4S39A

Ispg in complex with hmbpp
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
401
structure length
400
Chain Sequence
MRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 140
structure length 400
sequence length 401
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s39A01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s39A02
2AOPA 3H2EA 4MWAB 2VEFA 4C1NB 3VKSA 2E7FA 4DJDD 3H21A 1F6YA 1AJZA 3MM6B 4G39A 3MM8A 4D9PA 4S3EA 2YCJA 3MMCA 4S39A 3B0NA 3MM5A 1AJ0A 3B0JA 3BOLA 1Q8AA 4S23A 1EYEA 2XSJB 1AJ2A 3H2MA 2YCLB 3MMBB 4NIRA 3MCNA 3TZFA 3MMAB 4MWAC 3MM7B 4AOPA 3TYEA 4MWAA 4HB7A 3OR1A 4S38A 3MCMA 3B0GA 3MM9B 4S3BA 3NOYA 4G38A 2H9AB 2OGYA 3H24A 1Q7QA 3H23A 3TYUA 3TZNA 2V4JA 4DJFC 3MCOA 3TR9A 1ZJ8A 3TYAA 2Y0FA 4O0QA 4DJFA 4D8AA 3H2AA 1ZJ9A 5GEPA 1AD1A 1TX0A 4PZVA 4DAIA 3OR2A 4GEPA 5JQ9A 2VP8A 4NL1A 2VEGA 3H2FA 3H22A 3GEOA 3K13A 3VLYA 7GEPA 1TWSA 4DJED 2Y5JA 6GEPA 3B0MA 4CCZA 4DAFA 4C1NA 2YCIX 3VKQA 3TYZA 1Q7ZA 4DJDC 4DJDA 4S3FA 3MM6A 2AKJA 3MM8B 4S3AA 3B0LA 3V5OA 3MM5B 4S3DA 2DZAA 1AOPA 2XSJA 4O1EA 4NILA 3VLXA 2YCLA 2GEPA 3MMBA 3MMAA 3MM7A 2BMBA 1TWWA 4MWAD 3H2NA 4D8ZA 3TYBA 3VKTA 3H2CA 3VM0A 3MM9A 3AOPA 4S3CA 2H9AA 3OR1B 5AOPA 8GEPA 2DQWA 1TWZA 4DJFD 2V4JB 1AD4A 3H26A 3BOFA 4G9PA 3VM1A 2Y5SA 3VLZA 1Q85A 3MMCB 3TYCA 1Q8JA 3OR2B 4HTRA 1TX2A 3H2OA 4MWAE 3B0HA 3VKPA 2YCKX 3VKRA 1Q7MA 2DZBA 4DJEC 4O1FA 4DJEA 3TYDA 4NHVA 4DB7A
chains in the Genus database with same CATH superfamily
1VFSA 1FHUA 4M82A 3ABQA 3ARWA 2V82A 1UWQA 5ABEA 2Q3OA 1C8XA 3MM6B 3W2KA 2CBUA 4RDZA 3TOPA 3TTYA 2OLAA 3EWBX 2DW6A 1TA3A 4F0LA 1VFFA 1TRDA 3KZSA 3W7DA 3PZQA 4NIRA 3CJPA 5AKQA 4C6NA 1C9DA 3N6QA 2OVLA 1POJA 3C86A 3VPLA 1PZ3A 4H6QA 2ZC1A 1MUWA 3MCOA 3FKRA 1GVIA 4IH3A 3W53A 2H8ZA 3CLWA 2PAJA 4PZVA 4DM1A 2DT0A 3BICA 2VP8A 2Q09A 3AIWA 5LGXA 1XM3A 2CEQA 3MP3A 1UB3A 6GEPA 2J8FA 3RJYA 4MLRA 4DAFA 2QV5A 4AAJA 1GNXA 3FHAA 3E2SA 8XIAA 1Q66A 2VD9A 4AIOA 2DQXA 4XZBA 5HNUA 3TQPA 1M53A 4WDUA 1DWGM 2OO6A 3LENA 4HBKA 4GGHA 1Y0EA 2GEPA 3PG8A 4US5A 1KFJA 1YIXA 1Z89A 2ZUNA 1FWWA 3KOWA 4A6GA 1ELSA 4FLSA 1WKFA 1BEUA 1KKRA 5FD0A 1LF1A 3WMBA 2ABBA 2WXDM 3A4AA 1V0KA 1NFBA 4DB7A 1K9DA 3WBEA 1ZPTA 2ALDA 3VI2A 4MY9A 5AC7A 4RX0A 2A3EA 5IM51 3R4IA 1BGAA 1XCWA 4F8XA 1XSKA 3VVGA 1L8PA 1HJXA 3N2BA 4WXZA 1GORA 1OWQA 5FSEC 3NOYA 2DZWA 1UR4A 4UR7A 3W3OA 2HVMA 4Z1CA 2WW5A 2ZUSA 2WSQA 3MTWA 2NSOA 3URBA 3WJWA 3LTSA 3TW9A 1TCMA 8CGTA 3OHMB 2INEA 3RAOA 3ZSTA 1ZJBA 3PJTA 3M5ZA 4HD5A 3LNMA 1AG1O 3MUZ1 3WDPP 2ZX7A 2ZZ7A 3N2MA 1TJ1A 5C7HA 2YDAA 3E0VA 3SGZA 4ZR8A 5A5WA 3TU9A 3PWIA 4FLQA 4DELA 4AQLA 9CGTA 4OV4A 3T07A 4UTMA 3CB3A 1AQ0A 8XIMA 2EKGA 4GJ1A 1MZHA 2FPVA 4XUYA 4W93A 4CNOA 2VO5A 3LBCA 4L5ZA 2PEVA 3F5JA 2E40A 3T05A 2VDIA 3A3HA 1E70M 1GT8A 3ARQA 1JDDA 4BY3A 3UXAA 1XICA 4ZFCA 4DUOA 3NQ8A 3H26A 3R5EA 1W3HA 1R3YA 5DXXA 1SJDA 1CPUA 4XAYA 5GNYA 2J74A 1KFKA 4W5UA 4ZODA 3KXQA 4NZCA 4JQ3A 4J3XA 3N4FA 4ATLA 4JICA 1S1RA 3H2EA 2QYGA 3B4UA 5G4WA 3WF3A 1QNQA 3R25A 3W1TA 4NJJA 4KH2A 3UW6A 2YA2A 4GYKA 3DG6A 3WJYA 2Y7FA 1E73M 3AIQA 5CKSA 1TVNA 4FOJA 2BG5A 3WEMA 3LA4A 4Q33A 3PFRA 2VURA 5KETA 1GHSA 1KM2A 4PODA 1EGZA 4A2SA 3WQ5A 4F3HA 3LHWA 3G8EA 4H7ZA 4X60A 3W84A 3WD0A 1JUKA 1HW6A 3FGCA 3UESA 3CL7A 1G69A 3LCHA 2DZTA 2V8ZA 4PYSA 3N9RA 2X0HA 4NYYA 3WLRA 3WH9A 1XUZA 5J8LA 4XO7A 3B8IA 1JAEA 4B3LA 3EDDA 3PC0A 2J75A 3VOIA 5FJJA 3IACA 5FA5A 1OINA 4P8XA 2I56A 3H4GA 4LYKA 1SSGA 2YOCA 3UYIA 2POZA 2WMIB 4Q7NA 4MVAA 3TYCA 4LSBA 2J47A 3VKPA 4D1IA 3TUUA 1XR2A 2XDFA 4GYPC 2ZA2A 3TYDA 1AH0A 5EY5A 2VFFA 2OLSA 4C6JA 4OWGA 3GHSA 3HO8A 2VZTA 4UWMA 3RUBL 3S47A 1ZBWA 1ZHAA 2E6FA 1DWHM 1HIZA 3BSGA 4ZQNA 5FF2A 4MJ2A 2G3IA 4S39A 4LQ1A 4JN6A 3UPBA 3SCNA 1MDRA 1NSJA 4L1GA 4UQBA 1EC9A 3KBWA 4XSLA 5D37A 2X7WA 3WBWA 2RHGA 3NQ6A 3HM7A 3TXZA 1VFLA 3ZVIA 4KT2A 2QKFA 3G77A 4HU4A 3P8JA 5HPOA 4XBJA 1ADOA 2ZUUA 1E1EA 5ENLA 5I3HA 1DJHA 1UPPA 1LBLA 5FJTA 4M7TA 3M5VA 4HTYA 1XLHA 4OHQA 3BSMA 2YDSA 2PDMA 1AZ2A 2PCQA 2HTMA 1W5QA 3MP5A 3B9DA 3EDKA 4B2DA 4JTSA 1DJQA 4HN8A 3RR1A 3FDKA 2D22A 2A3HA 5FEPA 2WSYA 2J88A 4LCSA 3S5OA 1AW5A 1DPMA 1JDAA 5CGMA 1FWNA 3UJFA 1X1NA 4DQWA 3LCGA 3NVTA 3GYCA 1QHPA 3V7PA 4GXWA 3DHUA 4EXBA 4V1XA 3IJQA 2P8BA 3B8DA 2I9UA 3UERA 1RBAA 1TUFA 3IV8A 1E6XM 2E9LA 4XD6A 2X2YA 1SO4A 4TXEA 4GYJA 4E4FA 1QNOA 5I6SA 3VKKA 1O12A 4H7CA 1G6CA 2QCFA 1QATA 2VM8A 3NQEA 4IL0A 3S5YA 3A23A 4GQQA 2GJRA 3SN0A 1XX1A 4W85A 4OOZA 4B5NA 4MAVA 1VLIA 1K6AA 5HINA 3MKVA 3WX7A 3R0DA 3MI3A 3KM8A 1UD2A 1XKJA 1IEXA 4B3KA 1EL3A 4Q6XA 3CL6A 4DBEA 4XZNX 1NM9A 3G0SA 5FIPA 5C9WA 5A6BA 3VU2A 2J7DA 4B91A 2OWWA 2E68A 4AVNA 1DIOA 2ZIDA 3EDFA 3CL8A 4ZZ9A 4DO5A 3LBMA 4A29A 5AFDA 1US0A 3CV6A 1MQRA 1SO3A 1PVNA 1RR2A 1UWAA 3AYTA 3NR0A 1CXHA 6TIMA 4O8RA 1G67A 4CLMA 2ZTKA 2VWSA 4UCFA 2Z1VA 4PBFA 4C6PA 5JMUA 5FSDC 2XN0A 2Y5SA 1KRMA 3E02A 3EX2A 4AUBA 1O1HA 3ABZA 1Y5WA 5AYBA 3NQCA 4W4QA 1UW9A 2W6RA 3QGKC 1VPYA 3MZNA 3SB0A 2DV0A 1J5TA 3ICJA 2F6XA 4HT3A 5JBDA 1OQFA 1V8EA 1P6CA 5AN7A 3O6DA 3LCIA 2GLKA 2OR2A 3E2QA 3FEMA 4TTGA 3S8HA 4F40A 2G41A 3AI0A 