4S39A

Ispg in complex with hmbpp
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
401
structure length
400
Chain Sequence
MRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
total genus 140
structure length 400
sequence length 401
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s39A01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s39A02
5JQ9A 2E7FA 4S3AA 4S3EA 4G39A 4DJDD 3H2NA 2AKJA 3H21A 4CCZA 2XSJB 3VM0A 4NHVA 4S3BA 4PZVA 3VKRA 5AOPA 1Q8AA 3K13A 1EYEA 1AD4A 3TR9A 3TZFA 4S38A 3B0GA 3TZNA 3B0HA 3H2OA 4DJFA 1Q85A 3B0JA 3H2FA 3MMBB 3TYCA 3MMCB 1AOPA 4GEPA 3H2CA 3VLYA 3TYUA 4S39A 3VLXA 4DJED 2GEPA 1TX0A 4D9PA 4DJEC 3MM6B 1Q8JA 3H2AA 3TYZA 3MM9A 3H23A 2YCLA 3B0NA 3B0MA 3MM7B 2V4JB 2YCIX 2BMBA 3MM5B 3VKTA 2AOPA 1ZJ9A 4O0QA 3MMCA 2H9AA 4MWAA 4O1FA 3OR1A 2OGYA 4S3CA 4MWAD 4DJDA 1AD1A 3NOYA 3H22A 3MCOA 3MM6A 3MCNA 4DJFC 1AJZA 3GEOA 3TYBA 3MM8B 2YCLB 4AOPA 3VM1A 3MM7A 2DZBA 4DAFA 2V4JA 3OR2B 8GEPA 3MM5A 4S3DA 2Y0FA 4S3FA 4MWAC 3H2EA 4MWAB 3MMAA 4NILA 3MCMA 1Q7QA 1TWWA 4S23A 4G38A 2DQWA 4DJEA 1AJ2A 2XSJA 4O1EA 6GEPA 2VEFA 3TYAA 3TYDA 4C1NB 3BOFA 3AOPA 1TWSA 2Y5JA 4MWAE 3V5OA 1TX2A 4DB7A 3MMAB 4HTRA 3TYEA 3VKPA 4NIRA 1F6YA 1Q7MA 3B0LA 1AJ0A 4DJFD 4G9PA 4HB7A 1ZJ8A 3VLZA 4C1NA 2VP8A 1TWZA 3MM9B 1Q7ZA 2YCKX 3VKQA 2VEGA 4D8ZA 4NL1A 3H24A 3MM8A 3H26A 4DAIA 4D8AA 3VKSA 2H9AB 2Y5SA 2YCJA 3H2MA 3OR1B 7GEPA 2DZAA 3BOLA 5GEPA 3OR2A 3MMBA 4DJDC
chains in the Genus database with same CATH superfamily
3H4XA 2YLLA 1HG3A 2DSVA 3MYPA 2WM1A 4LSBA 2QR6A 2CHRA 4NQ1A 2PP1A 1BF2A 2QIIA 3PS7A 4YTRA 2ZX5A 3H8AA 4LEFA 3EOSA 3T0BA 1ITUA 1FWAC 3B8SA 3GG0A 4GJJA 3TYCA 2ZXAA 4JQ3A 3MKVA 1LOQA 3QTGA 1ZBWA 3AZRA 4I8YA 3VM5A 2G95A 4EANA 1ZHAA 1QU4A 3G1DA 1J8VA 4DN1A 4BJHA 3S3GA 3CV6A 3CS2A 1W1A1 3BV7A 1H50A 1M7JA 3THUA 1T5AA 1DWGM 3EWWA 1R3YA 3B9OA 3MVIA 4G56A 2CBJA 3MM8B 4L9ZA 2V67A 4LAZA 3V16A 2YW4A 2POZA 3ITVA 4F66A 1K6AA 2Z27A 1QNPA 5HANA 1M9HA 3Q4DA 3RG6A 2X7VA 5F2MA 5G4EA 3VCRA 4E5TA 5KETA 1I75A 1NDYA 1FWWA 2AL1A 1IIHA 1MEIA 3TIMA 4PUKA 1XSKA 1W3HA 1ITCA 4NXKA 2JKAA 3PK7A 2C14A 2DZXA 6CGTA 1IXNA 2V8ZA 1UKQA 3WLQA 3TAOA 5DEZA 3CYVA 1CXHA 3IUIA 3ZIZA 4Q4SA 3EXRA 2Z25A 1Q6OA 1E40A 2CETA 2QULA 3GXTA 3IIOA 3B0GA 3QW3A 3TXZA 1PX4A 2BHUA 3LUTA 3GRIA 3P61A 2I56A 3LPGA 4FSAA 1HJWA 4X0NA 3MZNA 4H8VA 3TX9A 3TQ0A 4O50A 5BWFA 2QCCA 1XRSA 4K7YA 4Z1BA 4Q4OA 4O11A 1J0HA 3ZFHA 2GQAA 1M03A 2PP0A 4BF9A 3J7HA 4I7WA 3VGBA 3C2EA 1Z7AA 1U2YA 2DY3A 3BVJA 1U1UA 1TV4A 2PTWA 3QEZA 4S3DA 4Y6GA 3G1HA 3FYYA 3WENA 4TX8A 3UWUA 4NX5A 4AHOA 2FKPA 5AHMA 1SM9A 3S2LA 3M41A 3EEZA 3BWWA 4UR8A 4KS0A 2E9BA 3AMGA 3O6DA 2Y88A 4FNUA 3SCVA 3P6LA 3RX4A 4LX4A 1MI3A 3SQMA 4O28A 2VWTA 1KXQA 4ATWA 5CQ1A 2INEA 3VD9A 1B0IA 5DN1A 3TC3A 3WQOA 4HNOA 1UPMB 5ABHA 1MSSA 3RLVA 1RY0A 2C1HA 2GGIA 4FNSA 3GNOA 5CH9A 4TR9A 1TE6A 1OB0A 3BGGA 1WZMA 1P48A 3GW0A 2OMAA 2DSWA 1Q4WA 2DDXA 2PODA 1W56A 2QT3A 4IISA 2GVGA 2NW0A 2JIEA 4DI8A 2ALDA 3IK4A 3IIXA 3T0TA 4KCUA 5C7VA 3FHAA 1RVGA 3RJYA 2NUWA 4AIOA 2BGQA 1BVZA 1OYAA 3MV11 3MM6B 3LTPA 3A5VA 1VIWA 4XAFA 1L2QA 3APTA 3VIIA 4S1FA 3VNLA 4M24A 4JICA 4CQAA 4O17A 4XTDA 2CBUA 4W5UA 3MM6A 4KETA 3UWWA 3VI2A 6A3HA 1UD8A 1FX6A 4REQB 4IG2A 3Q45A 4EOUA 1SJDA 2J7FA 1I2PA 1UMLA 2JF7A 2D22A 2B31A 5HMSA 3L4WA 1QVBA 2G3NA 3BMXA 3BZGA 4Y9NA 3L4XA 5FEZA 3N73A 1G4TA 4K8HA 1E43A 1M3UA 3KBVA 5CG7A 2Z2UA 4ZENA 3BG9A 5FKYA 3EDDA 4LF2A 1GPWA 5D8ZA 3M4HA 1G94A 5JIPA 1YLVA 1IZKA 3H7RA 4C6JA 3SAZA 4LUTA 1FP9A 4AU0A 2QDHA 3C2FA 1JUBA 3MV01 3DX5A 3PZ9A 4XD4A 1C29A 1EJ7L 4UTIA 2BSLA 2VZUA 4P7OA 3GYCA 3LX9A 5AYBA 4Y8EA 3BZJA 4XZMX 3SGZA 1QI3A 1JDEA 5IDIA 1RAKA 4W7UA 4OUIA 2TSYA 3GHUA 4GJ1A 3G3DA 1X38A 4OBTA 4YWSA 2GQ9A 2P5NA 4JTUA 4DBWA 4D6FA 4JQ2A 4KT2A 5GJNA 3T40A 8TIMA 1UWSA 4HZ8A 4UFMA 3FA4A 4GVGA 4QS6A 5ABEA 3PZQA 4PMDA 1Q7QA 1EJVC 1GEHA 1WUFA 2P3ZA 4XAZA 3WNPA 2XH4A 4A6GA 1CTNA 4PCFA 3ID7A 3MSRA 4JCLA 2J74A 1T6MA 5JXQA 2GDQA 2GJRA 1TZ7A 1K4GA 3ZOAA 2VGBA 1REQB 1YBQB 3MHFA 4NJJA 3M7WA 4B90A 3W7MA 3AOFA 3KRZA 2CXGA 2VP8A 2V9DA 1DXIA 2J7EA 2AKZA 1B2YA 1ADDA 1Y8BA 1XICA 1MNZA 3FXYA 1BTMA 1SMAA 3QFWA 4CD8A 1O68A 4LU0A 3A12A 4W9TA 2DIEA 3WX7A 1LL6A 1XCXA 1UCWA 3G6LA 7CGTA 4XVDA 5BOOA 1M68A 4EACA 4H00A 1AH0A 4WDTA 1C8YA 3M0YA 3GVQA 5G4HC 3C8NA 2VC9A 3EXSA 1E1CB 3CV7A 1Q6DA 4MLRA 1GYMA 1ZS2A 3BSHA 5DBTA 3C0JA 3AC0A 2PPGA 2VM8A 4GVHA 1ZAHA 1VHNA 2GUUA 3ABXA 4I9TA 1HN1A 3L12A 4JYDA 4CCDA 2ZYFA 3FSUA 3TW9A 3RMJA 3MCMA 5HNRA 5I0DA 1LQ0A 2XSJA 2BHYA 3CUXA 1Y5XA 2WK2A 4RUBA 3MP3A 2WVUA 3PUEA 6XIMA 1QOPA 4LV9A 4O13A 1IE7C 4GACA 4ADTA 3DG7A 4A21A 1J0YA 2D2GA 1ZBVA 4ZE4A 3F4NA 3W23A 4BI7A 5I24A 4FA3A 5CAHA 2EPMX 3U4AA 1ECQA 1Q6FA 3CBWA 1IT8A 3VILA 4OJYA 1EF3A 5I3GA 1RQEA 1O1ZA 1V93A 1KRCC 4Y96A 3DG6A 1K8CA 4AD5A 5K4ZA 3PJWA 3R25A 