WA 1FDAA 2ROGA 4KGMA 4OJ3A 3KLGB 4ECUA 2FLLA 4K4YA 2KFNA 4CT8A 4ZCIA 1T7PA 3C3LA 5D4NA 1J2VA 4WF9Q 5IFMA 4PUOB 2BYCA 4Z2XA 3MM6A 4NLSA 5KFCA 1RT2B 4DWIA 5CYMA 2HHUA 2A3JA 1ZAWA 4IFYA 1WTFA 3V6KA 2KI2A 1P1TA 2FHJA 2XGQA 2GO8A 4OJGA 3DLGB 2W7PA 4ILLA 3CC4S 4IG0B 3BGLA 2B4OA 3BSOA 1R7IA 1PGZA 4YP3A 4ZP6A 4LQ3A 3DOMA 1CC7A 2DNQA 3T3FA 4HI1A 4M5DB 1DARA 4A48A 1YRTA 4WFZA 4XDCA 3G96A 3R5CA 4H4MB 4I6YA 3IR5B 3LWLA 2RKIB 7GEPA 3PEHA 4C3LA 3FFIA 1FNXH 5DETA 2FTRA 1OPIA 3HVWA 4PCQA 5LXYA 5IT0A 3V81B 2Q66A 1X9SA 5HMXA 5F8IA 1YQHA 1W2IA 3K5OA 2Z8QA 2KJVA 5FDLB 4X4UA 1LXJA 2ZHAA 1RA6A 3GG1A 3ZFVA 4C8NA 1HNVA 2FLPA 4JV5F 4H4KC 1Q16B 2UV8A 3IXQA 2ZHBA 4NLXA 4Q0BB 1MWYA 1TK0A 4LMZA 2RS8A 1S6PB 4DFPA 4NLVA 4WJBA 1IQTA 1C2PA 3K59A 4RKUC 4TQSA 3PO5A 4FF4A 2Z2MA 1M5VC 1QY7A 4A8XA 2GMJA 4WU2A 5DQIA 4DF8A 3QGPA 2CQCA 1DTQB 4R8UB 1KS2A 1VBXA 2P5VA 5DGAA 3O1LA 3CD6S 3MPWA 1X5TA 4MAKA 1M5PC 2Z4PA 2OPSB 3PFEA 3QLHB 4OLPA 1C0UB 1DFDA 3CCJS 4KHRA 4F02A 2VOPA 5K8PA 3LF0A 4H4KA 5E0OA 3SEOA 2LU2A 5DG9A 3SYZA 3ENWA 2AYMA 4NOHA 2IJNA 1TKTB 2DCLA 1FXDA 2WW8A 3DI6B 4B3MF 3M1VA 4A8WA 2PE8A 2NPFA 5DG8A 2XLKA 4DX8H 3DU6A 4J9RA 3Q2TC 2AOPA 3O5TB 2M3DA 3MD3A 2R9LA 1JWWA 4PXBA 4RNMA 3VKRA 4MYTA 1P9QC 3J81Y 2DGWA 2VBYA 4DR1F 5E3PA 3ONQA 2LA4A 1DRZA 3TR5A 3IN5A 5A8WB 2QLWA 2WRMA 1IM4A 4ZVHA 5ADZA 1SL0A 1RI7A 2ACYA 2N82B 4M63A 4F8RA 3I31A 3SCLE 2WSEC 3DXBA 3HHLB 8GEPA 2LECA 5KT4A 2GO9A 5I3QA 5HN0A 2FJEB 4GKJF 2JHEA 4S3EA 4MK8A 3UPFA 2HW3A 5I3PA 2HMIA 1KOHA 4HI2A 1MROA 1U2FA 4EO6A 5K8OA 2HNDA 2FPHX 2XY6A 3M2UA 2KB2A 1H6KX 4I6AA 2F4VF 1YVFA 3HPOA 3ZZOA 4K4VA 2VOOA 2EK6A 2LQJA 5KG1A 5A0YB 3N6MA 5DQGA 1KVIA 1H7XA 3M9NB 1XEZA 2YKPA 4K4WA 2YNIA 2Q6BA 4DSKA 2HHXA 3AY0A 4NYOA 2ZH5A 2GHWA 2BJDA 