3WL0A 3GRIA 3ATYA 3THDA 4GFIA 2V5CA 2OZ8A 1M7PA 1VBJA 2D3LA 3NO3A 3R0UA 1ITUA 3EBVA 3TJLA 4I90A 4JIPA 2PDNA 1R3RA 4LB4A 1YDNA 3VNDA 1H4PA 1R3WA 3OVGA 1AFSA 3WLMA 4U10A 3QC0A 4BK9A 3W6YA 4GKTA 1QI0A 2Z28A 3CASA 4DVOA 2AQOA 1RJPA 3GNOA 2R24A 1WQ5A 2VDHA 4YN5A 4AVOA 3S6DA 3PBMA 1TV7A 4NZ4A 5KMYA 3TTEA 3T2PA 2OKOA 2YZ5A 3GR4A 4WKFA 2GGEA 2QNEA 1NELA 4HQVA 1JPMA 3F4NA 3ITYA 5D38A 5FJIA 2ACUA 1QPKA 5EMKA 3HFYA 5DCDA 3CQ0A 3CUFA 1XRFA 3MS8A 4DX3A 2ZCGA 1XD1A 3F4DA 4UIOA 4OECA 1DORA 1ZP3A 3E12A 2D23A 4MJZA 3A3WA 4M6QA 2IXUA 5K7JA 1S5VA 1FUYA 2PU0A 4INFA 2BHYA 3ARXA 4JX4A 1W8GA 1P7TA 3A6OA 3AYSA 3STCA 3T0CA 5AY7A 5HDRA 1OX4A 1LWJA 2RKXA 4Z08A 2P88A 1W0MA 2EJAA 4C5YA 3TW7A 2PGWA 2EHHA 3CZEA 2PF0A 1WA3A 1GVRA 3T4WA 2BASA 5I3KA 2H8XA 3LCXA 3N2OA 5U7SA 4GIAA 3ANYA 4R9OA 4NAFA 2Z1WA 3R8HA 5AVHA 2Y70A 3BLDA 2XN1A 3PUDA 3AAMA 3QV7A 1FCUA 2PP3A 3M7SA 1KC7A 4UTWA 5DCEA 5M17A 4P61A 3OGSA 3MM8B 4LVBA 1ICPA 4H6KA 1DWFM 3CIXA 4EE9A 4KGLA 3KRZA 5DT5A 1L6WA 4HU0A 4NILA 4IFKA 1VCVA 2VNCA 3CIVA 3PP7A 1IWAA 1I9CB 3AOPA 3R0KA 7ODCA 2D2OA 2Q71A 3S83A 1POKA 1ONWA 4G7EB 1A5MC 3GLCA 2FZ8A 2B7OA 2YCKX 3UJ2A 1ISZA 2VC9A 4E3TA 4NXKA 4MWAB 3FAXA 2ZYFA 4BHYA 3GAYA 2YBUA 2B31A 3QQ0A 4I8YA 2XN2A 4WR3A 2UY5A 4PCFA 4FIRA 3UR2A 1J96A 3VD7A 4IX0A 4Y9PA 4GKLA 1GQKA 4ZTXA 2RGMA 4QXIA 4NX0A 3G5EA 3HQPA 5E0KA 1CXIA 1W9XA 1XDLA 3NVDA 4ZOEA 3U4AA 3NZPA 1H7OA 3VD5A 3KRBA 4M80A 3AROA 3TC3A 4QNEA 2AL2A 4N7QA 1BF2A 3MQTA 1XIHA 1FA2A 4IGNA 2EPNA 2WC4A 1L6YA 1QAPA 2AGKA 4DJED 1NQKA 3TA6A 3AZTA 4PFMA 3W81A 2WSRA 3GH4A 1EF3A 1QI4A 6PTDA 4DLFA 1OYAA 3QY7A 1U5VA 2A1YA 1KB3A 4Q4SA 3VM0A 1P43A 3V1PA 4AZ5A 4AXKA 3UR8A 3FY1A 3TIMA 3VDAA 1UUQA 4G2DA 4O52A 4K6AA 3WLPA 5DMYA 1AA1B 2PDUA 3WNLA 2QGHA 4M81A 3TW6A 2VQTA 4M5PA 3OQ8A 4JFSA 3KTSA 2DUZA 5D8WA 2VVSA 5I3DA 2DZPA 3WBXA 4A21A 2FDMA 1U1JA 4HJWA 4YJ5A 1C92A 1A50A 2I16A 3UZXA 1MWOA 3FA5A 3CT2A 4M0XA 1UBPC 2YKKA 3G6MA 3VABA 2PDBA 4QCEA 1XXXA 1OG6A 3O6CA 1J01A 4CN4A 1TPDA 1F3EA 3O3RA 1O1ZA 2D3NA 4MHBA 4HVXA 2EG6A 4TX8A 3WQCA 2EPOA 2A3LA 3KTCA 2FLIA 5FF3A 2ACQA 1DXEA 4XZIA 1MW2A 3BLLA 1OFAA 3CO4A 3ZXWA 4UR8A 2OELA 3NQFA 1Q6EA 4K38A 4H8VA 1PTAA 3N25A 4JTDA 3UQNA 2WQPA 2OJPA 2B4GA 1VH7A 3T4CA 1R85A 3VGFA 1GUVA 5KZMA 3QMSA 4B5TA 2PS2A 3MM7A 1RP8A 2F9RA 3K4DA 4KEUA 3IGHX 1MEIA 2EF9A 2PP0A 3QSTA 2SFPA 3OU8A 3WQVA 1IEWA 4EPEC 1QNSA 2ZTJA 3ITXA 1I0BA 1LT7A 3OR2B 1TX2A 2WHMA 3DOPA 1U2YA 3O06A 4CD7A 1IIGA 1DWJM 1Y5XA 4C1NB 3CHCA 4DJDD 4X22A 4XD3A 3M16A 1NVMA 3STFA 4AWEA 4JHZA 2IKIA 4DEFA 1TPB1 3L2IA 4K39A 2J8TA 1UKSA 4RZBA 4JTTA 3AJ7A 4H6RA 4O1AA 4GZ7A 4FXJA 3KFTA 1TRIA 3V1HA 2YBVA 2QQ6A 3JZEA 3VOCA 7A3HA 3TZNA 2YXOA 1ITCA 2P8CA 1GKRA 1PTDA 3SUUA 3DDMA 3TTSA 3VLYA 1W1B1 5XIAA 4J28A 3IJ6A 4WXYA 5CJNA 1T0OA 4AX7A 5D9NA 3G2GA 3T42A 2QMKA 2PP1A 1NTHA 4Q7IA 5C0QA 3C3NA 1TCDA 4ZSTA 4C6FA 2WO5A 4KEVA 1VFOA 4AZBA 5LZLA 3RX2A 1C3FA 1XJBA 2ZZ2A 4D8ZA 3PJXA 4UNIA 1XF0A 1J10A 3HOJA 2PZNA 1F5ZA 1THFD 1CIUA 3N2CA 1DKWA 2OX4A 3DFSA 2HPIA 4WJ8A 3T40A 5RUBA 3RLUA 4P8VA 2GQ3A 1MZRA 5T26A 3N14A 3GU1A 1F9CA 1EA0A 4IT1A 3CIWA 1VZWA 3ALFA 5A94A 3TEVA 3S46A 3PZ9A 1OX5A 1KXTA 1Q2SA 3ZSSA 3MSGA 4W8LA 3DFQA 5I5RA 4GMEA 2QUVA 2AAMA 2BXYA 1E1CB 2E8ZA 1CB7B 1OK4A 1OY0A 4G38A 2WV8A 2PWFA 3QM3A 3FXGA 4BEQA 1Q5MA 1G5AA 3QGVA 1R7AA 3M0IA 2EAWA 1EPVA 5M1TA 1Q4NX 1JGIA 4GEPA 2JE8A 4HMCA 2ZRUA 4I3GA 3CUXA 3DGRA 3MSRA 2Z4GA 3S0CA 1H49A 3CAQA 1A49A 3B9OA 5M2FX 2WMGA 4B90A 2QCLA 1BWVA 1YNQA 1PX4A 1RK6A 2J25A 2E6AA 4HZ7A 2BV9A 3EZ4A 4MY1A 1OZQA 1R2TA 1LWHA 1IEQA 2QPUA 1UMYA 2P5NA 1FQ0A 4LW7A 2V5DA 4EPBC 3EOUA 2A6NA 4CQAA 1Q6OA 2O9OA 1NU5A 2RDXA 3M0ZA 3TQKA 4NI3A 3MWAA 2XIOA 2DJLA 5A6LA 1H1ZA 4I9AA 4GX9A 3U0HA 1WZMA 4DJFD 2INFA 4O11A 4P7NA 5HOSA 1FWDC 1FXQA 4LUTB 2XU2A 4BWLC 3DFYA 3GBEA 1W6TA 1F3TA 1YADA 3WDJA 3B0HA 4NG3A 2DIJA 1XDMA 1EIXA 4H04A 4CN1A 3JR2A 4FB7A 2YLAA 3WUGA 1UP3A 3LGEA 3UWQA 5GJNA 2G3NA 2XM2A 1HNYA 1G7UA 4UQ9A 3LSBA 5B80A 2BODX 4DBDA 1XBYA 4WKAA 1ISWA 1WZAA 2ATSA 1JZ8A 4L4LA 1SZNA 3Q45A 1E3XA 1PS9A 3DG7A 4K2SA 2O9TA 3LXBA 3AXKA 4HOXA 3CU2A 3QBUA 2PWEA 4IP4A 3SUSA 1TKKA 1DXFA 2ADAA 1TR1A 3FJ4A 3CEPA 2PTXA 4PA8A 3CZJA 1QFEA 5HWNA 3P80A 1TIMA 1CDGA 3VX1A 4QEHA 3N1AA 4QS5A 4FHAA 4FR1A 3WNOA 1SU5A 4DZIA 4LBSA 5BOOA 4UTKA 2OQYA 3QFEA 2OEJA 3VNLA 1CGWA 4KRZA 1L6FA 4NZ5A 4I8DA 2GUYA 1TPEA 1UIPA 2OT1A 4IPJA 4LAOA 4AEEA 4DWSA 4REQB 4CNPA 2DIEA 4A4AA 4WCJA 3VDHA 3SUVA 3PZTA 3ALGA 2FJUB 2FFIA 1W1YA 2PCEA 9RUBA 2PRHA 2NQJA 1H0GA 5G4EA 2WC3A 2V4JB 1DYSA 1YXCA 5G1MA 1N8IA 1LZOA 5I06A 3SCQA 2OFJA 1F73A 4XD4A 2G37A 2EPMX 3VIGA 2X2GA 4Y9AA 3APTA 3QF0A 5E9XA 3OBKA 1MMFA 1X6UA 1UPMB 3VZXA 2DFAA 1MXSA 4P8WA 1XIIA 1ZFJA 1W5OA 4WGXA 3ZO9A 2QPSA 4HJFA 5I02A 3EA2A 3U4FA 2H3BA 1E9LA 2NWSA 5MKGA 3QW4B 4DUWA 4PUKA 2QCNA 1Q8AA 4MGGA 2ZVIA 2Y89A 2Z2AA 4GHRA 4UXDA 4MWAA 1JXJA 3MCMA 5CCZA 1UYQA 2PUZA 3CB8A 4HMEA 2VFEA 2X16A 2JF6A 1IF2A 3QSRA 1XYCA 1J0ZA 4HU3A 4LEFA 3RX3A 3W29A 4K8EA 2GUUA 3QR1A 4RNHA 4C6CA 1BHGA 2PWVA 3HB9A 1S5TA 4AZGA 4EPDC 1TMLA 2W63A 4PUEA 5TBOA 3ZVHB 3GR8A 