4WKFA 4RLIA 2BLEA 4BHYA 3PAJA 5DELA 3TTYA 3ARSA 4NAEB 3PAOA 1QW9A 3H4GA 1JFHA 2A2IA 4DPPA 2GSEA 1MZHA 3MZ2A 3VIJA 1XYCA 3RFAA 4WJ8A 4GA8A 3VLXA 5AC5A 5JH1A 3ITXA 3KVJA 3WNLA 5K7JA 2VZTA 1Z41A 3MSYA 4GI6A 3UEQA 1NFGA 3FDKA 2PWDA 1J6OA 3CU2A 4WSHA 1OF6A 4DBSA 4N6EA 4XO7A 1E0XA 3Q67A 2OQYA 2ZRXA 1IWAA 2FFCA 5LNVA 1R2TA 3V18A 1ZUAX 3UQNA 4KRZA 4IICA 3GTFA 3XINA 4UTWC 5CBBA 5B80A 4HHLA 4HNTA 3GDTA 1TUXA 4MYAA 3WKZA 1SFLA 1WXZA 3L2IA 2YKKA 3PVFA 3TCSA 4UTHA 3IIVA 4PUWA 4IP7A 1HO4A 1IXOA 1GVYA 3IUHA 3UY8A 2BY3A 3RR4A 2BG5A 3RRAA 4F0SA 5KZ6A 3O06A 1H5YA 4XZLX 5A6TC 2WO5A 5ABFB 4QITA 3TMQA 4DWSC 1FHVA 3QBUA 4C90A 4E2DA 5ABGA 3UJFA 3H21A 3KOZA 1RH9A 4DUWA 3WUGA 2W63A 1EYEA 5GPRA 1G4SA 2VCCA 3TZFA 1UQZA 1WYIA 4G7EB 3W7DA 7ODCA 2O0TA 3CLWA 1VCVA 2NQHA 2I5QA 4HSHA 4RE0A 2HE8A 4ZQPA 2QXWA 3SSJA 3JS3A 4RPQA 4JIRA 3F4VA 4O14A 2V5LA 1BQGA 2IQDA 3W75A 2E5BA 5FEPA 4QISA 1NIUA 3ES7A 5LIUX 3W7GA 3V1PA 3N6JA 1L6GA 2P88A 3RHGA 1BF6A 4PB4A 4B2DA 2Y4SA 3EA3A 4HPHA 5FL1A 1R6WA 3QR1A 2CESA 4ZO7A 2F8QA 2PF0A 2AOSA 2XZ9A 3SY8A 5HXMA 2CNCA 3EZ4A 4R88A 3OGSA 1QXLA 3S9ZA 1KLZA 5IM51 1TTQA 5HA7A 4IG2B 3R2GA 1L0PA 3MMAB 3ABQA 2FPVA 1CPUA 3WBXA 2QW5A 3S5NA 2CLLA 1GVRA 1EC7A 4W8AA 1WCGA 4WIWA 1DTUA 1H7WA 2QCGA 1BGGA 4QQ3A 4DLFA 1G5AA 2ZZ5A 3EB3A 1MXDA 2DSUA 2X2GA 4ZFMA 3GFYA 2VFFA 3LHWA 2YL8A 2ZUWA 1XH1A 3HGRA 3WLLA 1VFFA 5IRPA 1E4IA 3ARPA 1RY8A 4MDPA 3H12A 1SU5A 3LCWA 3B0HA 3KHDA 4QAIA 3OW1A 4H8NA 1QI2A 3S42A 4UZSA 4AF0A 1WKDA 1QAPA 3L0GA 3OHMB 4IOTA 4KRUA 4CCCA 3UPMA 4D9PA 3SUVA 4P8XA 2QVNA 4MZ1A 4DM1A 4UOJA 4Y90A 6ALDA 4B5SA 3WQCA 1Q66A 3U2CA 3UJRA 4DJDA 5A2AA 5T9CE 1KFJA 3NQVA 2W92A 1PTAA 3M6YA 1U33A 5LA2A 1ICSA 5AB3A 2YYUA 3WDHA 4P7LA 1E4LA 3PG8A 1XGZA 4NJHA 2QCMA 3W74A 3F1QA 1KBBA 4JTRA 3SI9A 3NL5A 1V6UA 3PY2A 4DNHA 2CKRA 4ACZA 1TPFA 2OR2A 2OEMA 5LA1A 3MA8A 3DFYA 3H6OA 1XG4A 3BSMA 4L65A 1PVNA 1GJWA 1KKRA 4XD3A 3BJTA 3LM7A 4G9PA 4E2BA 2HCVA 2C18A 4MY8A 4CQ9A 5E09A 4GNJA 4US6A 1KXTA 4MADA 4ML4A 1B1YA 4ZB0A 4S3EA 4GYFA 1OT1A 1BXNA 1BXBA 3OZMA 2XSJB 2NV1A 2GDUA 1ISZA 4PR4A 4GCXA 3VKRA 4D1IA 3GG7A 3WYZA 2YL5A 4LUSA 2D0HA 3HF3A 1XH0A 1GQLA 2ZZ2A 1R3TA 4DQWA 1TPDA 2G5WA 3ABZA 1Q6CA 1E4MM 3KBWA 4M81A 5C2CA 5CG0A 1DQXA 3GG8A 4G8TA 3CWHA 1SW0A 2YL9A 3WD4A 4Z42C 4HTBA 1HGWA 4WJXA 1ZZMA 3NQ2A 1SJCA 1S5WA 1XLHA 1U5VA 1AD1A 1BXCA 1D8WA 3MDWA 4KCTA 4US5D 3LMYA 1JYNA 5FACA 3SCUA 1KM6A 1PSCA 4PH6A 2MNRA 3NO3A 1B3XA 5BXPA 2PTZA 4QCFA 1AODA 2X8RA 3GLCA 4PMZA 3TU9A 5M5DA 3ATZA 1MDLA 1JZ2A 4DYJA 1IGSA 1POJA 2EJAA 4JX6A 4W8LA 1QFEA 4IJRA 1Q7MA 1MXSA 1AL7A 1G4PA 1F73A 3PSWA 7A3HA 3W4RA 4O4WA 1QOXA 3BICA 1R9YA 1F3XA 1VBJA 3UCDA 3VIFA 1UOZA 4FLOA 2LLEA 3T6CA 1TR9A 1C8QA 5HMDA 3F2BA 5D2WA 1XC4A 1SR0A 3SGGA 1FCUA 4GISA 2XFRA 2F6XA 4KWWA 8XIMA 1ZBKA 3MUY1 3MW7A 1LRTA 1K9FA 4WF7A 1NOUA 4TO8A 1FKXA 4LB3A 4DWSB 2PDHA 3EYPA 4NZCA 4Q8NA 4UTTC 1M01A 3H2AA 4MZYA 4YS1A 3MTWA 1H1YA 4P8VA 4PSRA 5EMMA 1TWDA 3BJSA 2QGYA 1WAUA 3HQ1A 9RUBA 3WDJA 1XBVA 3HPAA 3HTWA 4LUIA 1W3IA 4XUYA 4INFA 2PTDA 1A5KC 4EXBA 3OR2B 3P81A 1FOBA 3MM5A 1VBRA 4ZEPA 4KFPA 3NIYA 4FX7A 5HQLA 4M19A 2E4TA 2OLSA 1K8XA 3WQPA 2DEPA 1A0DA 2VWSA 5AYXA 3NQDA 4AWUA 1CGXA 3WLRA 3UBPC 3IV3A 3E02A 1XLEA 4E0CA 3HFTA 2WC7A 2VT0A 3MS8A 4GCAA 4A8NA 2B0MA 1W91A 3D47A 3RYSA 4Z2GA 4NYYA 3OODA 3WN6A 1ZL1A 1WA3A 4LEQA 3BQ6A 1R0MA 1H7XA 4QQUA 4OIFA 1MVYA 4RW3A 7ENLA 2VMFA 3NQ7A 3BAYA 4IQDA 3CHFA 3BOLA 4L61A 2ZE3A 3IJ6A 3VDAA 2PEVA 2Z6IA 3C3NA 2ZVIA 5RUBA 2OT1A 1BD0A 1Q6LA 3LPOA 2ZA2A 1UBSA 3AQUA 2FPTA 3HV8A 3FVDA 4X22A 3ZVHA 1E1EA 1NY1A 3PBVA 2HDJA 3DCPA 4FXSA 2IQTA 4GEPA 4PTWA 4KEVA 1IT0A 3FKRA 1IYXA 3P14A 4L1WA 2RDTA 3LI1A 4BF7A 1J4EA 3BCJA 5BXTA 1S2UA 1UZHA 3W71A 3ZMRA 5A2CA 3JRKA 2OELA 1UW9A 1Y5VA 4HOZA 4Z17A 2WVSA 3MKKA 1CGUA 1TZZA 3OLEA 1GG1A 4ICMA 1RJPA 3WCZA 1KTBA 2AQOA 8GEPA 2XWEA 1DWAM 3ZLFA 3DERA 4UTWA 4E8GA 3WUEA 1DJHA 3O8AA 3CO8A 4RE2A 4NZ5A 1JCXA 3FX4A 3TJXA 4MZ8A 2FGBA 4C5ZA 2P53A 4X9SA 1J0KA 4NZ4A 3I7RA 3QKZA 5JUVA 4AYGA 3P80A 2IUZA 1Q2RA 1E73M 2WC4A 1V3KA 1FDJA 2YZRA 1JIBA 3L2LA 1OIFA 1L6YA 2C91A 5LYRA 1KWKA 3I10A 2C8NA 2F61A 4XKYB 2FH6A 1QOQA 3R8GA 4JTIA 2A0NA 4GH3A 2JALA 4JIIX 2VCAA 1RQHA 3LNPA 4ERIA 4WGXA 4FIQA 3WUBA 4W87A 3CYJA 1LYXA 1XLLA 2XSAA 1EIBA 2VFGA 1JFXA 1XRTA 1DTNA 4MJZA 1DQWA 3N3TA 1KGXA 4Y8FA 4CKQA 3CJPA 4RZ6A 5AHEA 3HG4A 5TAOA 3W1RA 3AXXA 3CO4A 3W26A 1TIMA 3UFYA 1CWYA 3T9PA 3NVTA 1TTPA 3GNRA 3GNXA 3VMOA 4ZQCA 1GZJA 1PIFA 5ABTA 4UCGA 1E6QM 4FF7A 2CLFA 3AU6A 2EPOA 4LWWA 1PYFA 4WOQA 4R27A 4BQ5A 3MDUA 1FCVA 2O55A 5MHBA 4UC5A 5HJXA 1GW9A 4XAGA 3DU0A 5T26A 3OTRA 3WEOA 4JEJA 4B3LA 1V0KA 3W82A 2V5KA 3BCFA 4POCA 2X1SA 3AOPA 1MW1A 3WJXA 2J9XA 4MDOA 3RLHA 4HTRA 1LOSA 5HPCA 3CB3A 5T91A 1W37A 1RPKA 3T09A 2QYGA 1WOAA 1X7IA 3NR0A 3GU2A 4F8XA 2YCKX 4JTFA 