5A8RA 1FA0A 3W3SA 3MR5A 2DT9A 4ED2A 4C9DA 3CIMA 2HHVA 4FXDA 4RUCA 4PXEA 2CPEA 4OMFG 4NXMF 3LGNA 1NZAA 4URSA 4PQUB 2J9CA 4Y28C 1QAJA 2O67A 2VPYB 3BDEA 4RBUA 4X4VA 2PI4A 5M2PA 1NJZA 1FKOB 2IRUA 4UUXA 5C24A 2R4FA 2VFSA 3H59A 1RTDA 3VLYA 1TKXA 1JLBB 1TL4A 2HHSA 4TY8B 5A6WA 4UQTA 1FERA 4YB1P 4YHHF 3M6XA 2VKRA 2HWHA 3Q23A 5J2QB 2AYEA 4L72B 3K5NA 1Y4ZB 3UCGA 4N5SA 4NWBA 2V8HA 4QPTA 2KRBA 1UW4A 1IR0A 2N4DA 5H1SV 4U7CA 1RT6B 4DF4A 4P2SA 3C6TB 3CEDA 1U6FA 1VMBA 5B7WA 5CYJA 4PG6A 3MR3A 3CCZA 1HBUB 1O51A 2MJNA 2DRBA 3GFHA 4NPOA 2GHPA 4C97A 2V4JB 3N5BA 1T02A 4RW8B 4TQRA 2W8LA 4JI0F 4DV3F 2AYBA 4ZVFA 4K50A 2JLGA 3VKTA 4ZCMA 4JI6F 4IUFA 4QR1A 2QRRA 3K8VA 2FJXA 3MXHP 2CPJA 2EFPA 1NJIT 2QZ8A 3QZ8A 3RR7A 2GGPA 2VV5A 3IRXA 3CJ2A 3GV7B 3JSMB 3ITHA 5KG6A 3J80Y 2KXNB 1J5OB 1KHVA 1OO0B 3M2RA 1WF1A 1NK7A 2RRNA 4AE5A 1HR0F 4HT7A 5KFEA 3GG0A 2VG6B 1FRLA 5SZTA 1S72S 4S3AA 4K59A 4ICLA 2VG7A 3TNVA 2AJ1A 2WAQD 3M9MB 1G1XA 1S1VB 3WZ0A 2L9WA 3W2WA 3PXGa 3ZZRA 4HTJA 5CCLA 3PJXA 1GXUA 1UVNA 3DDNA 4IYQA 4YUDA 5HMWA 2EFOA 1VRUA 2LDIA 3LGMA 3OQ2A 2CJQA 4MIWA 1JKHB 2IVMA 4CI0B 1WD6A 1RTIA 1K9MT 3GFZA 3QIPB 4X65F 3DLLQ 3KLIB 2HS4A 2Y0SD 1FO1A 2DD8S 3QGHA 2JEIA 4CO1A 3GZ7A 1HBMB 1DLOA 1HA1A 1HMVA 3GSDA 3AQPA 2BE2A 4D3GA 1R6YA 5L9XA 4KFBA 3W7BA 1VRTB 5EWEA 4DL6A 3CCLS 2YWFA 1H2VZ 2CG4A 3BF4A 3T1HF 1FJGF 2CKWA 1UFWA 2E9RX 1S9EA 2LXIA 4C0OC 1C1BB 4HYKA 4DFJA 5DLFA 4B9LA 1M90T 4Y2MA 2XI2A 1QE1A 2G0CA 3PR4A 4OHXA 3B0HA 5DS7A 3OVAA 2CPYA 3BGRA 2B4VA 3OPKA 5T7LA 2MKIA 4RW6B 3CJ0A 2CQ4A 1E6YA 3I87A 3N4WA 3KK1B 3NMRA 3B0LA 2B5JA 3G6VA 4M94A 2HYIB 2YKMA 4OZ5A 1X8DA 3B82A 3PDNA 4TKTA 5AOPA 3UWTA 4OZ1A 1T05A 4WE1A 3BO2A 2DR7A 2V9WA 3PW2A 4EUVA 1X7VA 4HL9A 2C42A 2E1CA 1SV5A 4OX8A 2UUCF 4WKRA