3BLOA 2ZZ4A 1X1ZA 1K7XA 3BARA 1EJSC 4E38A 1XFBA 2QXWA 5HBFA 3N34A 3C8FA 2PLCA 2GUBA 3UVAA 3OLIA 4NSBA 4GGBA 4GFSA 2QUTA 5A2BA 1DQUA 2ZUMA 4IP5A 2FHBA 4XD5A 1YBQB 1VQTA 1OFRA 2DH3A 3JZUA 3CUZA 2R8WA 4YTSA 1SYTA 4DIAA 1US2A 4QM1A 2Y8VA 1E9ZB 3UNTA 5CGQA 2XGIA 5HULA 4O4VA 4O57A 2EG7A 3GXTA 5F4WA 3S6TA 3TE9A 3EWZA 2OEKA 3M0HA 3VYLA 3GVWA 2CFFA 3KAOA 2PPGA 1WNOA 3S1WA 4XG1A 3AXIA 1R0MA 2PD5A 3PAJA 3E1F1 1XD0A 1OFQA 3AQUA 3MWCA 3E0IA 2A85A 3UG4A 5D04C 2BB0A 1YDYA 5AHMA 5A2AA 2QCDA 1BAGA 2WKJA 2H90A 1EJRC 5D32A 1F74A 1LQ2A 4G56A 3MO4A 3NSMA 3L4TA 5CZTA 5FOOA 1EFZA 4CNNA 4Y7EA 4EANA 5CLTA 1TWWA 3GO2A 3VD3A 3N18A 1MDLA 2OQLA 1PE1A 3GW3A 2XHYA 3KEHA 2OX1A 3A13A 2DQWA 3M64A 4D2JA 2NUYA 2XWDA 3CHDA 5EMYA 3VKCA 3LRKA 2EO7A 3QN3A 2XVLA 3MMUA 4GNVA 4HTRA 3IV3A 4PSPA 1Z48A 5TNVA 4XKYA 4FXFA 3AHTA 2V5BA 4GVHA 4JPGA 4HIBA 2G50A 2ZUWA 2BGNE 3H4XA 4QJ3B 1PZ0A 3I4KA 3CPUA 3N2TA 3WMLA 1JDEA 3PJWA 1KW1A 3UCQA 2J9XA 3ZJ7A 4QR6A 1NDZA 1FWHC 3IK2A 1PYFA 3W1MA 4OBTA 3WLKX 4HB7A 3UNDA 1B31A 4FLOA 2GSEA 2ACSA 2P50A 3ARPA 4OTKA 1CYGA 3SBFA 2GJNA 3QJAA 3VIOA 2OODA 4US6A 1XYZA 2VTFA 3GEOA 3WSUA 1P0KA 5CC6A 3MHFA 3QV8A 2ZE0A 4ICCX 4UOJA 1TV2A 3UWYA 1EBGA 3WFLA 2R94A 1TV8A 4LAZA 2VEIA 1JCXA 3BW3A 3KBMA 4H19A 4UFIA 4LH8A 3VNZA 4KF1A 4JX5A 1AMKA 3R58A 4PBEA 3TWAA 2HEJA 4L80A 4O28A 2TYSA 2E6YA 3H2NA 3PSVA 4B9ZA 1XH0A 1PKLA 2ABAA 5IBXC 3FLUA 1KRAC 3RM9A 4KQNA 1P1MA 4PRRA 1Z6KA 3A9IA 4WF7A 4NRRA 4DPQA 1YE6A 2E77A 5LA1A 3MBFA 2QEZA 4DYKA 4ERAA 4U2ZA 1H41A 2PDLA 3SRHA 3LI0A 4UNKA 2WHLA 3PPCA 2NXHA 4UZUA 1NWUA 4H41A 4BF7A 1GVOA 8TIMA 2FGBA 4ASTA 1RPKA 2GJXA 2JKAA 4D9PA 2VZOA 2HISA 2WM0A 1JZ2A 3AIVA 3MKKA 3BOLA 1IT8A 4TIMA 3WLIA 4MNKA 2D0FA 1VIZA 1NWRA 1YHTA 1CLKA 1N82A 1SJCA 1ZNNA 3RNDA 1V77A 4BI5A 3CQIA 5EFFA 1GOXA 4J3WA 4MB4A 3DKLA 2WNQA 3JRKA 5CBJA 3CAVA 3A22A 4QCFA 5D8ZA 3IRSA 2NVCA 1KGUA 4KERA 3MMWA 1W9DM 4AZCB 1B3VA 4J1OA 3BLFA 5FEXA 5DX7A 2FHCA 3D46A 4CUCA 1KGXA 4LBRA 2C1GA 1ZBCA 4S3DA 1S2VA 1K8XA 4MB3A 1HL9A 3CUJA 3QKZA 4H9UA 2ZX6A 2PGFA 2E8YA 1Q65A 1QNPA 2VGIA 3UZJA 1KV8A 2JFEX 4JNMA 1X96A 3PNZA 1ODZA 2AQVA 3G1DA 4AD3A 2IW0A 3HA1A 4ZQOA 2PBGA 3SUTA 1FCVA 3GYEA 4QE4A 3LG3A 4W7VA 2O4QA 1PIGA 1EEPA 1OB0A 1FDZA 1LUCB 4V27A 4OQVA 2PC8A 5IHSA 5EPDA 1D9EA 5L6UA 2O0TA 1EA9C 1N55A 1GZGA 1TJRA 3MI2A 3W2LA 4W7UA 5FEWA 1QW9A 1EYEA 3L5AA 4S3JA 3I6RA 4PMJA 3SSZA 1LQAA 4JIRA 1WB0A 4IG2A 4S38A 4WRHA 3VFLA 4MFEA 3GNXA 3P2VA 4FNQA 2OWCA 3NQMA 4W87A 4UQDA 4KCWA 1SJBA 2P53A 3TXVA 1Q6DA 3GWQA 1IHIA 3QEZA 1ME7A 1JCLA 5FF0A 4PCTA 5F2MA 5I78A 2YLLA 6A3HA 3AXXA 3N2XA 2YFOA 3VZZA 5ABFA 3E0LA 3MUAA 1DQXA 4MKNA 3WLHA 3N4EA 4LF2A 3UFYA 4NUWA 3UXKA 3WUEA 3VLXA 3IUHA 4CD8A 3W22A 1YDOA 2NV1A 4HSNA 2W5FA 2Z29A 1S3HA 1PWMA 3PHAA 1UR0A 2E4TA 3D3FA 1LBFA 2WCSA 2GK1A 3EWWA 3MT1A 2OQHA 3GVGA 3HGOA 3KLKA 3K1DA 1TTQA 4ERGA 2GSJA 2WHKA 2WWDA 3LUTA 2Z24A 1NWTA 2VR2A 4DJEC 1BRLA 3KX6A 2ZQ0A 1WX0A 2CXEA 1REQA 3RHGA 1OF6A 1Z41A 1PCKA 3L4WA 2B7PA 4J27A 1QK0A 1R9XA 1UD6A 3O1NA 3CUHA 1V6YA 2V63A 2NUXA 2XSJB 1LL7A 4NXSA 4P2VA 1PXGA 3V4BA 5BXSA 1Q7QA 2JALA 4UOZA 1O5RA 1JYXA 3VFCA 2QJNA 3GTIA 1I45A 4IL2A 3S2JA 1MXGA 2HDJA 2QCCA 4EPKA 3VE7A 3IJ9A 2E6DA 2MNRA 3MUY1 4UFJA 3S9IA 4MJ4A 4KCVA 1P5BA 4AF0B 4IFOA 5CQ1A 5H6HA 4C6KA 2PD9A 3QPZA 3U9IA 1IGSA 1JPHA 4L9XA 3HFTA 5EMUA 1MQQA 5AYXA 4NJGA 2RH9A 2EPLX 2QHAA 1EX1A 3ZVHA 5E6YA 2PDHA 2YB1A 2ZXBA 4YTQA 5LHFA 3W7PA 4GY1A 4BI7A 1GVSA 4D6EA 2XTKA 2AL1A 2G4JA 4MYXA 2HXUA 3GHRA 4WK9A 4AZHA 2VUYA 4HA4A 3IAQA 3M47A 3UWVA 3F5KA 4KFPA 4HHMA 4G1KA 1F3WA 3STEA 4F4RA 3FV9A 2FZDA 5FL1A 1SW7A 3LBOA 3BJSA 4RV8A 4EX4A 4MDOA 2RUSA 4IMEA 4G1NA 1S2AA 1S39A 5I00A 3BV7A 1P0EA 1TV3A 3O0KA 5AZ0A 4QSHA 2NXGA 4O13A 4NZFA 4P7RA 1DWAM 5C70A 3HGJA 4QSFA 3VOFA 1XGEA 3UBPC 1GK8A 1B4EA 3PANA 2DORA 5D2VA 2OGJA 1HJWA 2CKRA 3W0KA 4KMQA 4LNYA 4JR5A 3IJIA 1BYBA 4RK8A 3M0YA 2A7RA 3DIPA 4DJDC 3BLEA 3M41A 3GTNA 2CNCA 2E3ZA 2AKJA 5A6KA 1J2WA 4JD4A 3W6MA 4H83A 2DZAA 4GVFA 5HR7A 3NTYA 2RDUA 3HQOA 2ZXAA 1FH8A 2ZX9A 1UR8A 1GOQA 4MIMA 1OZMA 3CZ8A 4A22A 2IQ0A 2O55A 3PTKA 2IPFA 4CKQA 4P7OA 1RPXA 2DPEA 4TMCA 3ITLA 4U5KA 3K8MA 2ZUVA 4ML4A 3O8AA 3HG3A 2CZ5A 4PN2A 1QPNA 3OODA 4I7UA 1RY0A 4E2DA 2DUXA 1K1DA 1WP6A 3BURA 1ZZMA 3ZQ9A 3B0VC 1JULA 5AC4A 1SR9A 1H5YA 1JPKA 2CIPA 3G1YA 3KCLA 1CGUA 5D30A 3WQDA 1GEQA 4C1LA 1EYWA 1PUDA 1F6PA 1GYLA 3A24A 2WNWA 2C13A 2J6VA 1W3LA 3KHJA 5DEZA 3TTOA 4AOPA 3QYQA 4QJ1A 5CBBA 3DYMA 2OZTA 4ZO9A 3BGGA 3NZRA 2XH7A 3WLSA 2JEPA 3PVFA 1Q6RA 3AUOA 1GJUA 3BG5A 1XUUA 3WK0A 4MDPA 3ZJKA 2VEGA 5AB3A 1NH6A 3ARRA 4QGCA 2YW3A 2J7BA 2Z6JA 3HQ1A 3WO8A 1CEOA 5D2WA 1PDYA 3GK0A 3IARA 1DXIA 4GCAA 1GQIA 2OSXA 2CZVA 4OBRA 2F38A 4ZOAA 1E0TA 3OVQA 1LOSA 2Y7DA 1AOPA 2FVKA 5CC3A 1I6NA 4EAMA 1F76A 3VDGA 5AOPA 2GVGA 3VIMA 2Y24A 4DWDA 1PX8A 2QV4A 3RO8A 4D6FA 3S4TA 3P74A 7PTDA 4YCPA 1DP0A 4ICMA 1NOWA 4DZHA 3W37A 2EPHA 4HPXA 2WYSA 3VUSA 4QDWA 4WDTA 3F2DA 3PZNA 3TLQA 2PDFA 4NHVA 3GG7A 3JW7A 4LFYA 1JZ4A 3MJYA 1TE6A 3NDZA 4FLRA 3W1RA 1OD0A 2WPBA 1E1FA 4H9MA 1KA9F 2FZBA 1VF8A 2Y61A 1EX5A 3WBYA 2A7NA 