3GK0A 4LBSA 5I3KA 2FVMA 2GK1B 4GI8A 1YPFA 3RCNA 3G18A 1JZ6A 3B03A 1S5NA 4L6DA 5BRQA 4IGNA 2BZNA 2B81A 1ICPA 3M64A 4PTVA 1VRXA 2VNCA 4D6GA 3V36A 3P7YA 2XGIA 3HB9A 2WSRA 1VYPX 3CM4A 2WSKA 3V5FA 2E77A 3TE9A 2HS6A 3GXMA 3RJXA 3TTEA 4DJEC 4WHBA 4TMBA 2YCLA 2XIOA 3VK5A 4Z2JA 3KRBA 5BCAA 4IWWA 3SRDA 2E09A 1K1DA 5LIXX 3VX0A 2XN1A 4Q22A 2QMKA 1T40A 5D37A 3VO0A 4NAFA 3GZAA 2YCLB 3WBYA 1W1PA 3UG5A 4LUJA 4AVNA 1E5JA 1XF0A 1UYQA 3LA4A 4D6DA 4S3FA 5TD4A 4F0HA 1LTDA 1E6RA 3TW6A 3CPGA 1JZ4A 1FFQA 1G1YA 2TMDA 3SCNA 2QPXA 4B92A 4ZGYA 2VDIA 2J8TA 1SZEA 4MTVA 1BWKA 1OABA 3N29A 4FPSA 4A35A 2I1OA 1RXOB 2P10A 3QTPA 4DLMA 4GZIA 1JDFA 4HN8A 1R47A 3BGAA 3QPYA 4BS0A 4S3KA 3VZZA 4B15A 3EA2A 1ONRA 1HJSA 1OF8A 3CPUA 3TOPA 1HFBA 3L23A 2RGMA 4XSMA 2PFHA 3WH5A 4FR6A 2XM2A 4B5WA 1W9PA 2NUXA 4GH1A 2AGTA 1GOWA 2F2KA 1YKWA 3LEPA 2VHLA 5LNRA 1IEVA 3SIMA 3S6DA 2WJDA 3GU1A 3T42A 2HISA 5C5YA 3H2FA 3LQLA 4JHMA 2RJGA 5BZAA 3IRDA 2YJQA 4QLLA 5A1AA 3ZXWA 3ZR4A 4YTUA 1O5QA 3PN8A 5HULA 1QI5A 3TN3A 1TPC1 5EMUA 3ENLA 2J77A 4WLCA 3WD0A 5EU9A 1O1HA 3ALGA 1QHZA 3WQGA 3LZ5A 5DF0A 4IQJA 1J18A 1WBHA 5D2XA 4B5XA 3WD2A 4RDZA 1UA3A 3L5LA 4N02A 4J5NA 2X2YA 3I4EA 2EPHA 5D33A 2DQWA 4CU8A 3GIQA 4TOQA 3TYAA 2XISA 5CZKA 2OOGA 4LANA 3VE9A 5D9OA 1JCNA 5K9XA 1W3LA 5CC7A 1QI4A 1V6YA 2QIWA 2GSJA 1BVWA 3GTHA 3LCHA 1KFLA 5CSUA 4HOWA 1V02E 2XIIA 3ONCA 3ES8A 3TJLA 2CHOA 4DO6A 1DJWA 4Z1YA 3F2DA 1OGSA 3IVSA 3T1GA 2ZTKA 4HU3A 3DHFA 4M7TA 3GZ3A 5CLTA 5LHFA 1AZ2A 1W8SA 5IFTA 2GPTA 3CTTA 2CLIA 3OIXA 5HINA 3AIUA 3MHGA 1VFOA 3AMDA 1ADSA 3S46A 2VFDA 2WMIA 2ATMA 3S9IA 2NZLA 3FY1A 3L9CA 5CSRA 4HHMA 3LNMA 3RPTA 1WNOA 5KTLA 3W01A 1LG1A 4O54A 3KX6A 4U31A 1M7PA 1EDQA 4JD4A 2A3LA 3PZNA 1W54A 1EYWA 1ZQ5A 3VE7A 4UTUA 3L0KA 2Z1WA 3VNZA 1DOSA 3NOYA 1E6ZA 1K8YA 2BNJA 4KRTA 4B3KA 1VB9A 3IARA 5DFAA 1QPNA 3OYXA 4AZHA 2CZEA 1TMLA 3E0FA 3GIPA 3IGUA 2W9MA 4J35A 1XIFA 4FLSA 3LERA 3MMDA 4H9UA 3TK7A 4LC6A 1KBLA 1X98A 1ZJIA 1QWGA 4C91A 3IJ9A 1B3WA 2JKPA 3S0CA 1UH4A 2BOEX 4E4PA 4F2UA 1M6JA 3RCMA 3MMUA 2Y2WA 2PDLA 3M0XA 1T0OA 5GNYA 1TFVA 2FVLA 4NRRA 3PULA 3PUGA 1R86A 1FRBA 1WZLA 2CXEA 4D6CA 4FXJA 1H7RA 8CGTA 2TAAA 3W2LA 2FZBA 1FWIC 2FDMA 1QPKA 5I77A 4ECLA 4IPIA 5BU6A 1VBHA 4M1BA 4ZMGA 1NFBA 5G4WA 4C7FA 1US2A 3NSNA 3W1QA 1P6BA 2WSYA 4TQTA 3ATYA 2YBTA 1QK0A 4JYEA 3KCOA 4M80A 2EEXA 3H2CA 1RQBA 2CZDA 2CITA 4M6VA 4ZCWA 4QXIA 2EG8A 2DH2A 1Z44A 3C3UA 3GH4A 1YRRA 4E2OA 1MEWA 3AS2A 4I9JA 2P1FA 1H0IA 1SYTA 1C8XA 1GVSA 4JNMA 3UR2A 3OEXA 3OVGA 1P6WA 3UZZA 3T0CA 2VD8A 1OFDA 4GFSA 3MJYA 2HJPA 1XIJA 4U3AA 1EXBA 1QPOA 3QGKC 2OEJA 3H2EA 1JD7A 3ANVA 2VFHA 5EA9A 3S2NA 4GC3A 1S1PA 2A4AA 3AIWA 3W7HA 4NU7A 2QUMA 4W7VA 1TPWA 2HWGA 3NZQA 2VRJA 5KZDA 2WLYA 3I4KA 3VGHA 1VLIA 2ZUUA 4NKCA 2J8FA 1VYRA 5EFFA 3TXVA 4Z2HA 1PL9A 3SSZA 4L1GA 4PYSA 3ZWTA 4LAOA 1G67A 4F40A 2ZOXA 2C1GA 5BRPA 4YPJA 1JPMA 3D6NA 3CIXA 1O7AA 3EKZA 4CN4A 4OTKA 1A0EA 1KCXA 1XIHA 4K39A 1CENA 4EVZA 2X05A 4KKXA 1XLFA 5E70A 1US0A 2BP1A 2Z28A 4JY9A 4HA1A 1TRIA 3YPIA 2PURA 3WD3A 3M9YA 3BLLA 3WLPA 1EDGA 4AZIA 1ITQA 4A8IA 3LDVA 2X42A 3NGFA 1GORA 4F79A 4Y2WA 5TF0A 3S4TA 3HU7A 5AC7A 5F4SA 1IWPA 4X9YA 4DZIA 1VHCA 2J27A 3KBJA 4AOPA 1N7KA 3WBWA 3RM9A 1R3SA 1RP8A 2FTYA 1NFPA 3AI0A 4X2RA 2AL2B 2EKCA 2XG9A 3NFUA 4GZEA 4QSFA 4WK9A 3TJ4A 4QBXA 1ME7A 2V5JA 1XL9A 3B0VC 3KTCA 3VFLA 4FIRA 2EBNA 1QBAA 2V82A 2WBGA 3TROA 2WQDA 1W1YA 2ON3A 2WWCA 2QV4A 3C2OA 2PTXA 1ZJ8A 2XH7A 4HB7A 2QJNA 2Z24A 1ITXA 3ARRA 4AIUA 1RLCL 2IKJA 2WHMA 5JH2A 1OFRA 4WJEA 4F0LA 3JVAA 1EWDA 1OZMA 7GEPA 5CZ0A 1XUZA 3WMSA 4KERA 3MI3A 1XJBA 4XV0A 4MVAA 1CLVA 5G5IA 4F3HA 2YA2A 5EYWA 1UD5A 1ZU8A 4XK2A 2G3MA 4ICCX 2PDYA 2HSAA 5XINA 2OWWA 3IWPA 2PDUA 5CSYA 3TTSA 5LIYX 2ZC8A 3IAQA 3U2ZA 4DWDA 4B5NA 3K1GA 2PLJA 1UWIA 1JXKA 3PWGA 1UP0A 1YDVA 3WK3A 4RZ4A 4AD2A 1ZPTA 3OLDA 1XD0A 2GZXA 1D8CA 3QQ1A 4HNVA 1PUDA 4G38A 2RAGA 3W38A 4WRHA 4H04A 3GFZA 3BDKA 1WZKA 4KGJA 1FDZA 1EJXC 4PBGA 1QO5A 2YDAA 3ZS4A 3C0SA 3LCIA 1W1TA 4Q4PA 1OG6A 2NWSA 4QSHA 1JPDX 1IV8A 3DN5A 4M8UA 5J5RA 1K8ZA 2OZ8A 1X97A 2PBOA 3EB2A 3ARQA 2PSNA 4S2BA 4S2CA 4YVVA 5H8UA 2QJHA 1L9WA 5DCBA 1UZ1A 4OUEA 1GTHA 1J5TA 2PRHA 1E4NA 4EPKA 5GEPA 3UWQA 2NV9A 5JBEA 1HL2A 3LBOA 3PWIA 3LTYA 2A3CA 2YB1A 1DXFA 1E6XM 3OVPA 4E2VA 3M0MA 1Q8AA 4MIMA 2FB2A 3M7SA 2A1YA 3PZUA 2NLIA 3QGVA 4JTJA 3CTLA 4PGLA 1I6NA 3WJYA 1GQJA 2V63A 2HQAA 2PDBA 4NJIA 5E1QA 4J3VA 4U33A 1HW6A 3CQ0A 3QOMA 4HA4A 2XJ7A 3W85A 2Q3RA 2QJJA 4ZO9A 5FSEC 1TELA 4F9DA 5F4XA 4AEOA 3RF9A 1E0UA 2V38A 3ME3A 3DUGA 2ZZ7A 2QZRA 5FJPA 2DFAA 4J3UA 4EWND 4EPBC 1FWGC 3S5YA 4GC4A 3WO8A 4CD7A 3W24A 4WXYA 2VDGA 3PF3A 2I57A 4MAVA 3T05A 1SUXA 4UNIA 4R9OA 4V2XA 1B3VA 1H7OA 3G1AA 4Q8PA 2VEFA 1VEMA 1XLCA 2PD5A 4XUGA 1E51A 1L6FA 4ZTXA 3V5OA 3MUAA 3T2OA 4TUFA 2J62A 3STPA 2XYLA 2NQZA 1QNQA 