4TV5A 3VKJA 2ZRWA 4QJ4B 3T9PA 2PTZA 3MM9B 1SM9A 1XLJA 2BDQA 2OOFA 4HNTA 3E0FA 4XSMA 4DJFC 3BLPX 3BGAA 1RBOB 1PHWA 2XIBA 1VJSA 3WF2A 4RL3A 1R8LA 1H62A 3SCRA 5D02A 2VCAA 3MA8A 3T0AA 2IKJA 4S1FA 3MSYA 1UZHA 3WY1A 1O68A 3IUIA 3QYSA 3N9SA 4GX8A 5E70A 2F7FA 3GDRA 4YHEA 4TO8A 4OT7A 1QK2A 3HQNA 4AZIA 1TUXA 2A7PA 2X8RA 1P1XA 2VKZG 5HQEA 3AALA 5HNRA 3UCCA 4FZIA 2HRWA 4MNLA 4A3YA 7CGTA 3TX9A 1FWCC 5CH9A 3QV9A 3THUA 3OP2A 5BOEA 1JVNA 5B7ZA 1VYRA 3EEGA 1V6TA 2Q01A 2DU2A 1XQLA 3IEBA 4EAYA 3CV1A 1R38A 3MC5A 3MHGA 4DHGA 4NI8A 3V5FA 2CU0A 3QR0A 4PCSA 3B8SA 3ZMRA 2CLKA 1PIIA 1YKWA 4ACZB 4XZWA 2ZX5A 1AJZA 2TMDA 3N6HA 2DVUA 3NXFA 1XBXA 3CLMA 4A3QA 4PTVA 3EMCA 1H11A 3HGRA 3OLDA 4H8UA 3OIXA 4W7WA 3BCJA 1TWDA 2WANA 1UD5A 4ZBCA 5JUVA 8A3HA 1AVAA 4KWWA 3VILA 4XQ6A 5IHRA 3HG4A 3CZKA 3O16A 1I60A 3MHUA 4Y9NA 5A6TC 3K46A 1A80A 3BLIA 4QG8A 3MVTA 4D8AA 1W91A 2REQB 1A5LC 2NX9A 1BGGA 3ITCA 4E3VA 1RA5A 2GSHA 4WVXA 4HU8A 2VGFA 4KFNA 3WF0A 2GOKA 3V16A 4HP5A 2DIKA 4M7SA 4UTTA 4O16A 4DY1A 3QGAC 5F2IA 4PUJA 4EACA 3OHIA 4W86A 5CAHA 1TA3B 1T7LA 3P5ZA 1RVGA 1DBTA 2WVVA 2BVDA 1AQFA 4L9YA 1TWZA 1H60A 1UJPA 4JTQA 1RJRA 4TU1A 3T2QA 4XZHA 4PH6A 1YDVA 3A64A 3O05A 4JCLA 3SFKA 1QNVA 2XSAA 2TRSA 1FCBA 3OGVA 3WBAA 4FNTA 1AH3A 3VO0A 1XFCA 4QBXA 1LCOA 4JIQA 1A53A 1ZAJA 2GVYA 4NQ1A 3EWYA 1A5NC 1G94A 1RXOB 4DBSA 4NYUA 3OPSA 3LHVA 1Z32X 5CG7A 3SQLA 4UFKA 4US5D 2H6RA 5KSWA 1YYAA 3FYOA 2VZSA 1Q63A 8RUCA 1JG9A 2I9EA 2Z27A 3OVPA 2YR1A 1S3TC 5EMJA 2C1HA 4KIRA 4WHBA 2VUNA 1GQJA 3MI6A 3R6IA 3W00A 4KWOA 4QX4A 3LTYA 1UR2A 4MJMA 2RGLA 3OLGA 3QLLA 1TPUA 2OPJA 5KINA 5K9DA 5F4SA 3GDLA 5A2CA 3GG8A 3NQVA 4AYGA 4IPIA 1Y5VA 3OYZA 4O1EA 3LNPA 4HK6A 1BSLA 1E15A 1ENUA 5FACA 3Q94A 2UV8G 2VELA 3CYVA 8GEPA 1B30A 4U3AA 6ALDA 2WVSA 3FS2A 4ALDA 2BY3A 3GXPA 1OGBA 1FP9A 2IKHA 3PTQA 4K7YA 4WX2A 1W1IE 4R3UA 4FK9A 3SQMA 4R7WA 2DT2A 2W66A 3C2EA 1P4CA 3R10A 3W7MA 4L7ZA 2D69A 5AC8A 3SN1A 1ZALA 3PZGA 3W1AA 1JCTA 3W7QA 4A05A 3BMWA 2YXXA 3K4WA 3THCA 3P7YA 1RD6A 4F0SA 4JN8A 5FCZA 3RM8A 1XLIA 2D24A 1GKPA 3K8KA 3VIKA 7REQA 3VGGA 3BJTA 4X9SA 3DECA 2ZC8A 4H2CA 4XIMA 1A5SA 3A4JA 3AWNA 1T99A 1JYVA 1OM0A 3BVJA 1E4NA 3PM6A 2GOUA 7GEPA 4MNMA 2V3FA 3V18A 3TCSA 5GPRA 1RCQA 4MZYA 4IGMA 2J9YA 4X2PA 3LZ5A 1E6SM 1EH9A 3S9ZA 2XZ9A 2YJQA 1JCMP 4R34A 2IPWA 4IGHA 5HXMA 1UD3A 3II1A 1DJGA 3PR2A 2QCGA 1RSCA 1LRQA 2PODA 2H9AA 3MDUA 2EXOA 4O0KA 2OTDA 4O1CA 1B0IA 1MW0A 5CZ0A 3GFZA 1ZGDA 1LLOA 4DUXA 4GJJA 2PDKA 5SWUA 1XLGA 4QROA 3UJRA 1XIGA 3NSNA 4RR4A 2OCZA 4UFHA 1Q7MA 2FMOA 4Z0JA 1EPXA 3E9AA 3GNNA 4JKMA 1PEZA 2C7FA 3FGCB 1W2PA 3SIMA 2DGAA 2PTYA 4L4MA 1XYFA 4GINA 4C6LA 3H8AA 4OBSA 2WNZA 2QDEA 4JEQA 4PCNA 1AQHA 3URAA 2CBIA 4FNUA 1N8FA 2HNHA 3S42A 3DHFA 3BAXA 1SW3A 3N12A 5CC7A 2ESCA 3H23A 3UD6A 2IKGA 4D72A 4Q8OA 3B8UA 1VP5A 2QJJA 1BVWA 1WAUA 4UR9A 5H8MA 1LQ0A 3IIVA 4EP8C 1Q13A 3VIIA 3T8LA 3EX1A 3NPUA 3TYZA 4O54A 3E2VA 3VCCA 4I9JA 3W1XA 5T91A 1R46A 2L5HA 2VT0A 3HU7A 1BD0A 1RP9A 4JTCA 1GYMA 3UPWA 4Q8NA 2CXGA 3QLDA 1EDQA 3VMOA 1I75A 4ENLA 3IANA 2PTWA 5JH1A 3AMKA 4L1WA 2BTMA 4H9VA 4WJEA 1KFBA 1VHCA 4PULA 4GI8A 3WLQA 4JTRA 4LWWA 5BMXA 1ONRA 1ADSA 1EQPA 4WSKA 2VFGA 5TD4A 5CSRA 1HKMA 1EP3A 3UY7A 3P0XA 2JEQA 1JXKA 3GDBA 1D8WA 3S9YA 3PWGA 4L1XA 3TQVA 1WKYA 2I7GA 5D9OA 3NGFA 3RK8A 3KCJA 1JAKA 2J8GA 2YYUA 4FXRA 3B0GA 3POHA 3N73A 2FB3A 2WQDA 4GH1A 4W89A 2OZ0A 1L6GA 1G0CA 4C6IA 5HUOA 4L6DA 1K9EA 2BZNA 3M0XA 4G6CA 3WFAA 3VOJA 1QBAA 4MOZA 1RLCL 3I7SA 5HAOA 3TAOA 1Q6FA 4Q4PA 4RDVA 4XAFA 3PWAA 3OQEA 5LNSA 2ODOA 3EOEA 1JCYA 4ADUA 4HPHA 1WDPA 2AKMA 2TODA 2X7VA 3TKFA 1DIEA 2QUUA 1X6LA 1R3TA 3BAKA 4C5ZA 1HT6A 4D6HA 5I2UA 1WYIA 2ZE3A 3T0DA 3EMZA 1V03A 3IGUA 4HYRA 2BP1A 3E74A 3THAA 5K3VA 2R91A 2LLEA 4E8DA 4IISA 4JY8A 3QY8A 1RY8A 4GD0A 5JIPA 1JIBA 4GIYA 1F8MA 3A47A 1BXNA 4DO4A 1UC5A 2AQWA 1EC7A 1X8CA 3KOZA 1UUMA 2BOFX 5A6BD 3PFMA 2GPTA 4MZ8A 5XINA 2INZA 1F7BA 1LLWA 3FAWA 3LCWA 4AY8A 3MYPA 3A12A 3L9CA 4IM4A 5I77A 1FWSA 4ZL1A 1DQWA 1FWGC 5HANA 4QQ3A 4UOQA 1V93A 4BF5A 1OGSA 1MEHA 1W54A 3WQ6A 3DFPA 4AYSA 5HWJA 2F84A 5H1WA 1A0CA 4CEXC 4C90A 3TYAA 5E0CA 1UZ1A 3W73A 3UPMA 3GDTA 3LM3A 5E9AA 1O94A 1B3ZA 2B0MA 4GC3A 3LRMA 1MUCA 3EPMA 4R7OA 1ALDA 4IFRA 4HPNA 1VBRA 3P5YA 1MFVA 4ILSA 3KCOA 1MXDA 4ZE5A 2XJ7A 2PRLA 1JRBA 4D6IA 1PBGA 4XX6A 3QZ6A 4U2YA 3UETA 1BKSA 4PTDA 4ZCWA 2ZWZA 2OYLA 3QQ1A 1QR7A 1MEWA 4A3RA 1I1WA 3WLNA 1Z7AA 3BQ5A 3ARYA 3QFWA 3FK4A 4DRSA 3HPAA 1ZJAA 2NQHA 3L23A 2PDIA 1RCXB 3GVVA 2GZXA 2OYKA 3KDOA 3W76A 1W56A 2QVHA 3W7KA 1A3XA 2W9MA 2E9BA 1JDFA 1ZAIA 3G0XA 2J13A 2G3FA 4MAZA 2Z2BA 3LI1A 2WPGA 2Y62A 3Q4DA 2EG8A 1AJ0A 1YXDA 2KX9A 2AMGA 4DYJA 3LV5A 4WOZA 2GGHA 1HX0A 1WUEA 3LGGA 1TELA 4JNZA 3OBEA 1NIUA 2ZUTA 4M3PA 1A5AA 2PB1A 4UCGA 3T09A 3ITGA 2WBKA 4KCUA 2J24A 4OZOA 6REQA 3UWWA 3H7VA 4L9ZA 3VNYA 2WHJA 3ZT6A 2HBXA 4JN7A 4LGXA 3ZR6A 3UZZA 1DJIA 1I2NA 2X1SA 2WWCA 1FHLA 3LV6A 3O2LA 3VA8A 2VC7A 4AIBA 1P7TB 3JVAA 4HTBA 4EK7A 1PB0A 1OX4B 3BC9A 4PUMA 3MMBA 3GC4A 3H54A 3KRUA 3ZR5A 2WNNA 2DVXA 1B57A 1YEYA 2X42A 4ADTA 2FGZA 3QRHA 4UTJA 5IOBA 4RXGA 3SY5A 4GUFA 3M4HA 1TB3A 1M7JA 4Y8FA 1E0WA 3BOFA 4I6KA 4OU1A 5AZ1A 1JNDA 2J7CA 3ZS4A 5A6AA 2G3MA 3S1VA 1DEDA 4NAFB 1ONEA 1RVKA 2VX5A 3DC0A 3NPVA 5A6SA 4H2HA 4FALA 4AC7C 3UY8A 1W2VA 4JNYA 4S3EA 4JFUA 3GTXA 5K2ZA 2QULA 2VGBA 5EBUA 2V67A 4Z1YA 4RDWA 4IFKB 2F61A 3RM4A 3TQ0A 3R11A 3TSMA 5EKYA 1IR2A 2ISDA 3WK2A 2G4FA 3I3DA 5M3WA 1J6OA 4OFCA 3OIHA 3FA4A 3NWRA 1ISVA 1ZTVA 4CD4A 1T96A 2FH6A 4TOQA 2I5QA 4G7FA 4R88A 1IXNA 1TWSA 1IYXA 1TZ9A 4H3DA 2JKEA 4AX6A 2W62A 1RD5A 4ONVA 4FP1A 1EDTA 2X30A 3SCTA 2FB2A 1YLVA 2OYMA 4X2RA 1IEVA 1JYWA 1PKMA 2PLJA 2YDQA 1O6IA 2CLLA 1JCJA 1ICSA 1W3JA 2PDPA 3EKZA 3IJ7A 2JK2A 1K7EA 1C90A 1EHAA 1XI3A 2W0UA 1OT1A 3MANA 3IUDA 2QPXA 3U2OA 3KBVA 1WXYA 4JTLA 1OABA 2AL2B 1H09A 1EUAA 5DRIA 2PZ0A 3KS5A 4BJHA 2ZX8A 4JHMA 5FAJA 3HGSA 4CCDA 3L0NA 4B3ZA 1UZDA 1VB9A 4I9MA 3PUEA 1RK5A 1E72M 2FQIA 2QJIA 4FO4A 3N4AA 4GQGA 1VS1A 4FMVA 3D0CA 1DJYA 1I2OA 1EKOA 1K8YA 4MPQA 2ISWA 3B0JA 2VI0A 3VIHA 2QDDA 1MW3A 5CPSA 3FYPA 1DJXA 3W25A 1CW2A 5CC5A 4F9DA 2C79A 3BWWA 3GVQA 3UP8A 4TX9A 3UXLA 5KZ6A 3WDIA 1AL8A 1HQTA 2Y0FA 2DDXA 1ZJ9A 3FVMA 3R8GA 3P62A 1YPXA 2NQZA 3TSDA 2VMFA 3CM4A 3WH8A 1NFGA 2VCCA 3RITA 3I6EA 1V6UA 1H7WA 2Y7GA 2FYMA 3EKGA 3REQB 4NZ3A 4CQDA 3G1SA 3GXIA 4LEQA 1FWEC 1E6ZA 5BMWA 3S5SA 1EXBA 2J78A 2NT0A 5EMMA 3VM7A 1XLAA 1BWKA 4FR6A 4ML9A 1S2UA 4ORMA 5H2ZA 1BTMA 1UWSA 3NM3A 3B40A 4XWUA 4DBWA 1IWBA 3BG3A 2V6AA 1V4YA 3PBGA 1ISXA 1GZ1A 4MNJA 3UWZA 1J0HA 1LL6A 1HO4A 3KL5A 1LLZA 3RDKA 3DN5A 1M68A 1CLXA 3EMQA 3B0YA 4OE7A 4HN4A 3JU2A 3P0WA 1TVPA 3ZLHA 5J5RA 1F3XA 3LPOA 2VRQA 1KM6A 3LPFA 4XTDA 2UWFA 3VKAA 3VTRA 1CECA 5I24A 4DXXA 2XGZA 4AD2A 3N19B 1JI2A 5G2IA 2PGRA 1I4NA 5AYIA 4DF1A 3BAWA 3D47A 3I6TA 3U6WA 2E67A 3MM7B 3W1NA 2QIIA 3WMSA 1JYNA 4YLWA 4QLKA 4C91A 4FOKA 1TZ7A 3CUGA 2YL9A 1WBJA 4A8NA 4IPLA 1BYAA 1JPIA 1XV8A 4C6EA 1A4MA 3AHVA 3GHTA 1WAWA 2GGJA 3S2CA 3UXIA 4F2UA 4IPNB 3MJMA 4IMAA 1HJUA 1YTKA 4GI4A 1XL9A 4MZ1A 1VHNA 4PMYA 5LIYX 3K30A 2CZEA 3G3MA 4XBSA 3HPXA 4UFMA 3E2RA 3ANVA 3CO8A 1PJ9A 1NY1A 4BQ2A 4NASA 3N29A 4NJHA 2VX6A 5BOFA 2RAGA 2V3GA 1YPIA 1DTUA 4RNIA 4PMUA 3GBDA 2NVDA 1SZGA 3LDVA 1Q6GA 1B3WA 3MMCB 1E3ZA 2A4AA 4P7LA 3M44A 3EKLA 5CZJA 1VYSX 5LNVA 1KCLA 1JR1A 5BU6A 4JTAA 2V68A 3I65A 1NDWA 1QW8A 3UCDA 2HXTA 3RIKA 4JL2A 5JIWA 5ABTA 2V5LA 3NDOA 3Q67A 4Y9OA 3HURA 2ZDRA 3LD5A 4L64A 5D4YA 1XLMA 4WKHA 4LF1A 3UXDA 1SVDA 3TZFA 1O5KA 3SGGA 1HZYA 4YXGA 2HROA 3VC5A 5LXXA 4FAMA 4YYFA 1TPC1 2I17A 3VIJA 3M6DA 4O0QA 5CSUA 1R2SA 1YW1A 4YMZA 1QNRA 2QJMA 3N3TA 4IMFA 1JDCA 1WDWA 1HGYA 4UTHA 1U30A 3NEHA 4B9YA 5A6JA 4WEVX 1P0DA 3W7HA 2H3DA 5E09A 1V3IA 1DWIM 2CLEA 4PTWA 3GH5A 4Q4KA 4PUDA 1V08A 2ONEA 3BLKA 2ZDSA 5I7GA 2YCLA 4FNPA 2Z00A 5D09A 3IK4A 1EZ2A 1X1OA 1OF8A 1LT8A 3BAYA 2ZKMX 4MTVA 5BYWA 2Z7GA 3SRKA 3C6CA 4U4MA 4HNNA 1TPVA 2VJXA 1VCGA 1E56A 3V36A 2ATMA 4UZSA 1R2RA 3VGHA 3ERPA 2HE8A 4LAUA 5BNKA 5I0DA 3KLLA 5EBAA 3SUWA 4KWSA 4F48A 3E49A 1JQXA 3NCOA 4HNOA 3L5LA 1G7VA 4OUEA 3EB2A 1VJZA 1CX9A 3SEPA 3RPDA 2ZA3A 2OSYA 4EKJA 2IUZA 1GOOA 2PDQA 4IHCA 1EBHA 2VEKA 3MUXA 1LOLA 2HPMA 1ZJ8A 5REQA 4M29A 1ZBKA 3NQBA 3T55A 1XQKA 2E5DA 4F79A 2DJXA 1CTNA 3TAKA 3OG2A 3BAJA 3O6AA 3UA4A 2ZADA 1YNYA 3U3HA 3K8LA 1PZ2A 1L2UA 5KITA 4GXMA 4DF2A 1HKKA 3OZMA 1CNVA 1QT1A 3AS3A 3EEZA 3R13A 4IJCA 3WLJA 1K8CA 4NNAA 3ITVA 4AD4A 4XUGA 3S1XA 4LB3A 4WLCA 1Z3NA 4D6JA 4AIUA 4XIAA 4IQEA 3W38A 4GY7A 3IIOA 2E25A 2QF7A 3QPYA 4LUYA 1GHRA 2YL5A 2DZUA 3EWCA 4C1KA 4MWAE 1M7OA 1GG1A 3GW0A 1XSIA 4KESA 1KXHA 2PC4A 3NL5A 2AOPA 1IZCA 4LYQA 4PE8A 3FEQA 4NZ1A 4E5TA 2G0WA 2Z1XA 1D3GA 3RGTA 1IT0A 4Q8WA 3AWOA 4J7RA 4Q22A 7TAAA 2IQDA 5CGTA 2CZFA 4DWSB 4FSAA 3ZT5A 2V2DA 2C0HA 2BBFA 3OTRA 4AHQA 1GVQA 3USZA 4ZGYA 4GRSA 3GXNA 1EQCA 2OLHA 2QCEA 4J5NA 3B8VA 4DAIA 1A4LA 1Z42A 3K13A 5A8QA 4H1ZA 3W28A 2J6XA 5HA7A 2R82A 1J6PA 2XIQA 5E6ZA 5JXQA 1FOBA 2CW6A 4GC4A 1XRVA 2Z1SA 3N6JA 3TROA 4Y8EA 4K36A 4B92A 3VDBA 4ATWA 3HG2A 4NJIA 1KQYA 5MKGB 3SCUA 2V9DA 4AHPA 2PLKA 1TO3A 1J0JA 3G3DA 4MWAD 1ME9A 3FSTA 1CT5A 3W24A 4LC8A 1LWIA 3M1ZA 4Q4OA 2QR6A 1QCWA 4KW2A 4GZJA 1XLLA 4ZB2A 1ZLPA 2WK2A 4GIEA 1VFHA 1VJIA 1JF5A 2J79A 4TX6A 5A8NA 4AVFA 3DENA 2IPGA 5I03A 3MU7A 3CMFA 3PBYA 4IP7A 4L6OA 2NX1A 3KVLA 3DC8A 3J7HA 1FHVA 1W8SA 3AO0A 4JTGA 3B9EA 1FH7A 1F8IA 4EWJA 1SJAA 5HUPA 2W67A 2NXIA 5HQMA 5BXRA 1VCFA 3TYEA 2A3BA 1Z9AA 4HYVA 3AZRA 1ZQ5A 3PBWA 4UMBA 5LNUA 1QPOA 3CAKA 1IQ8A 3KZPA 4JTKA 3PNUA 3O63A 1CCWB 3T08A 1R6WA 2CESA 1CLVA 4AY7A 4ADSA 3VNJA 4RZ4A 2RDWA 3WDQA 2WJDA 2DW7A 4M19A 2CKSA 2FVMA 1KR1A 4RNFA 4NX5A 1A3HA 5IRPA 5I07A 3CHVA 1V79A 1DJNA 1KO0A 5DY2A 3WQFA 4QP0A 3V5CA 4N9EA 3AMLA 1MSSA 3WK3A 4EXQA 1KFLA 1WXZA 4Y9MA 1ZJHA 3LXAA 1TPFA 4H00A 3PTDA 1K03A 2F8QA 4D1JA 4NZJA 3REQA 2HK1A 1H7XA 4LRSA 2CLIA 4XAZA 4GBDA 2IPJA 5LHEA 3B8WA 3BW2A 1ZL1A 4AWTA 3R2GA 5FEZA 3RFAA 5KTLA 2QCDB 1S2WA 2O4MA 3A4WA 1NAL1 1Y8BA 1FX6A 1BWLA 3GG0A 4C6BA 4O15A 1QU4A 1W1PA 2V81A 1W1ZA 4QLJA 1JZ7A 3WQOA 2YCJA 4E8CA 1P48A 3H6OA 2D2HA 4HA3A 3D5HA 4LNCA 3GDKA 1KM1A 3NSXA 3CPGA 3PJUA 4DNMA 4ZB5A 2ASHA 1JUBA 4TVCA 3W86A 1PKYA 4LUSB 3CTTA 