2P0IA 3DFTA 1XYZA 3CZEA 3KOYA 3UYCA 3E2QA 3K30A 4Q8WA 3TLLA 2XVNA 2Y5SA 1OIMA 3AYSA 3WK2A 2BY0A 3SUSA 4JFUA 2A7RA 2EQDA 4IUGA 3QN3A 1C92A 1ELSA 3G0SA 4E3TA 3KL0A 2PDFA 4RE4A 4LAKA 1UWUA 2QEZA 3O1NA 5C2XA 4U10A 1IT7A 1ENUA 3SW6A 4C5YA 2YXGA 4WQ6A 2UWFA 1K03A 5FJTA 1ZP3A 1UASA 1Y5WA 3U7VA 1DHPA 1NDVA 3NO1A 5C6MA 4AD4A 1N8IA 2ACRA 2EPKX 1JYWA 2HK0A 4H9MA 5I07A 2UY5A 4K8GA 2OQLA 2J25A 3TR2A 1W31A 3DDMA 2J47A 1C8VA 1X96A 3C0QA 5JBFA 3VOJA 3W2NA 4ZA0A 4RK8A 4AZ7A 3AHYA 1HVQA 4QCEA 2VDHA 3WEZA 2OG9A 3AXHA 1J2BA 5JVLA 2V6AA 2I17A 3GHSA 4QJ5B 1OWQA 2FZ9A 3T4WA 3E3HA 2HPMA 1H5VA 1K70A 1XQKA 5LGXA 4Z1CA 3NDZA 1XSIA 1UR9A 3WELA 1TV5A 2QLYA 1Y65A 2EG7A 1YPIA 3S83A 4QTGA 3VKBA 3TEVA 4UOQA 3QMTA 4O15A 3VKQA 2DZSA 2Z2BA 1E9YB 2FH8A 5DY2A 3A47A 4C6KA 1XLJA 4NRSA 3MWAA 1LLZA 3TP4A 5C2GA 1W9DM 1C91A 1ZJHA 3UZYA 3ECQA 1MUMA 4LALA 3UJEA 4LS2A 3T7VA 4GIRA 1HJXA 2ABBA 3N2CA 2E5DA 3FJ6A 4IQEA 2PAJA 4ZL1A 3UPBA 3VM7A 3E0WA 3LS9A 5DMLA 1OC6A 2C3ZA 1KGUA 1XLIA 4M51A 4BFAA 3GAYA 5REQB 2E5CA 3WMLA 2A79A 5E0CA 2IXVA 3N9SA 5H91A 2ISDA 4JZ5A 3VKKA 3VNYA 2BDQA 2FHCA 1SZGA 3PTDA 1R7AA 5HMFA 4V15A 4KEMA 3RUBL 3O3RA 5CXPA 4UFKA 2PGWA 2Y0FA 3GVVA 2Q6ZA 3A6OA 3DFQA 3PJXA 4GY7A 2ONEA 3G8RA 2HBVA 5M17A 1AQMA 3MC5A 4IX0A 4AY8A 3QV9A 4NASA 1GCYA 2WC3A 4ZBCA 3BLPX 1CLXA 4GK8A 2FFIA 5DCEA 2ZTJA 1W9BM 1CNVA 1JDAA 3WNMA 1NARA 1JRBA 3VAVA 4GIAA 3VIOA 2X0YA 4CD6A 3KL3A 1OT2A 4WY0B 1QASA 2P0OA 3K8MA 3OVQA 3ARYA 3NCOA 3O15A 3QZAA 2HRWA 2W0UA 1A47A 3AMKA 3R1ZA 2GSHA 3KWXA 2OGJA 5AVHA 4XZIA 4XZHA 3IPWA 2J9ZA 1H2JA 1N2VA 3N2BA 3WMCA 4DX3A 5K4XA 3CAQA 1NEYA 2IPJA 1FP8A 4YN5A 1OYBA 1K6WA 2PLCA 5CCZA 3LRLA 1WDSA 3FJNA 3BANA 3BSGA 4MPKA 1V0NA 1W1IE 2WM0A 4OFCA 5AYIA 4DJED 2F38A 1M53A 1P0NA 2YFOA 2H3DA 1ZNNA 2QDDA 3KAOA 3SRFA 2ZUVA 1UIPA 2X7WA 1W32A 1OX4B 1C9DA 4P7NA 4PMUA 1JR1A 3IVTA 2XDFA 3LCFA 1V51A 2R1NA 3NPWA 4AXNA 2WPGA 2R24A 4ZFCA 4N2YA 2DU2A 4GVFA 2AQWA 2DSKA 3HGSA 4ORMA 3FDGA 3NQEA 3DFHA 3EX6A 4G1NA 4J3XA 4V1YA 1Q13A 2ABAA 5E93A 1H41A 1EXPA 5AHIA 1OCQA 3M07A 5HMEA 1M04A 4D2JA 1XLBA 4DRSA 4NF7A 5DMYA 3F4WA 3VLZA 2P76A 4TMCA 3M46A 1G7VA 4GJIA 2ACUA 4HYVA 3QW4B 1UR3M 3DENA 3T0AA 4OOZA 3VIGA 3EDKA 4DAIA 3WY1A 3VYLA 3I6EA 2IQ0A 3Q37A 4Z1AA 1FXQA 4HD5A 2Z00A 3H2NA 2CZ5A 1DJGA 4I7UA 3BW3A 4IJCA 1NDZA 3BW2A 5EL1A 4F0RA 1F7BA 1B57A 3UYIA 2F6KA 4HN4A 1VFMA 3UCQA 5DT7A 2DIJA 2BVYA 3AALA 3TZNA 3W6YA 1M7OA 1GHSA 2RFGA 4K6AA 3W7RA 3KOWA 1GKQA 4PUMA 2D69A 3DFNA 2UY2A 4H01A 4GYPC 4ENLA 2D73A 3I3BA 4W86A 5H8PA 5BNKA 3E38A 4R7WA 1A3HA 2DVXA 3MB9A 5D9MA 2GFTA 1JCYA 5CC5A 1RHCA 5HUOA 1SFTA 4J3ZA 4DXKA 1AJZA 3D46A 4ALDA 4NNAA 1VJZA 4J2PA 5BW6A 4M56A 4UOZA 1FQ0A 1E9ZB 4G2DA 4PN2A 4NZ3A 3VFCA 4EKJA 4I5UA 4Z2IA 3RCYA 4AHPA 3CL8A 2KX9A 4QE1A 4DXXA 1B31A 1KM2A 2GUBA 4KCWA 2WKLA 4A2SA 5D05A 3R11A 4JTGA 5DRIA 2WKJA 4OZOA 1AJ0A 4JTHA 2OX4A 3DHPA 3OYZA 3VC6A 4ZTYA 2JKEA 3E6EA 2BVTA 4NL1A 3E5PA 5J04A 4IGHA 3GXDA 2DP3A 2UV8G 1EJTC 4HIBA 4PRRA 2BV9A 3AISA 2A3EA 1ZSXA 3MQTA 2CU0A 2EHHA 4PUDA 1X1ZA 1XFCA 4RDVA 3M47A 3ERPA 1JVNA 4FS9A 3VPLA 2HV5A 9XIAA 1GQIA 2B4GA 4PUEA 2FMNA 3NL3A 3THAA 3T0DA 1OFBA 4ROPA 1YIXA 4HK7A 2VX5A 4C6NA 4N0RA 3C0LA 3HPSA 3UGRA 4JFTA 1ZGDA 1LROA 3PFRA 3VGEA 3NEVA 5HATA 2QNEA 3SCPA 1RV8A 2WVTA 3UPWA 1FH9A 3MUIA 4BA0A 1KFCA 3KLKA 3WSUA 3DAQA 3MCOA 4RNFA 3FK4A 4HSOA 4LY8A 4E6MA 3RAOA 3W1PA 3HMCA 4OOUA 3CQJA 5H1WA 4IHCA 3EKGA 1PCKA 2XH2A 2PU1A 4YHEA 2IXUA 4PFMA 1V77A 4P8UA 1H1ZA 3BW4A 2Y5EA 3TNBA 3W83A 1AG1O 3TQKA 3BOFA 1LT8A 1YXDA 3SY1A 3MBFA 1PJ9A 1H60A 5DLCA 2PRLA 3WF0A 4GX8A 3NPVA 3M0VA 2GK1A 2VENA 2CZFA 3KVMA 5FJJA 2RDXA 5KZEA 1XIBA 2QCHA 2EO7A 3PC0A 1E6NA 4L9YA 5TQLA 4N9EA 5DANA 4XQ6A 4YVPA 4RE3A 4XKMA 5HNUA 4AXKA 4HK5A 4J3TA 4HA3A 2PC4A 4J40A 3EA1A 3O9NA 4LRTA 1VBUA 1EOMA 4ERAA 1PZ2A 3C2RA 2J7CA 2NXGA 3VOFA 3GXPA 1PX3A 1V03A 3NPXA 4S38A 1R2RA 1P0KA 3UWEA 4FB7A 3RPMA 1JJKA 3OA5A 3WH8A 3OGVA 2GVLA 3NM1A 3ZSTA 3HGOA 2F84A 1W3KA 3N13A 1ALDA 1UG6A 1HKMA 4YYFA 2UY3A 4CD5A 3WQ4A 1PPIA 4AEFA 3G1YA 2EPNA 1EH9A 1FH8A 2FZNA 4TX9A 2MUCA 2XUCA 4K3ZA 4YMZA 4AX6A 3P60A 4JIEA 2REQB 2P8BA 4GINA 3TA6A 4Y9OA 3R5EA 4WDUA 3IAPA 1FY6A 1I0DA 3T07A 5HNTA 5HR6A 5GNXA 3ZSSA 4WGHA 1XIDA 3W00A 3GQYA 4OE7A 2XVPA 4O0KA 3THCA 3GHTA 2BBFA 5EB8A 2WMKA 4NIRA 1EPXA 4IH3A 2QUTA 3BH4A 1XUUA 4W7WA 1LWHA 4MFEA 2W27A 2WLZA 4ZOEA 2J4GA 2ZUTA 1NP2A 2X41A 3O16A 5A8NA 4GI4A 3NQCA 1IIGA 1VS1A 4GE8A 3C5QA 4IL2A 4S3AA 4HHPA 1UH2A 4CCZA 3FN9A 4CCEA 1S2VA 4MJMA 1PX8A 3AS3A 4D6EA 5FCZA 4MKNA 3ITGA 2AL2A 2PWFA 3H2OA 3WEMA 2G0WA 4DJFA 4P7RA 1EB3A 3EX2A 3W7KA 4IX2A 4NNBA 1PV8A 4PB3A 5C0QA 3GY1A 1LDCA 1TCDA 3ICJA 5A6LA 3NZGA 4Q6XA 3N14A 1AL8A 1R3WA 2PD9A 1ZJ9A 4ZQMA 3L4ZA 3V35A 3HGJA 4MWAD 4GUGA 4H83A 3A9IA 3CV2A 4MY9A 1K3UA 1EHNA 3BC9A 4G7EA 4NILA 2ZX6A 1XXXA 