2BVYA 1SO5A 3W7JA 4NL1A 2BS9A 3XISA 3BH4A 4FOUA 4CVUA 4XKYB 3CT7A 1EXPA 4WDXA 1OD8A 3P6LA 3LTPA 3GIYA 3BE7A 4Y90A 4NKCA 1J9YA 2XIJA 4JX6A 3QR3A 3QHOA 4K68A 1MW1A 3T44A 3LQGA 5GNZA 3EAUA 3N13A 1CB2A 4N42A 5HR6A 3RILA 3NO1A 3OO2A 4MUZA 4X61A 4LUIA 1E6RA 4AW7A 3CHEA 1ZU8A 4PUUA 1BG4A 3PUGA 1JCNA 5L9FA 3OJGA 2PURA 1QOPA 1Q6CA 3L4XA 2HCVA 1FDJA 1H1YA 1HXJA 2FHFA 3KL0A 3LHUA 5FAGA 3B0XA 4GOAA 3VKRA 2E9MA 3P14A 3W75A 1ICQA 5HMFA 4ZE4A 3TJIA 4GYPA 1LP6A 5CXPA 1TREA 4ZENA 2XPKA 3BPWA 3S3GA 1BXBA 3TR2A 4LY4A 3APGA 1DVJA 3SIZA 3IRDA 4JOMA 3MMCA 2IS7A 2PF8A 1EGMA 1MVYA 1UCWA 4YVVA 3NAVA 1S5MA 1P0BA 3B97A 3L0KA 5J5DA 1UOKA 2QAPA 5HWMA 1M7XA 1G4PA 1JRCA 1JZ6A 1E71M 3S5ZA 1RQBA 2QMJA 3WEZA 4W88A 1OCJA 3OVRA 2W92A 4POCA 2QJHA 4EF8A 4DZ5A 1W9BM 3QPEA 3WMCA 4CQ8A 3KE0A 3B3DA 4ZOBA 1UJQA 3W88A 1NARA 2GQAA 2HJPA 3W74A 2C16A 3O7UA 2AMXA 4H9TA 3QMTA 3SO7A 2X41A 3EB4A 4BZYA 3HJZA 2FTWA 3HPZA 4RPQA 3UZYA 2GJXB 5H8PA 1E6QM 3W83A 3MV11 1WKEA 1PSCA 4QG6A 3MMAA 3OW1A 4I9TA 3CMJA 1GVFA 2PMQA 3W2MA 4J3UA 5GNXA 2DUAA 1XP3A 3C2RA 4NNCA 5A8PA 1EUNA 1HVQA 3AC0A 1R3QA 2QGYA 4IQLA 4B5XA 2GDUA 1R47A 4XVDA 2G5WA 5DCBA 2BNJA 3BXWA 4W8BA 1F6YA 4NP7A 1GOKA 3G1HA 3MM5A 1H3GA 1KKOA 1U5HA 3MDWA 4JQ1A 4FS9A 3ZFHA 3RLGA 1HP4A 2X0YA 1L6SA 2Y85A 3WEOA 1KCKA 1B4KA 3OLEA 3INPA 2BY2A 2C15A 1O5XA 5DBUA 2ZZ6A 3GU9A 4TUFA 4ACYA 4AISA 4Z42C 2PDCA 1GVYA 3STGA 1K9TA 1PCWA 1V0LA 3W27A 2BOGX 4CQBA 3HV8A 3G24A 2WKGA 1ITXA 1E0VA 3G1VA 5DFAA 3A3XA 3BCDA 5DELA 4P7QA 1TV5A 4UTWC 4O19A 1TJPA 2FPYA 4OUIA 1F2JA 3ONBA 2HZGA 4HMNA 4HPJA 1TTIA 2E1WA 2R1PA 4JKLA 1C91A 1FP8A 1VFMA 1W1A1 3ZJ6A 1UKTA 1NF7A 4N4PA 4IG2B 2FZMA 3CV7A 2WM1A 3KBSA 3T0BA 2XG9A 5EYWA 4QHRA 3AHYA 2WVUA 2QCMA 2ZBTA 1XLFA 3UZ5A 1TJ0A 1U22A 2ZXQA 4GABA 4J4KA 1TTPA 4RDYA 3ES7A 4GI9A 4FX7A 3NGJA 1UA7A 5ABFB 1EF2A 1U5JA 2O7QA 1FVPA 3KBJA 3AU2A 2CZDA 1LRNA 2GDVA 4ROPA 2Z6IA 4GQ0A 1LOQA 2A5HA 2J66A 4MSSA 1OFEA 2GFTA 5LSMA 3L68A 3OR1A 3AFBA 3M6YA 3SN4A 2VFHA 1RBLA 3B4YA 1XH2A 1SW0A 3AIBA 2GK1B 3GY1A 4PBGA 4QRNA 3LLDA 3C61A 5BROA 1KLZA 1VKFA 3CWHA 1NF0A 3T81A 1J0KA 2QUNA 2WJZA 1XLKA 1F4AA 3BMVA 1BRLB 1O7AA 3W23A 2DSKA 3T7VA 1REQB 1FWFC 4LBUA 2NW0A 1TE1A 1TYGA 4UNLA 1ZCOA 2QUMA 3D3AA 1N7KA 4QIUA 2WZHA 2WMJA 3FKKA 3FW6A 4J2PA 2YBTA 1EO5A 3W87A 4OV9A 2QIWA 1X38A 2FFCA 5CPMA 2J27A 3CWOX 2Z26A 3UWEA 1E6NA 2VL4A 2V3EA 2YL6A 4PRWA 4NRSA 2W61A 1UKPA 5DQPA 2KZHA 1XRSA 2Q02A 3IS4A 4EVZA 3AXHA 2V3DA 1E4LA 3KWXA 4CEUC 4WD0A 1XLDA 4AWSA 4DZAA 3WCZA 5DO8A 1D8CA 2P1FA 4O1DA 7XIMA 4MB1A 3I4EA 4WY0A 4I6VA 4YTTA 4TTUA 1JL8A 9XIMA 3PBVA 5E93A 3RRAA 1A5CA 3CH9A 3H55A 1ZCCA 3H2MA 2WZIA 3IVSA 2CBJA 1FXPA 3VOHA 1XC6A 1R5YA 2V30A 2O9RA 2E28A 3TC6A 1QI3A 1QUMA 5ABGA 5MHBA 3SRFA 1HUVA 3RLHA 5GEPA 3WQ8A 4LAMA 1TZZA 2Q8XA 1GYNA 4GNKB 5LIKX 1GTEA 2GQ8A 4HZMA 2ALRA 5HMDA 4MFDA 3CH0A 3U7VA 3TFXA 3ZR4A 3AXMA 3NQAA 2YSWA 2WMHA 1B3OA 2NLIA 5M03A 3V75A 3IIZA 1KQZA 1HG3A 2Q6ZA 5A8OA 2GDQA 4JQ2A 1IXOA 4C65A 2OO0A 4LPCA 5FESA 4B16A 1O95A 3G0UA 2YFNA 1GQNA 2QF8A 3TMQA 1QMLA 5FF7A 4NAEA 4E4PA 1A0EA 4WZHA 1MQPA 4N2YA 1IZJA 1KM4A 4GI6A 4CD6A 1EWEA 3B9AA 2E0PA 3SRDA 4Y6GA 3L4UA 1L8NA 2I57A 4Q8UA 2DH2A 4AMAA 4HZ6A 3GNPA 3R94A 4LS0A 1OADA 2CITA 3WJSA 1BFNA 2NX3A 5GQBA 3ZT7A 4GJIA 2ISFA 5DXYA 4TMBA 4GUHA 4AXNA 1BYCA 1SFTA 4Z1AA 5HQLA 2CBVA 3WENA 1V02A 1PZ1A 3SDOA 4PCPA 1SQ7A 4PMXA 4JFVA 2HV5A 4M1RA 3TYUA 4JY9A 5LA0A 3TR9A 1SO6A 4V2XA 1J0IA 1UD8A 1AD1A 1ZJIA 2YXGA 4A8LA 3WNPA 1W17A 3WD3A 3S1GA 1GTHA 2OZ3A 3W2NA 4CCEA 3HPFA 3B0MA 1KLYA 2XH4A 2YCIX 2I1OA 3QOKA 4LUSA 5CG0A 1JZ5A 1KM3A 1K4HA 1E43A 2Y2WA 1O4UA 1UASA 4JS3A 1FKWA 2C18A 3LPPA 4JFTA 4KKXA 4Z17A 3GAKA 1C9WA 1FCQA 4RZ6A 2VCBA 4FPSA 3PAOA 5K9CA 4KRUA 3V0UA 7TIMA 1LJYA 3UG8A 4O10A 3S6OA 4PGLA 4H7VA 2DZVA 1JQVA 1V0MA 2NVAA 3IGXA 3G1FA 5HPCA 2CHNA 3COTA 3P67A 3RN6A 5LNWA 1V5XA 1RZMA 1GQLA 2QCHA 3UYCA 3LPGA 4O0ZA 5BCAA 3ZWTA 1NDYA 2YGYA 1XCFA 1KV5A 4R9XA 2W91A 4IQJA 1V0NA 1T8QA 3CHFA 2J77A 1KWGA 5BXTA 1A3WA 5E0FA 2WCGA 4PMRA 4TQTA 3MCNA 1WCGA 3SSJA 1FWIC 2YL8A 4S3BA 3LSCA 4IMCA 4HNVA 1JPDX 3F7JA 4ZQRA 1E55A 1I2PA 2RJHA 2VRKA 2WJEA 3L66A 4HMDA 3DFTA 3ZIZA 1WOAA 4KEZA 1KTBA 4ZA0A 4BF9A 2HK0A 5AHIA 5JH2A 1NOFA 3EOSA 2WZTA 4YYCA 1H7PA 2DSZA 3QTPA 1MI3A 1XG3A 2PDYA 3N11A 1QASA 2JBMA 3PTMA 3LHTA 1R30A 2BHUA 3AYVA 3DAQA 4GE8A 4S3AA 4LUJA 4BFAA 3UG5A 5DY3A 1TWIA 3ARTA 4IUGA 1R86A 2QT3A 1CXFA 1V3HA 4KS0A 1FWRA 1NDVA 2OG9A 3EPOA 4IXXA 3W7IA 1YMYA 4LS1A 1D2KA 2CYGA 3NNTA 1ME8A 4GO9A 4UBPC 1Y7VA 1UR1A 1RV8A 5C7VA 3EOLA 4AC1X 4MKVA 1E0XA 1M65A 1TJ2A 3PZVA 3OEXA 3PULA 4DYEA 2X0SA 4L56A 1D3CA 2G3JA 3H4WA 1IGWA 4U28A 1EP1A 2PBOA 1OCQA 4H4IA 2C6QA 1W31A 1LRTA 1XIJA 3CBWA 3VKBA 5CEWA 1UKOA 3ARZA 1K6WA 4ZEPA 4IMGA 1EJ7L 3T2OA 1OBAA 3GD6A 3JS3A 3ATZA 3WKZA 3NM1A 1OCBA 3R1ZA 4PEKA 2PDGA 3RCMA 2DZXA 3LS9A 3SI9A 1B90A 3FNDA 5BWAA 4PB3A 1Q7ZA 2D20A 2CWNA 3MM6A 4JIIX 3VD9A 1H51A 1EHNA 1NP2A 5DF0A 4DWSC 1CXLA 4HNLA 4JDBA 2G95A 3MW7A 3LK6A 1KWKA 2EBNA 4PFHA 4XVEA 5JVLA 5G2WA 4AMCA 3TYBA 5BWFA 4Y2WA 3KTXA 4E4UA 4H9XA 3EXRA 2Z7KA 3WQPA 1T8XA 5C2CA 3TVAA 2XISA 3VINA 5EA9A 3SR7A 1UMLA 3W7EA 4M8UA 4RE3A 3ZOAA 3WDHA 4ZO7A 2YX0A 4GCXA 4F2BA 3OB8A 2QW5A 3G18A 1UQYA 2X1RA 1RHCA 4LVDA 2PTDA 4YHGA 2VFIA 3RX4A 3W1PA 3HMCA 3GX9A 1C29A 1LTDA 4PUNA 2FTPA 1R9YA 2VEPA 3B0NA 1IWPA 4BS0A 4A35A 3LYEA 3LLXA 1RJQA 2PWUA 3T78A 3W1LA 3S2NA 4MWAC 1QO2A 3KDNA 1KTNA 1UROA 5C55A 2WVVB 1FWBC 3QC3A 2GL5A 4RZ5A 1UWRA 4WSHA 1IE7C 4GISA 3T0TA 1XG4A 3DERA 1KBJA 1QVBA 3DXIA 4S2CA 4U31A 2BHZA 1V3MA 4JKKA 2VX4A 4JYEA 3ONCA 4ZB0A 3U7BA 2CLMA 1J2BA 4M24A 1B3XA 1VR6A 6CGTA 2Z1KA 1RA0A 1VBHA 6ENLA 3WLTA 3SECA 3RCNA 4HSOA 3W01A 5LIUX 3DKJA 4F0HA 2FMNA 3W9ZA 4L6HA 2ZRVA 1Q6QA 1I2QA 2XSXA 2X09A 4J3TA 2IXVA 3FHQA 3QHNA 2B7NA 2ZZ5A 2PWHA 4P5UA 5TIMA 4QEEA 4BWLA 2CHOA 3ISIX 1BTCA 3BUVA 3MMTA 3OZPA 3MUIA 3A4XA 5HMEA 1WKDA 1GVEA 2MANA 2NQ5A 3H21A 3SGUA 2TAAA 5LXEA 2XVGA 1I0DA 5CLWA 4PMZA 3VD4A 1GOIA 1W1TA 3GNDA 1AL7A 3NL3A 2XM1A 3C52A 4PMQA 5DMNA 3K4AA 2C19A 1KTCA 1P6BA 1GOMA 1YTDA 3DBNA 1CI1A 5FF4A 2EKCA 1OJXA 2Y6ZA 3GHUA 3L4VA 4D6CA 3M07A 1FWJC 2X1IA 4B5UA 3FX4A 1V3JA 4IPPA 2CCRA 3WF1A 4IJBA 2ACRA 1XDJA 4L4PA 1W3KA 2FPTA 1OYBA 4C6DA 2BX7A 2V2HA 1VEMA 4AD5A 4AZ7A 1XYMA 5I23A 3DFHA 2EPKX 4F0MA 3NEVA 3B9NA 5CPOA 4AD0A 4AB4A 2BGSA 4GACA 4UQCA 1IIHA 4GYFA 4K1GA 2OXNA 1M1BA 4IIHA 4FA3A 3LCLA 7REQB 3GNRA 1JD9A 3HTWA 4CU7A 1XW8A 2X40A 3U5YA 2PDJA 4FNRA 3TONA 2Y63A 5D03A 2Z2UA 4QAWA 1Q85A 1A5KC 1EJWC 3C0QA 3WQEA 3RR4A 3ZLGA 2DT3A 6XIMA 1G4EA 4B5VA 2XIMA 4X63A 5FI8A 3ITOA 4B5SA 3W72A 2WSPA 3TC7A 5A69A 3NIYA 1CZ1A 4QFUA 1EJXC 2WSKA 4GQRA 1SSDA 1XGZA 3WD1A 1UH2A 4MUPA 2P3ZA 4MB5A 1IV8A 3ID7A 3LMZA 3V0SA 3KVKA 4LS2A 1V7AA 4LY8A 1SPQA 4IZGA 2H9AB 3KOYA 4N6EA 1H1NA 1QDSA 4NNBA 5EU9A 4XB3A 2R1NA 2WMIA 4YPJA 3GTFA 4FF5A 1XYBA 1M01A 1UR9A 4LAKA 3ZWSA 2Q8LA 4B4HA 2Y8UA 2AAAA 1GG0A 1LG1A 3P8IA 1F61A 3OG3A 4H9YA 1YTEA 4QDPA 4QLLA 5F1UA 1AMYA 1FFQA 1WXJA 3TP4A 1KM5A 4PSRA 4C60A 3ABSA 1QXLA 3MO7A 2GJLA 3P84A 4Z1BA 2CHRA 4W8AA 5D2YA 2QJGA 4AWUA 1J4EA 1HFBA 1V51A 3F5LA 1SUXA 1I8JA 1U33A 3A9BA 3GZ3A 3RO6A 1LM1A 1VBUA 3C2YA 2POTA 4Q4MA 1KXQA 4I5UA 4HNCA 1GPWA 4G9PA 1OFBA 4UQAA 4AU0A 3M9YA 2R9RA 3AUJA 1MRQA 5KZDA 4HKPA 4JYDA 1MRAA 1NQ6A 3GM8A 1LORA 1E40A 2Q8ZA 4OIFA 3WUFA 3AIEA 4O18A 3HN3A 4F66A 4OOUA 3L2LA 1H0IA 3ME3A 3IVUA 4QDMA 5K4XA 1PYMA 1XINA 2JGYA 1VPXA 2DVTA 3TLLA 2NQLA 2XFRA 1WDQA 1NWSA 4ZXOA 4JXCA 3RXZA 3UR5A 4N0RA 3DH7A 3U2ZA 2ZRYA 2W3ZA 1L9WA 3EX3A 4F0KA 2F6KA 4PMVA 4J40A 5DT7A 3LHYA 4JTJA 2OGYA 1AW2A 1UHVA 4ZO8A 2YDRA 2BLEA 4IIGA 4AHOA 3M5YA 4HZ8A 3RJXA 1X7IA 4DLMA 1XGDA 5KZEA 3W70A 5FJUA 1O5QA 5C5YA 2GVLA 3E96A 3W6LA 3QXBA 2CC0A 3XIMA 1YNPA 1OT2A 2PI6A 4V33A 1ZBVA 3LERA 1J12A 2HVOA 2XSBA 5TAOA 2GGIA 4RW5A 3DFOA 3MP4A 3W71A 2VC5A 1LDCA 1B3YA 3RPMA 1UKQA 5B7YA 4LYRA 2OU4A 3VMPA 3C2OA 1QHZA 4JIEA 3CQKA 5M5DA 1AUSL 1V3LA 3KL3A 2O56A 4LVGA 1VEPA 2NZLA 3M43A 1UZ4A 2ZVRA 2VEFA 3U48A 2C0AA 3T1GA 4G39A 1XIFA 3WF4A 1PDZA 5C71A 2X1TA 4LV4A 4M6VA 4UB9A 4YWSA 4CNUA 3SCPA 4GXPA 3U2CA 4M6UA 4W5ZA 1FFRA 3SFWA 4YIWA 2PDXA 4OVXA 3WJXA 2G96A 1CWYA 3WNNA 3EXSA 1B9ZA 2HVNA 1XRTA 1JUEA 4AIEA 1TX0A 1B9BA 2XH2A 5I3JA 1IEIA 1R3VA 4GVGA 3H22A 3TNOA 2Z25A 3PZUA 1DJZA 1OCNA 3VGDA 5G2HA 1G9HA 3S2LA 3WUBA 3EDJA 3BO9A 4K37A 4PMDA 4EOUA 1KRCC 1GOWA 1HL8A 2A0NA 1KXVA 1O60A 2DEPA 2VR5A 3LRLA 2D0GA 5IFTA 1G4SA 3FDGA 3CZLA 3C4UA 2BGQA 3FFSA 3WNMA 3B0UX 1U83A 4HPGA 5IBXA 4ZXLA 2ISSA 3ZJ8A 3BL3A 5I09A 1XYAA 1NOUA 4PR4A 4DF0A 3W1QA 3AMCA 3GXDA 1UH4A 3NZQA 3GUWA 1DE5A 4G8TA 4O1FA 2O92A 3VKSA 3PPFA 1UQZA 4NVTA 3VE9A 1H7NA 4FEZA 2ZOXA 4I5RA 1S46A 4JEJA 3GKAA 5T8GA 1C7SA 1L2QA 4UTLA 1OG0A 3CZGA 1ZP4A 3P82A 4HK7A 3MVIA 3TOYA 5A8MA 4N9CA 2HBVA 1E4IA 3F4CA 3ABXA 5FKYA 2XINA 2ZXDA 2EGZA 1BVNP 4GBUA 4I5XA 4JQ4A 1QI2A 2Y8KA 2NV9A 1KRBC 1SMAA 5T9CE 1G01A 1T5AA 3IIXA 3H2FA 1WDRA 2D2JA 3E38A 4UMCA 3B06A 3RRXA 5LKYA 5C9UA 4D6DA 3URNA 1RCOB 3R43A 4NF7A 1S1PA 1DHPA 2V5JA 3CNYA 2TPSA 3LQLA 1AK5A 2FTYA 2EJ1A 1GCYA 3N04A 4U33A 2GVEA 3NPWA 2D0HA 3O0FA 4X0NA 5A1AA 1Q6LA 4QQUA 4XAPA 4ECLA 3VAVA 5F7UA 1US3A 3T8QA 2Y1HA 5AECA 1KBLA 5ABHA 1RQHA 1UUOA 5ECUA 1BQGA 2J9ZA 2PWDA 2C91A 4NJKA 1XCXA 4N02A 4LVFA 1YE4A 4AZ6A 3L0GA 1QBBA 3MZ2A 4JYFA 2R1KA 4E0CA 2YYTA 1PKNA 6REQB 5ECVA 3WD4A 2Y88A 5A95A 4JIHA 1SMDA 3MM8A 1WDSA 4WUIA 4IF2A 4B4FA 5CAKA 4ORIA 2GYIA 3R89A 1AJ2A 3WL1A 3MMBB 3PB2A 3BJFA 1M04A 2PA6A 4B15A 1UP0A 1MNZA 3RLVA 2E5CA 4S3GA 1TV4A 3B04A 3H24A 4KBXA 1W37A 1UA3A 3EPNA 2A79A 2MUCA 4IGSA 1V6WA 1JEZA 5BU9A 1EDGA 3TK7A 4F2TA 4G7EA 2DP3A 1JNEA 4ZOCA 4PTXA 5J04A 1PV8A 1QPRA 4NU7A 3TA9A 2XH0A 4LXFA 3AIUA 3CEUA 3WK1A 3MMDA 4CQCA 4F9JA 4RW3A 3ARVA 1U1UA 4LJ3A 5F4XA 1W9UA 3B03A 1KFCA 2WB5A 5D9PA 3VZYA 5LGZA 1KBKA 3MB9A 1QRQA 4GPNA 5IDIA 5BRPA 3ZLFA 1NP0A 4H6EA 1L0PA 4XO6A 3W7GA 4IIEA 2ZA1A 2E09A 2A6LA 1KM0A 1VEOA 1DTNA 3F03K 3EWUA 1OX6A 5MF5A 3L4YA 4DJEA 1RUSA 3MSDA 4Q8TA 3P81A 1X7FA 1OC7A 1QWGA 2X1UA 1HKIA 3UU0A 2I5GA 5EL1A 4R33A 2GQ9A 3GU2A 3QVQA 3U8GA 3UVIA 4K3ZA 5AHEA 3USBA 4EF9A 2TSYA 1BPLB 3U2EA 1UIOA 1TMHA 3HJEA 3QW3A 3NOEA 4PMOA 7ENLA 3IGSA 