2V3GA 3CQIA 1KM0A 3TN5A 2ICSA 5I3HA 2V3FA 2Z1VA 4NXSA 2A21A 3E74A 4TIMA 4JFSA 3NSXA 4AZBA 1F61A 1DWHM 2VRQA 4CNPA 4I6VA 1PBGA 4Q8VA 2D2HA 1E3ZA 3B0YA 3R94A 4YXGA 4UTJA 3VU2A 3QHOA 1OQFA 4GZ7A 3VNIA 1RK6A 4HNUA 5IXEA 1TV8A 1V3HA 2BX7A 2PLKA 1CXIA 1GVIA 3WF1A 2Y7EA 2VQTA 3W2JA 1XYLA 2CBVA 4XISA 2VZSA 3P3BA 3WLTA 3B8UA 4OU1A 3UNTA 3VOGA 4L80A 4RCXA 3WNKA 3QSRA 4XD5A 4K68A 4UIOA 3CUIA 3S2CA 8A3HA 4LUYA 3LCXA 1H4PA 5AHFA 3E1F1 4JTEA 5AVNA 5HPOA 3GBEA 3OG3A 4HQVA 4Q32A 1JEZA 4TX6A 1MQRA 4Y9PA 1TB3A 1W1B1 2XHYA 3O6YX 1S2TA 4W89A 3PUDA 3QHNA 1CW2A 1TG7A 3NSMA 4D6HA 3S1GA 2NX3A 4PUUA 1UUOA 3F7JA 2D23A 1AA1B 1L6SA 3TH6A 3MBDA 3WLKX 1QNSA 3ZJKA 1K77A 3WLIA 4H7CA 4S3GA 5XIMA 1J0ZA 3T4CA 2WMFA 1UWRA 3LHVA 4AQLA 1X1NA 4XIAA 1IHIA 4R34A 5TBOA 5I3DA 1OK6A 3CEUA 3MSDA 1R38A 1A5SA 2H90A 1UC4A 3GR7A 3S5ZA 4X2PA 4I3GA 5KEZA 3PPCA 3B9DA 5EY5A 2Z1XA 3V75A 3KVKA 4Q4MA 2VEGA 2QQ6A 2ANUA 4W84A 3H24A 1TA3B 3L4YA 4GY0A 3QLLA 5FI8A 1E15A 1HKJA 2QCDA 3KL5A 1FUYA 3ANUA 5D30A 4HCDA 3W6LA 2YR1A 3BURA 2QF8A 2J66A 4XKYA 4AAJA 1IEXA 1BYCA 1ISWA 2C79A 1SW7A 3PPFA 4YIWA 4U28A 3USBA 2WAGA 1XDLA 1OVDA 5I00A 3FEMA 3URQA 1HIZA 1JGMA 1OX5A 1WBJA 3PZMA 3TFXA 3UP8A 2PDWA 4UWMA 4WKAA 3APGA 4K7VA 3BLEA 4R85A 3ABSA 4DBDA 1KRBC 4Q8UA 1PDZA 3ARZA 1XH2A 5J8LA 1NP0A 4OWGA 3RK8A 1CCWB 4MYXA 1RBLA 2CPUA 2YXXA 3F5KA 4JTKA 1TVPA 1H61A 4H19A 2YBUA 3EBVA 3AJ7A 3CEPA 2NT1A 1AQFA 4OHQA 1AUSL 4A05A 3SCQA 5C55A 3UF9A 4QEEA 2WWDA 2XH0A 1TJ1A 2XM1A 4XBKA 5HQEA 4MB3A 4YTSA 1B4EA 4PTDA 3MM8A 3TUUA 1F3EA 1YX1A 2J9YA 2Y6ZA 3IIZA 1MFUA 1PHWA 2Y8KA 1OYCA 2WNNA 3AHXA 4WZHA 3GM8A 4AUBA 3NVDA 1WUEA 3W1UA 3R43A 4HYWA 5D4YA 1LBLA 1MDRA 1RALA 3N6HA 2X0SA 3WD1A 3T8QA 3TAKA 3TYUA 6PTDA 4JCMA 3HN3A 4J3WA 3NAVA 4ACZB 1WOBA 2HVNA 3H23A 3RDKA 4G6CA 4W8BA 4RZBA 4AISA 1VAHA 1KB3A 1REQA 1RVKA 3QYQA 4C6CA 3TSMA 3F4CA 5HR7A 3OO2A 4JNYA 3ZT7A 1BG4A 1XS2A 4IGSA 4NZJA 3UETA 4L5ZA 3GDMA 4DJFC 1ZBCA 3P84A 3NQFA 2O4MA 2GGHA 1KFKA 2CYGA 3CHVA 2GJXA 4YTQA 3TW7A 1LRNA 4M6QA 1ZCOA 4MSSA 1JZ8A 3EOOA 2VC5A 3Q2DA 4C6IA 1A5MC 3MO4A 1UR0A 5C9XA 2JQXA 1R2SA 3CWNA 3C56A 4D8LA 4AVOA 3HM7A 1XIMA 1TTIA 1F4HA 3RU6A 1OFEA 1RR2A 2ZCGA 1Q7ZA 2PZNA 3V7PA 3CB8A 1BYDA 3SCOA 2VXNA 3H26A 1JPIA 1YNPA 1JI1A 4FR1A 3N4EA 3MMBA 1PAMA 3WH7A 2HVMA 4DWSD 3BG5A 1H51A 2JBMA 4IMDA 4L4MA 4PZVA 4LBRA 4GFIA 2EGZA 8RUCA 3MMBB 3NXLA 2PB1A 2POTA 2KZHA 1MW0A 1J10A 2E8YA 4Z0JA 3NPUA 1MO0A 4YVXA 3EPNA 2WCGA 3LB0A 2GVJA 4GXWA 3SO7A 1BAGA 4M6PA 4P7QA 3VIHA 1I2NA 4I5XA 2BODX 4TV6A 4NYUA 1SZFA 1E6SM 5A3HA 5B7ZA 5CPOA 2J7GA 3ZVHB 3U6WA 4O1EA 3EWCA 3TYDA 3GFXA 1C90A 1J11A 2DW7A 3W2KA 4B16A 1R46A 3MUZ1 1QATA 3UD6A 3IANA 3REQA 1VCGA 3GD6A 1TWZA 3HQOA 2HXUA 4U5IA 3GKFA 3DGRA 3W28A 3OG2A 3AZTA 3N3MA 4DO7A 3SECA 1LORA 1RA5A 1DIOA 2DZAA 3P74A 4XIMA 1VF8A 4AD3A 3TJIA 4LXFA 3S2MA 4ZSUA 1FA2A 2GJPA 3CLMA 3BAXA 5I23A 3SEPA 4RNHA 2GGJA 4DVOA 1DL3A 1AH4A 3QV8A 3LM3A 4MM1A 3VDCA 1HF6A 1HL8A 4DUXA 2R91A 2E6YA 3U3HA 1WV2A 1YDNA 2ZA1A 3W1XA 2BOFX 2E9LA 3RLGA 4IJBA 2EF9A 3WIJA 4C6PA 1F07A 1JI2A 1C93A 3A4AA 3D5HA 2RJHA 1VH7A 4E38A 1TR1A 1N82A 3SJNA 5IOBA 1DHKA 2NQJA 2JE8A 4ZOCA 3AUJA 1V4YA 3K8LA 4TVCA 2ZDSA 1IWBA 5ABFA 4GKLA 2WNQA 1YE4A 2AKMA 4PTXA 3O0KA 1VPXA 1ZENA 5I2UA 1RCQA 4RXGA 4CQBA 2NUYA 2HROA 4QP0A 1O95A 2DQXA 3N34A 2E3ZA 4W88A 5A8GA 1ONXA 3TFCA 1LLOA 1MUWA 5A6JA 4IIBA 4DJFD 5ECVA 2CLHA 3SGUA 1U1JA 4AZCB 1W5NA 2O9RA 2C1IA 4H6EA 1K9TA 4ZVJA 1DIDA 1JF6A 5E0KA 2GOUA 2ZRYA 3H4WA 2IMRA 3OB8A 4Q6JA 3TLQA 1DYSA 1BRLA 4KW2A 5HJYA 4GD0A 3WJWA 2BVWA 3B0UX 3B9AA 2XSBA 1F76A 4JX4A 3EXTA 4UNLA 2QCDB 1GJUA 2X1UA 3LTSA 5BU9A 4H2CA 1N8FA 3NO5A 1Q4NX 1E5NA 2VOTA 2IPWA 2XINA 1CYGA 3M16A 1RD5A 1LRQA 1EDTA 4H6KA 5F1VA 3W9ZA 4GPNA 3W27A 3AYRA 5DY3A 3CT2A 1DJIA 2IPFA 3VNKA 1AFSA 4US5A 2G96A 1LBMA 4IQLA 2X09A 4WDWA 3SCRA 2OSXA 3DI1A 4DIAA 3VMNA 2PCQA 1L8PA 1OBAA 1GK8A 3RU8X 2D0GA 1XLMA 4BY3A 5L6UA 4GQRA 1WPCA 2Y7FA 1A4LA 1ISXA 1S5TA 1V79A 4U2ZA 3VUSA 4HTYA 2XPKA 4GYJA 1B3ZA 4IIHA 4DEFA 1QHPA 5G2IA 3DBPA 5EBUA 3TN6A 2PDJA 2TPSA 1HJQA 4L56A 3HG3A 1BEUA 2E7FA 3LK6A 3WQFA 5FAGA 3PBWA 3WLMA 2WW5A 4JOMA 1XDMA 4O1CA 1G7UA 3MMTA 1A3WA 2WV8A 2ZRZA 1QK2A 3KRSA 4KESA 3UVAA 2PDIA 1A5AA 3AIRA 2V5DA 4JQAA 4LS0A 1H1NA 3RILA 3S6OA 2GEPA 3CPRA 1BKSA 3TYZA 3MM9A 2YZ5A 4B2DD 3KM8A 4ICNA 4GBDA 3ZJ7A 3R13A 3W7JA 1GJPA 3AAMA 4JEQA 1RBAA 2OGYA 1XLKA 2GLKA 4XBJA 2BS9A 4S3CA 2DT0A 3PNUA 1H09A 3DKLA 2BY2A 1ODUA 1KCKA 4G5DA 3P67A 1TSIA 5CGMA 1C7SA 4HNCA 3VGFA 3FLUA 4HZMA 4A3UA 7REQA 4X60A 1CT5A 1P7TB 1YXYA 3B9EA 1W3TA 2Q8LA 1O66A 1RP9A 2VFEA 5CBJA 3OBKA 3S9YA 3I3DA 3CQHA 4ILSA 1HJVA 3EMQA 5I7GA 5CC3A 3VDBA 3N2OA 4Y7EA 4HPNA 4XAPA 1M41A 1KO0A 3BLDA 3URAA 3C6CA 3B0XA 2P50A 4Q4KA 4U2YA 1R3RA 3MPGA 3QGAC 1OD8A 4LVBA 1W3JA 1PTDA 2IS7A 3LXCA 2E8ZA 2E9MA 