1HO1A 3WN6A 1E5NA 5JQ9A 1R7OA 1XPYA 2QVNA 5C6MA 4YS1A 5DN1A 3ZM8A 3LHZA 4UTFA 2WJFA 4MYAA 1EZWA 1HN1A 4CD5A 3CMGA 3TSBA 1MFUA 4L65A 1OVDA 3FOKA 3R79A 4TV6A 1K8ZA 5C8BB 3HBLA 4CCCA 3DESA 1HJQA 5G5IA 1P0NA 3DFNA 4R53A 4MPKA 4CNTA 3QOMA 4JCMA 3VDCA 3C56A 2R14A 5BZAA 2GGGA 3HPSA 2Q3RA 1OC6A 3TN6A 4MM1A 5HNTA 2ZWYA 1KCZA 3QZEA 4M51A 4PB5A 3O6YX 1IT7A 1X39A 3WQ4A 1WE5A 4JTFA 4W9TA 3AISA 1QOXA 3XINA 3RMJA 4LOCA 2XZ7A 3Q65A 1ZY9A 2WKLA 1UWUA 2BSLA 1E0UA 1VRXA 2VC6A 1OEPA 5FJPA 1MNSA 2HNEA 1XPGA 3TH6A 1ZRQA 1WDDA 3AS1A 3K1GA 1UR3M 3VUPA 5DRCA 2JQXA 2KAUC 4LCQA 1WBHA 2P76A 3Q2DA 3W7OA 4E2BA 3OBAA 3V3WA 3LCFA 4C6MA 3H7UA 3OR2A 4YVXA 3QKEA 3EB3A 3IPWA 4O8AA 2ICSA 3KRSA 3LU2A 3DHPA 2QLYA 3VK5A 2CPUA 1XYLA 3PZOA 4HHLA 4C1NA 4K8GA 3O9NA 1XH1A 2C14A 4J2MA 1I2RA 3DX5A 5G1TA 3NA8A 4DJDA 5C9ZA 4S3FA 1QOQA 1EP2A 2ZZ1A 2PDWA 3TN3A 4UTIA 4TVDA 3V5OA 4D6GA 5T9BG 5DANA 1XHGA 4M6PA 2P0OA 3HIJA 3W7LA 5BXPA 1VGAA 5GJMA 4L4OA 2OSWA 4J3VA 2FVLA 4JTIA 4HHHA 3I3BA 3GXMA 2VVNA 4ZQMA 4RPPA 3E5PA 4KWUA 2R6OA 3VGBA 3ITTA 2BVTA 1KFEA 5EFDA 4B2DD 4YL2A 4KFOA 3EWXA 1W1VA 1VPQA 2NSXA 1T41A 4RXFA 2I5IA 3URQA 3GG1A 4ES4A 3POCA 5G1YA 1B2YA 4FF7A 4AEOA 4MG4A 2R1MA 3GFXA 1F05A 3TNBA 2P0IA 3WZ0E 3OA5A 3HF3A 1VLWA 4O14A 3QMRA 1QPQA 3JUGA 3ANUA 4MLJA 2Y5EA 1JFHA 1Z69A 4GLEA 1S2TA 4U3CA 4H8NA 5HMSA 1ESWA 1O66A 4GO8A 1HGWA 3AS2A 3V0TA 3F4WA 1XLBA 1SZRA 4K7VA 3LLFA 4QJ5B 3GIPA 5C9XA 3NQ7A 5LA2A 1ZS2A 3V35A 3SW6A 2A2IA 3EYPA 1LL4A 1KBIA 3G1RA 3TV8A 1XBZA 3WD2A 2C3ZA 4CCZA 3CK5A 1RH9A 3W82A 2WMKA 3NO5A 4XISA 4FXSA 1R3SA 3NL2A 1VIWA 4UTTC 1BKHA 3DI1A 4GA8A 4QS6A 3WH5A 3UWUA 2WBGA 3PPGA 1QWKA 1K9FA 2EEXA 3TJXA 2E5BA 1DL3A 2OB3A 2W4XA 2FKPA 3GC2A 3ABOA 1BYDA 1E1CA 1XIDA 3QH2A 1TR9A 4GH3A 2FGLA 4KEMA 2OOGA 4N9BA 4Q4QA 4UMAA 1A5OC 2JKPA 3RYSA 1AD4A 5HJLA 3DU0A 1KD0A 3QTGA 4O17A 4UC5A 3R7MA 4EIVA 1UBSA 1F6KA 4IXHA 4QE1A 1QJWA 3NYDA 1EWDA 3HMJG 1CGYA 3GFYA 3ES8A 1BQCA 4H9ZA 2CLOA 1YX1A 3NUKA 3FN9A 2P10A 3NYZA 3ZZ1A 4DXVA 4XBKA 1GPFA 3BAIA 4DUVA 3DI0A 1SR0A 4ZTYA 1GW9A 3LGDA 2E1DA 3VIFA 2J7EA 3PUOA 2YCLB 1LYXA 5FL0A 2OMAA 3UJSA 1TSIA 1XSJA 1SZFA 4O50A 4NT0A 4FNSA 5AHNA 3WIJA 1IXQA 1PX3A 2VRJA 4DJFA 4LUTA 5C2XA 2OT0A 3VMNA 4J35A 1WV2A 4CU8A 4IIFA 5EB8A 5A6MA 4V28A 3VIPA 3CXOA 3K2GA 3VKQA 4N6FA 4JTUA 4HYWA 4UQEA 3M7WA 3MPGA 1VD6A 3M0LA 4GZEA 4U5IA 1AODA 1SZEA 4XZMX 5D2XA 2A3AA 1AW1A 5F2GA 6TAAA 1WZKA 5C9RA 3BQ6A 3EGJA 5AC5A 4WIWA 4WQ6A 3BG9A 2HQAA 1G4TA 3EWDA 2WMFA 3NZ1A 3SADA 1UG6A 2CERA 3FIGA 1GGOA 5REQB 2WOQA 4YVPA 3YPIA 1E9YB 1X8FA 1ZSXA 2XFYA 3BV4A 2A3CA 1Q8JA 1A0DA 2JIWA 5EGRA 4URIA 3GTHA 2DZBA 1TPWA 5LNRA 1YQ2A 1WO2A 1EJVC 1EOMA 2XFWA 3RU8X 3LZ3A 5AC6A 1PAMA 3DYOA 1KBBA 1PHQA 1GW1A 2VGGA 3A21A 3H70A 4REQA 4YTRA 1A47A 1FWAC 2YW4A 4JQAA 3TDFA 2PGEA 4MY8A 3T6CA 3ORWA 3CYJA 3O07A 4RE4A 2HS6A 5BRBA 1ZAHA 4UFLA 2V4JA 1JI1A 1HKWA 2D73A 4MADA 3P60A 3F4VA 1HL2A 3O15A 1ECEA 4D8LA 1J0YA 1VFUA 2UY4A 2FH8A 1DOSA 2BFGA 2PFHA 2VENA 4LU0A 5CSSA 2VDGA 3I3EA 4P8UA 2VQUA 1DE6A 4GZIA 2J4GA 1FTXA 3A5VA 1FDYA 3THQA 3C8NA 1TPH1 3H53A 1NEYA 1UOZA 1N8WA 4M1BA 1XIMA 1MYRA 4GK8A 4M56A 3NFUA 5CPQA 2WZEA 1CENA 1JFXA 1C8VA 3VM1A 5IDZA 1OFPA 3U57A 2HSAA 2O7SA 2NUWA 1C93A 2VZVA 3F1QA 1OC5A 1K02A 1PTGA 3WH7A 1E6PA 1LG2A 1DIKA 4HK5A 3GIQA 2YA0A 1C8YA 1NFPA 2E7FA 3N17A 4AG0A 5AYZA 3SCOA 1BVZA 5H8UA 1BXCA 1JGMA 4A3HA 2QZRA 5CBIA 2VOMA 2WVTA 2VXNA 2Z1BA 3S2MA 3WQWA 2HS8A 1ONXA 3G6LA 1M3UA 3Q37A 3UGRA 3C2FA 2B81A 2QAFA 4O4WA 2YIHA 4HOZA 2HMCA 1S5WA 5I79A 1HKJA 1YBQA 5AHFA 2G97A 3PK7A 2OKTA 3SURA 3CTLA 2W79A 4L61A 3FVDA 4GVIA 3VXGA 4OGZA 4LALA 2CWXA 3FA3A 2WLYA 4OKDA 5GVJA 1IXPA 4LTSA 4BR1A 4IWWA 1IZKA 3IIPA 4GUIA 3L2MA 4ICNA 1W9VA 2VR4A 4PMNA 3W07A 3S5NA 4HA1A 3W4RA 4YWIA 3IJ8A 3CWNA 3W26A 4XTIA 1AZ1A 1K7FA 2V0TA 3SAZA 3TJ4A 1XWYA 1VBGA 3GQYA 2PU1A 1OGGA 3N9KA 3APYA 4TR9A 2XVNA 1BLIA 1M03A 1OIMA 3I7QA 4IMDA 4K8HA 3KW3A 3EDEA 4LYPA 3F2BA 3L21A 1LROA 1VFTA 3NQ2A 3H2OA 3BZJA 5HATA 1WOBA 1OFDA 3B8TA 3TN5A 3W7CA 5I3GA 5CJMA 1B5TA 1W5NA 3L67A 3DEQA 5IXEA 1H2JA 4I7VA 1CGTA 1UC4A 5AYYA 3WELA 1TTJA 2PSNA 1KCXA 2EQDA 1GEHA 3UR7A 2DSUA 5GJPA 4PL1A 4IIBA 1D3HA 4S3KA 1JD7A 4Q6JA 1Q45A 3KBNA 3W85A 5CZSA 4C6QA 3G22A 3BGJA 3OA3A 4YU1A 3W02A 4UTUA 1I1XA 3UEQA 4Z1DA 4YCOA 4TVUA 1TG7A 3P93A 4JDYA 1YXYA 1GONA 1H63A 3AIRA 2ZZ3A 5LIWX 2NV2A 4WJXA 1E5JA 2W27A 1SFLA 1B1YA 2XIIA 2XVKA 4LANA 2ZRXA 4R85A 3WNKA 4EXAA 1HVXA 1GJWA 5F2LA 4K1WA 4ZMGA 3M0KA 2YZRA 3VM5A 3QZAA 2VD8A 4R5EA 4QTGA 4JFWA 4O53A 2ANUA 5LIXX 3LMYA 3KP1A 4LVAA 4Z2HA 1KFWA 1PWLA 3DCPA 2V69A 1EGVA 3CC1A 3M0VA 3LB0A 4HCDA 3AJXA 3OOQA 2WC7A 2JIEA 1CBGA 4CU6A 1A5BA 2HE5A 3TWBA 1UD4A 1EEXA 5CPLA 1TQJA 3PB0A 3I7RA 1DJWA 3EOOA 3HV9A 1XIEA 5DMMA 3NQGA 2OEMA 4UUIA 5JBFA 3RF9A 3WG6A 3DGBA 1WUFA 1ITQA 3DHDA 4B5WA 4WGHA 1FWTA 3L4ZA 3IWPA 1FHDA 4KPLA 5H91A 4LCRA 1Q2RA 1FH9A 4KRTA 3OYXA 1W9PA 3P3BA 5LYRA 4HHPA 3AS0A 4XZLX 4G5DA 3W2JA 2QDGA 1W5MA 4R27A 4MF4A 1M6JA 3M5XA 3I68A 4ATDA 3NG3A 5AOUA 1V3KA 1GZJA 2YB4A 3FXYA 4DN1A 1YRRA 3KWSA 5AVNA 4XZ9A 3AMGA 4GWEA 3SCVA 1XLEA