2OZ3A 3FHQA 3AFBA 1B9BA 3AYVA 5JQ9A 4YWIA 1YQ2A 3OBEA 2H8ZA 3P82A 3U5UA 3EX4A 3FV9A 3LOTA 3NG3A 1U5JA 2V5CA 4UQ9A 2Y70A 5E0FA 2HTMA 2OVLA 5A6AA 3QC3A 2OJPA 2ZFAA 2J8GA 3BJFA 2CHNA 3O2LA 4EXQA 3SN1A 1JZ7A 1YHTA 4K8EA 3KFTA 3SCSA 4LV4A 2OU4A 3WNNA 2DVTA 5LKYA 4YCPA 5SWUA 3HFYA 1KTNA 4GG9A 3HQNA 1Z48A 3LY0A 3MM5B 1YYAA 1GZGA 1A0CA 4HJWA 4YNGA 1L2UA 2ALRA 1WKFA 3ZVIA 3SRKA 1UR4A 3GVRA 5F1UA 4JIHA 2PTYA 4O4VA 1W8GA 2PWHA 3URBA 3URNA 1R30A 1WX0A 1PEZA 3UWVA 4AG0A 3UWYA 3C4UA 1CECA 2OLHA 2VEIA 4XVEA 1JPKA 2QMJA 3RX2A 4ASTA 2VOMA 4A3RA 4GRSA 1HT6A 1VP5A 4QDPA 3U7BA 1VRDA 3PTKA 1XQLA 5LNWA 5CZJA 1GKPA 1SGJA 3UXKA 3GTNA 4O8RA 1OHLA 4PMXA 3WUFA 1IZCA 1F6YA 4LQ1A 2CC0A 4JIQA 2G41A 2GJLA 5LZLA 4KEUA 2V81A 4UQDA 3POHA 2VCBA 1J5SA 2XIJA 4IXHA 3KCJA 3HBLA 4D72A 3TN4A 3G2GA 1BHGA 4JFWA 4O8AA 3REQB 1SQ7A 1XPYA 3SFKA 1QTWA 4DYKA 1O5KA 4C6EA 2OX1A 3MUXA 3K46A 4B4HA 4UB9A 2BB0A 2QCLA 1VPQA 1H7NA 2Q8ZA 1GKRA 3BGJA 6XIAA 2QF7A 3NDYA 4UR7A 1RJRA 2Z26A 5I3IA 3N11A 1PO9A 2Z0IA 2PS2A 1R9XA 1P4CA 3ISIX 4IMCA 1SW3A 5GJPA 3FXGA 2VX6A 2ZVRA 4KWSA 4E4FA 3K1DA 1M5WA 1G9HA 4HBKA 3NURA 1SFSA 4WY0F 4H7ZA 2GQ3A 3MT1A 1YDOA 1DE6A 2VZVA 3WLSA 2VGGA 3P5ZA 3W7OA 5FF0A 1YADA 4H6QA 4MWAB 2YPIA 1THFD 4QE5A 3OA3A 2VD9A 4LS1A 3VKAA 5A6BD 5I3JA 1J2WA 4LOCA 2VC7A 5I06A 2PDCA 1GG0A 1XR2A 3VVGA 1UOKA 3QY7A 1JUKA 1BGAA 3JR2A 3R8RA 1V3IA 4C6QA 1ISYA 1XHGA 1J6PA 2PU0A 4IMEA 1VD6A 2WHLA 2PDXA 4Z2KA 3CZLA 3QXBA 3QZ6A 1QJWA 3NJ3A 2UY4A 1X6LA 3HPZA 3W7CA 2ZX8A 3AIBA 3ABRA 1WB0A 4JXCA 1DXEA 4DJDD 3W2UA 3NNTA 5AKQA 2PUZA 4IMFA 5CZSA 3SDOA 1EKOA 4DZHA 4KCVA 1P0EA 5G1YA 4Q8TA 3KE0A 3AS1A 1DE5A 1OCNA 1MMFA 1MW3A 2ZRVA 9XIMA 1T99A 1QPQA 1OZQA 1GT8A 2BFGA 3PZTA 2TRSA 2WZMA 1TRDA 1Q6QA 4GZJA 1R7OA 1UP3A 2I16A 4LY4A 3G6MA 4H8UA 1W9XA 2O92A 4KWOA 2J6VA 3F5LA 2OT0A 3CHCA 4PTMA 3H55A 1L6WA 3GAKA 1EBHA 4YYCA 4HOXA 1XG3A 3AICA 2BWGA 2V2CA 1KBKA 1OC7A 4HVXA 1AQ0A 1TKKA 3TC7A 3QC0A 3LV5A 3I68A 3PR2A 3W2MA 2TYSA 3A3WA 3MMWA 3PJUA 1AW5A 3AROA 1E1CA 1KM5A 5HWJA 1TV7A 2RKXA 1VKFA 1RZMA 2HE5A 3UWZA 2W66A 1V0MA 5H6HA 1FCQA 3IIPA 4B9ZA 1IQ8A 1WDQA 4C6FA 4FOUA 3P0XA 2BGNE 5M03A 1G01A 4EXAA 2Y8VA 2YCJA 4BCEA 3GBDA 1EO7A 1GVOA 3QYSA 2XSXA 1SO4A 1H0GA 3A22A 4WSJA 4O1BA 7TAAA 1EC9A 1YDYA 2F2HA 4P8WA 4X0VA 1QBBA 4V1XA 5M1TA 1DORA 4BQ3A 3FNDA 5HBFA 4H1ZA 4NVTA 3UR5A 4PCNA 2WJEA 3LD5A 4A3YA 5K9CA 3MYOA 5AC4A 1H62A 2DIKA 4GGHA 1S1RA 5AY7A 2V3EA 1EUNA 1AK5A 4DYEA 2VFIA 3MCNA 4U3CA 1XM3A 4GO8A 2WMHA 4L4LA 2TODA 3OP2A 1VJIA 4AY1A 2FQIA 3RO8A 1UWAA 3CT7A 4NT0A 4ZOAA 1DWJM 2XZ7A 4C60A 1K9EA 4U4MA 1PE1A 4EAYA 4LB4A 2O56A 3HO8A 3VOCA 3PZVA 1WXYA 1D7KA 3LYEA 1XSJA 2QPUA 2C0HA 3VIMA 5GJMA 1BYAA 5CPSA 3W22A 1NSJA 2HNEA 1UA7A 1QMLA 4O57A 4PFHA 3A9BA 1KV8A 3VKSA 2H9AB 2I7GA 2A5HA 3G77A 3OBAA 3WQEA 1VR6A 1W9VA 4TVUA 2GL5A 3B8WA 3UZXA 3GDKA 4W4QA 3EX1A 1ZAJA 4KFNA 4Q33A 2C7FA 3HQPA 3NQBA 2XN2A 3C52A 1F2JA 3I6TA 1MQQA 3DYMA 2HEJA 1M65A 4GQGA 3W7LA 4C65A 1BFNA 1CXLA 1LL4A 4HPGA 2OEKA 3IK2A 3K8KA 1LUCB 4E8CA 4IMGA 3WQ6A 3MM7B 1RBOB 1A5OC 3O07A 2FGLA 1XPGA 3BXWA 1JYXA 3NQ6A 2WZIA 3E12A 4DO4A 1JNDA 4HKPA 3QHMA 1GNXA 3RXZA 2E67A 4KIRA 1QW7A 4TU1A 3ONBA 3PTQA 3KDOA 2O7QA 1SO6A 3W81A 2PMQA 2PDPA 4GHRA 1QCWA 2VI0A 1V6TA 2Z29A 3U57A 4B91A 2NQLA 4UMAA 3T44A 4BQ4A 4FNQA 3H54A 3T2QA 1SZRA 2VVNA 4N7QA 4LW7A 1JL8A 1UROA 1B4KA 4UZUA 3GDRA 4IT1A 1VCFA 1XBYA 1IXQA 3SUTA 2VO5A 1X8CA 3O63A 4H41A 1TPUA 4PEEA 4WCJA 1O6IA 3LPPA 4YTTA 4XWUA 2DZTA 4JTAA 5CC6A 1CIUA 4WEVX 1V3JA 2NSOA 2CLPA 2WZHA 1TZ9A 1BVNP 5LSMA 2ZA3A 1FKWA 4AD0A 4AW7A 2QCEA 2FTWA 4IPJA 4WDXA 2WCAA 4JX5A 1YW1A 5CGQA 4OKDA 1TX0A 4JL2A 4L7ZA 4QDMA 1T7LA 2L5HA 2NV2A 3HA1A 4QLJA 1XRVA 3N4AA 4GY1A 1JDDA 2W6RA 4CQDA 2O9OA 3OLIA 3W3OA 3DFSA 2ATSA 3N12A 1EJSC 1VIZA 3VD5A 2ACSA 3UA4A 3MWCA 1RUSA 1US3A 5I78A 4MWAC 1GONA 2WHJA 4X61A 1WAWA 2Y85A 4LNCA 2P3EA 4H9VA 5DRCA 2CLMA 3CZ8A 3GXNA 4MLJA 1KRAC 1QUMA 1GPFA 1BQCA 2ZX9A 1V08A 4F4RA 4LGXA 5A6BA 1EP3A 1TX2A 3SQLA 2ZWYA 1NQ6A 4IP4A 1W5QA 1DQUA 4JN7A 4H9ZA 2AAAA 3GWQA 3QJAA 1CB2A 5FESA 4XG1A 3IACA 1YNYA 1XC6A 2F9RA 3ZT6A 1TIWA 3BAIA 4H3DA 4D8ZA 4DF2A 4BEQA 4V27A 3AO0A 3R79A 4HZ7A 1U22A 1Q5MA 2PWVA 4KPLA 3FYPA 5HOSA 3STGA 1LQ2A 3FIGA 1YEYA 3EOUA 2A7PA 2QAFA 1VFTA 4LAUA 2D2JA 1DP0A 3OGRA 3TR9A 3W53A 1QI0A 5H8MA 3AIVA 4DUOA 3OU8A 1GOKA 3UCCA 2V3DA 4AWSA 2OWXA 4FNRA 4UNKA 4DELA 2WMJA 2XWDA 1UD3A 1RSCA 4YCOA 4GX9A 1S5MA 4JY8A 5FAJA 1A3XA 3D3FA 2PDGA 4EWJA 1GGOA 4UR9A 1OJXA 2VR5A 3WQ5A 1EQPA 4CN1A 3NZ1A 1FHLA 3TWBA 2V4JB 3T55A 1EL3A 2W3ZA 3FGCB 5DBUA 2W91A 1JQVA 3DC0A 2QHAA 4MFDA 5PTDA 3EWXA 1EOKA 1U30A 2OO6A 4UBPC 2VVSA 3N04A 4M29A 1PKNA 1UJQA 2R1LA 4IPNB 4ROQA 3MUCA 1DBTA 1XBXA 4LCRA 3GR4A 1BTCA 3CUFA 3RITA 2NX1A 4N9CA 4C7GA 4M5PA 3RIKA 1VPYA 2YW3A 3VABA 1XCWA 4C1NA 5CPTA 4DBUA 1HVXA 4O16A 2DUXA 1S2WA 3KBNA 5IFPA 1TQXA 4EIVA 1QDSA 3W1NA 2NXHA 3ZJ6A 3UG8A 4D8AA 2FJUB 3W6MA 5IDZA 1FHDA 1BWVA 4IIEA 4MMWA 2Q01A 1MQPA 3KVLA 4R7JA 3VD4A 2D1ZA 2VEPA 1O60A 3QF0A 3VKDA 4PSPA 3IJ7A 1XISA 4BQ2A 1BYBA 2INFA 3XISA 1D7FA 4K1WA 4GGBA 2I9UA 2O9TA 2WBKA 3EMZA 3EWUA 2J79A 5C70A 5A8MA 2VX4A 3QQ0A 1IXPA 1A5BA 4M82A 1D9EA 1HKKA 2O9PA 5CJNA 2X1RA 1K02A 3M5XA 1QWKA 4GNVA 5J5DA 2DZWA 3TTOA 3QMSA 2GWNA 4XAYA 1XP3A 3LHYA 2H9AA 5K9DA 3NQMA 1A49A 2ZZ3A 1ZY9A 4HPXA 3DFOA 3PZIA 3C86A 3L0NA 5MKGB 4R5EA 2OO0A 2CEQA 4UQEA 5CKSA 4NJKA 7PTDA 4L64A 3T81A 1OM0A 3TMLA 2V30A 4UTFA 3O0FA 3NL2A 2G8ZA 2DPEA 4C6MA 1TPB1 1P1XA 3CAVA 1DIEA 2YA1A 3BLOA 2HNHA 1YTDA 1XD1A 4NSBA 2DZVA 4O12A 4MWAE 3HPXA 4LVDA 1DWFM 4GNKB 5XIAA 1M1BA 2J13A 3JZEA 2PP3A 3CL7A 1IGWA 4UXDA 3RLUA 2Y7DA 3W72A 4JTDA 2CLOA 3UZWA 2V69A 1OC5A 5AFDA 5A69A 1UUQA 1EF2A 2Z1BA 3LSBA 1HQTA 3H70A 4GXPA 5C8BB 3CH9A 5AHLA 1W17A 2PBGA 3L5MA 3MI6A 6REQB 2PWUA 1XYMA 1EBGA 1XLGA 1JQXA 2D24A 3WF3A 3WDIA 2RGLA 3WQVA 2X1TA 2FZDA 5D38A 2UZ9A 2XIQA 1I0BA 4LRSA 4A29A 4HK6A 1VBGA 2ZZ4A 1FWEC 4H6RA 2CWNA 2GVYA 1KGWA 5CBIA 2Z7KA 4KQNA 2C19A 2FB3A 4H4IA 1I9CB 4J27A 1R85A 1AVAA 2VZOA 1CDGA 2YOCA 1R8LA 3UGVA 4KMQA 2J24A 5DQPA 5CPNA 2E1DA 2XVLA 4P2VA 1LL7A 1GOIA 4GYKA 1UD2A 5CAKA 3KLLA 2HK1A 3IVUA 3DEQA 3RGTA 3W1LA 4GXMA 1V6WA 3KUMA 3P2VA 4FLRA 1J93A 5GQBA 5HQMA 3M44A 1D3HA 4XZNX 3PBMA 4L6HA 2Y5JA 4JQ4A 1I4NA 1DJXA 2J78A 3UNDA 4WD0A 3B8DA 3A4WA 2W5FA 2C16A 3L4TA 1VEPA 2OZ0A 1A5UA 1H3GA 3DBNA 4H7VA 3DESA 1D2KA 3UXLA 4UQBA 1QT1A 3TONA 1XKJA 2OZTA 3OQ8A 4LFYA 4AMCA 2Z1KA 5FF3A 3HJZA 5I3FA 2WPBA 2H3BA 1B5TA 2Q02A 1OINA 1P5BA 4IMAA 1HGYA 1GTEA 2A6NA 1EGVA 4O52A 3PNZA 4AZ5A 5BMXA 4IL0A 1HL9A 5I5RA 3ZO9A 1Q6EA 2C6QA 4EAMA 3IUDA 1LOLA 3AJXA 4UTTA 5F2GA 1V7YA 3VDGA 3G1RA 3LQGA 3FJ4A 2FHFA 4C1KA 3SIZA 3UXAA 2E40A 3GS6A 4MWAA 5EGRA 2ACQA 1T41A 4UFLA 4H9TA 4DF0A 5A6SA 3WBEA 4CN6A 3FEQA 4ZB2A 2E6AA 2QKFA 4ZOBA 5BMWA 4Y9MA 1SR9A 3FKKA 3MMAA 1KCZA 5A8PA 1RA0A 2OXNA 2ZBTA 2WYSA 3VA8A 2XVGA 1F8MA 4F2BA 1DV7A 5FIPA 4RV3A 5M3WA 5HWMA 4DPQA 5DO8A 4NP7A 5F2LA 3P8JA 1NQKA 5D04C 2RHGA 1OFOA 1R87A 2R1MA 4AEEA 1EZ2A 1J01A 4R33A 2FTPA 3F2CA 1VQTA 2B7OA 1PZ0A 3SM0A 4AF0B 5EPDA 3WK1A 4Q7NA 1H11A 3G5EA 5E5CA 2DT1A 2RDWA 4AHQA 3K13A 3C2VA 1LBFA 2WSPA 3VZYA 5BWAA 3HURA 5BYWA 3QQWA 4S39A 1T96A 2ODOA 3CASA 4JGDA 3G0UA 4CLMA 1Q8JA 1SSGA 4FF5A 4KGLA 4EE9A 3AXIA 5D2TA 1A80A 3ZT5A 3THQA 1WDDA 2ZUNA 3GUGA 2JF6A 1W5OA 2DT3A 8XIAA 1F6KA 4JKMA 1T8XA 2OYLA 4URIA 3NYZA 4XX6A 4L1XA 2I14A 2ZDRA 2PC8A 2JEQA 1A53A 4OBRA 2PRMA 1K4HA 1WDPA 1GWJA 5AN7A 3W70A 1ZCCA 2Y8UA 1TCMA 3VM1A 6ENLA 5HNNA 4UFHA 3T78A 1WKYA 3U48A 2V4JA 3CHEA 3WJZA 3FYOA 2FPYA 2G3FA 2BY1A 4O1AA 4FLQA 4A8RA 3ZM8A 3W1AA 4DZAA 3SUUA 3ITOA 1ME8A 3CGTA 4E4UA 1JPHA 3HG2A 1H7PA 4IFRA 4NX0A 3R4IA 1CX9A 2WB5A 4QIUA 4MY1A 2AMXA 1I1WA 4QNEA 5AZ1A 1SJAA 4LF1A 2YIHA 4UCFA 2VJXA 5CGTA 3FW6A 1LT7A 4JL1A 4M0XA 3R10A 4ZO6A 1BG9A 1WE5A 4BI6A 1FHUA 3N17A 2BVDA 1J96A 3GB6A 4UMCA 5ECUA 4JTTA 2XU2A 1BSLA 1WP6A 4A3HA 1A4MA 2GGEA 4S3BA 3SUWA 4LVAA 3RM8A 5DMNA 3R0DA 3RRXA 3K4WA 1Q85A 2XGZA 2INZA 2Q3OA 4MJ2A 4O10A 3PWAA 4O53A 1TREA 1NF0A 1GOOA 2DSZA 2DZPA 1UKOA 4GI9A 2GUYA 3KBSA 4KWVA 3G1VA 4CQ8A 3B05A 2WCSA 2JFEX 4EPEC 1DKWA 5FEWA 2DJLA 3ARXA 1U83A 4IFOA 2HPIA 5EMYA 3PBUA 3QPZA 1CI1A 1TMQA 4F48A 3WDRA 4BKNA 1W1VA 2ZRWA 2DORA 2DUZA 1B90A 4AVFA 2EXOA 1E1FA 4QHRA 4RJEA 1N8WA 5FF4A 5B7YA 3JU2A 4BR1A 3OZPA 2Q8XA 2CWXA 1R3QA 4WOZA 1OY0A 2GJXB 4FMVA 3LV6A 5HDRA 1TUFA 1BKHA 3GG1A 2XGBA 3AXKA 3CWOX 2QUVA 3FAXA 3ARWA 4PCTA 3EDJA 2NLYA 5LHEA 3DXIA 4OGZA 2MANA 1CGTA 1N55A 3BAKA 1P1MA 4PMYA 3VX1A 2HVOA 2B7QA 4DO5A 5DCDA 3RO6A 4FALA 4K1GA 4I5RA 2R8WA 2VQUA 1OADA 3EWDA 1GYLA 4ZR8A 4ZXLA 3MSGA 2XFYA 4MOZA 1TJ0A 5L9FA 3BAJA 1NU5A 1B3OA 2BGSA 1XYFA 3VNMA 1EJWC 3A5FA 4QJ3B 3EAUA 2QV5A 2VUYA 5HJLA 4DZ5A 5LIWX 3DHDA 2NQ9A 2I9EA 1SO5A 5FF2A 3QH2A 1HKWA 3PBYA 3QFEA 4ZODA 4LVGA 3QOKA 4DJEA 5I03A 1F6PA 2FDSA 4LCSA 3S1UA 3GKAA 1MYRA 1CXKA 3E2VA 2NX9A 3A64A 2ZX7A 1KM3A 3TCEA 4NJGA 3T8LA 4CVWA 2Y1HA 4DB7A 4EF8A 4JHZA 4AIEA 2Q71A 1R3VA 1ZJBA 3EOEA 5D32A 4BWLA 1GYNA 1V0LA 1X8FA 3QKEA 4FX6M 2OFJA 1EZWA 1ONEA 4F0KA 3SB0A 1FWSA 1QRQA 4FO4A 4KFOA 3WL1A 1PHQA 4J7RA 4K38A 5CZTA 1VZWA 2WSQA 3CUJA 3R0UA 3NQGA 1EP2A 1WXJA 2CLEA 2ASHA 2PDNA 2Z4GA 3NGJA 3SCWA 3VLYA 1V8EA 1I45A 3LZ3A 2WZEA 4L4PA 4RV8A 4RXFA 2X0HA 1DVJA 4PCSA 1JCLA 3CMGA 2A3AA 3B0NA 2J88A 1K7EA 2IKHA 4FHAA 4GUJA 4O1FA 3N1AA 4YU1A 1XW8A 1NWSA 2YCEA 3VGDA 1O5RA 1S5VA 1JCTA 1TJ2A 2JGYA 3UZ5A 1V3MA 1XX1A 2QPSA 2A7NA 1Z3NA 3OZOA 2R6OA 3AHTA 4OQVA 2WHKA 5I6SA 3R6IA 1DJNA 3AWNA 4JTLA 4I9AA 3UVIA 2AGKA 5IHSA 3BUVA 3WFAA 1TWWA 4RZ5A 1YTEA 3T2PA 4DY1A 4UQAA 4C6OA 3ZJ8A 5C9ZA 1QNOA 2VUNA 1JAEA 1E55A 2VR4A 3CUGA 1Q45A 1HNYA 4IIGA 3Q65A 4REQA 3GVGA 1ZAIA 3BV4A 1E0VA 4FAMA 1XV8A 5EKYA 3EGJA 4AX7A 3SR7A 4TTUA 1FWRA 4CEXC 3W76A 3G3MA 3QR0A 2PGEA 1ZFJA 4WSKA 4YLWA 1CXEA 4CNUA 3H2MA 4PE8A 2ISSA 1F05A 4RDYA 1I1XA 3FCPA 4QROA 2CFFA 1BSIA 3QR3A 1DIKA 1OX6A 3FA3A 3KTXA 3KP1A 5AC8A 4W85A 3FSTA 3LMZA 4HJFA 2P8CA 4WKHA 3UR8A 3GHRA 3W87A 3R8HA 1NWUA 3W07A 4GQ0A 5D02A 1HP5A 1W5PA 2V5BA 5FJUA 3VKTA 4RX0A 3ZR6A 1ISVA 1YNQA 1DPMA 4O19A 3DFPA 2X1IA 4LCQA 1ZB5A 3DZ1A 2UBPC 3AUOA 5A95A 3DHUA 2DZBA 3OQEA 1DJQA 5D2YA 4I9MA 1PWLA 3M5YA 4Q3MA 4GUIA 1B9ZA 4O1DA 2CCRA 4PCPA 4H9XA 3R7MA 2OSYA 3AMCA 1W0MA 4PEKA 4CVUA 3ARVA 4O18A 1NTHA 3I6RA 4C1NB 3VGGA 5KINA 1UB3A 4FOKA 3XIMA 4B4FA 3MKCA 4CD4A 1EWEA 2VTFA 3M0LA 5U7SA 1A5NC 3N4FA 3CMJA 3VMPA 2GOKA 1Z89A 3I7QA 5D2VA 3UJSA 1PIGA 1JDCA 3DI0A 3EMCA 3E5BA 1MFVA 1VGAA 2YDQA 5LA0A 2G4FA 4Q8OA 5E9AA 4PBEA 4FXFA 3O6AA 1R5YA 1PZ3A 2YDRA 3L4UA 3GNNA 1TMHA 1A5CA 1OD0A 1TQJA 4AWEA 4JN8A 3WMBA 4B5VA 4FZIA 2J7DA 4LC8A 3G24A 4GUFA 3W84A 4HMCA 3PBGA 4KBXA 4JKKA 4ZZ9A 2HS8A 3W88A 3S8HA 4RDWA 1IR1A 2V2DA 3B9NA 2O4QA 3VNDA 4NAFB 4B9YA 3CV1A 3TWAA 3BTNA 3IGXA 3NM3A 2PF8A 3A4XA 3L65A 3MMCA 5EFDA 2OKOA 3ZR5A 4RL3A 4GO9A 3TSBA 2E6FA 4LBUA 7XIMA 3A13A 3CAWA 3H7UA 3BE7A 1PXGA 2W67A 4NAEA 4JN6A 4ML9A 3TSDA 3KWSA 4NZFA 3EB4A 3VIKA 1DJZA 1VEOA 4MG4A 1FWNA 2QGHA 4QG6A 2DGAA 5HAOA 2X30A 4AZGA 1XYBA 2OODA 5DX7A 1W6TA 4IGMA 4L4OA 2ZQ0A 3V0TA 6REQA 3CHDA 1Z9AA 3VCNA 1CEOA 3RN6A 1U1HA 4OECA 5A8QA 3OR2A 4HMDA 1MXGA 1UPPA 1X1OA 3NYDA 1EC8A 3ZLGA 1JCJA 5F7UA 3L4VA 1GOQA 4IIFA 2R1KA 1SO3A 3ARUA 1HX0A 4EP8C 2QS8A 3W7QA 2GDVA 3PHAA 1VENA 4G1KA 3HIJA 2H8XA 3SFWA 2EAWA 4IUOA 5AZ0A 2WOQA 3PM6A 4Z08A 4HU4A 3DKJA 2IKGA 3VCCA 1NWRA 4AFYA 4HYRA 3B3DA 3EEGA 4XZBA 4PC8A 3MU7A 2ZUMA 1FTXA 2E1WA 3AMLA 3H22A 3W37A 3C8FA 3CUHA 2DV0A 5KMYA 4FP1A 3KEHA 1I2QA 1MWOA 4AB4A 1YPXA 3GO2A 3KRUA 2NVAA 4J28A 1KFWA 1UZ4A 3W1MA 4WX2A 2WJFA 4M1RA 1V5XA 4AC1X 4R9XA 5FJIA 3AIEA 1XBZA 3CNYA 1F5ZA 1TV3A 1V7AA 2R14A 1Q63A 1YXCA 3G1SA 3W86A 4QDWA 4WXZA 3W7IA 4DHGA 2YSWA 1PDYA 4P5UA 3WFZA 2WQPA 3E0VA 1SMDA 5FJOA 3THDA 4QG8A 4LYQA 1LWJA 5HK4A 2HMCA 5IHRA 2R1PA 4M3PA 5AC6A 4LH8A 5C54A 3N2XA 5C7HA 2AMGA 2W61A 1PZ1A 3WF4A 3CZGA 4MF4A 3P0WA 4MNJA 4IFKA 3B4YA 4LTSA 3W1TA 2VR2A 1J9YA 1IEWA 2Z2AA 3IJLA 3NQ8A 4OBSA 3V1HA 4MHBA 3SADA 3QMRA 2EG6A 2PA6A 5CJ5A 3U2OA 2XFWA 2BMBA 7TIMA 3E9AA 2BXYA 3ELFA 3ANYA 3V3WA 2PDQA 3EWYA 2Y63A 3WQWA 1CGVA 5A5WA 3TYBA 3L67A 3WDQA 3JW7A 5A2BA 3PTMA 3VUPA 1EFZA 4JIPA 1OGBA 1YMYA 2WVVA 5F4WA 1EJRC 1SFJA 1ODZA 3GXIA 4R3UA 1MNSA 2FYMA 3LLXA 4QAWA 2Z6JA 1PB0A 1VJSA 1ONWA 1UWTA 3GDLA 3OZYA 5FL0A 3QY6A 4AC7C 3B4UA 3GC5A 4JQ1A 1EHAA 3UXDA 1P6CA 3G22A 3BLFA 3MANA 4LYRA 3KW3A 1B3YA 1JNEA 3OHIA 5LGZA 1FVPA 2C13A 2DT2A 3N2MA 1SVDA 1NJJA 3GYEA 1M7XA 2PWEA 3W25A 4D1JA 2D2OA 1I8JA 2QVHA 1E70M 4Z1DA 4BF5A 1AD4A 1P0BA 3UXIA 4CGTA 3W02A 4NY2A 3E49A 4CQCA 5FD0A 3EX3A 1E9LA 4PRWA 1Q6GA 4N42A 4EPDC 3LBCA 1D3CA 4HZ6A 4PA8A 3VOIA 1EEPA 2XN0A 4C1LA 1XGDA 3USZA 3H53A 5JBDA 1S2AA 3GC4A 3WL0A 1V02A 1UWQA 2FZMA 5ENLA 3FS2A 4PUJA 5LNUA 1G0CA 1PIIA 4GUHA 2IW0A 4GLEA 1FWBC 3SZ8A 3DG3A 3F4DA 4XZWA 3APYA 3W7EA 1NVMA 1SPQA 3Q94A 4LUTB 1TPVA 1HJUA 4GWEA 2SFPA 3MY9A 3P5YA 3WLOA 3GX9A 4ZQRA 3VD3A 2DUAA 1LLWA 3PG9A 1POKA 5G2HA 4D6JA 4FX8A 1BWLA 3AU2A 4ZQNA 4AIBA 1QNRA 1EX1A 5CPQA 4ZXOA 3CMFA 4FOJA 4BI5A 2QAPA 1JD9A 4PMJA 4UTLA 3V4BA 3A21A 4M7SA 3R0KA 1ZLPA 2IPGA 4IPPA 3BPWA 3BAWA 3LHTA 4UUIA 3VINA 3D0CA 1TV2A 4V33A 4DJDC 1ML1A 1AW1A 4G39A 2ZXQA 4AYSA 3VM0A 1ZP4A 4U5KA 4FNPA 4ATLA 3W7PA 3KS6A 4DM2A 1F8IA 3SCTA 1HO1A 1GVEA 2AQVA 4LVFA 4YHGA 1AW2A 4HHHA 1X39A 4CNSA 2C0AA 1UMYA 5MKGA 4MUZA 1X6UA 3PP7A 1U5HA 4LUSB 2VGIA 3GC2A 2DJXA 3GTIA 3OR1A 1IZJA 2W4XA 2H6RA 3P8IA 3HV9A 1OGGA 1TVNA 4CNNA 1F74A 3U9IA 1FWDC 2OTDA 1SZNA 1SSDA 1CZ1A 4PODA 1KFBA 1TYGA 1VLWA 3IV8A 2ZC1A 4Q8MA 2VEMA 6GEPA 4IPLA 3EKLA 4AZ6A 2Y7GA 2OYMA 4H8HA 1LF1A 3RR1A 5G2WA 4MB5A 3E2SA 1LUCA 3DH7A 4F9JA 1VYSX 1OEPA 5H2ZA 3STFA 3MM9B 3WZ0E 1Q2SA 1KW1A 3ITTA 4OVXA 1CBGA 3WFLA 3HJEA 4LNYA 3ZYZA 1KCLA 2JGQA 1RCXB 3AZSA 1EEXA 4J1OA 1FCBA 3QY8A 3EPMA 1UC5A 1K9DA 1QO2A 1Q65A 1C3FA 4RR4A 3K5XA 1DJYA 1TO3A 3KTSA 3NUKA 1MZRA 3QM3A 4AH7A 1BPLB 4I8DA 4UFIA 4UQCA 3UZJA 2BXZA 3WF2A 2ADAA 1OCBA 4HA0A 4QEHA 3NZRA 1JYVA 5C9RA 4XZ9A 1J0IA 1KNWA 2X16A 2YCIX 3LSCA 1LM1A 5FSDC 2BTMA 3N25A 1S3HA 1UD6A 4DWSA 4JBRA 2F6UA 3TKFA 2EPLX 1JUEA 4WR3A 3ORWA 2ZICA 3IJ8A 3MM7A 4K2SA 4WVXA 2D3LA 4DAFA 3GSMA 2C71A 1FDYA 3SJ3A 4C6DA 2NVCA 4GABA 1LG2A 2NT0A 4NI3A 5G1MA 4YL2A 3SN0A 1EP1A 2YL6A 2DZUA 3FOKA 3GXFA 2XTKA 4PMVA 1S46A 2E68A 4JNZA 1WDRA 3FA5A 4HP5A 4MUPA 4J9JA 2WNWA 2PWGA 2XFFA 3PB0A 4QLKA 3WQ8A 2OCZA 1LWIA 4FK9A 3T08A 4CNTA 1FWTA 1OX4A 4Q7BA 4RPPA 3RPDA 4PMOA 1RLDA 1QW8A 3FFSA 3LENA 5BOEA 4GYPA 2WANA 2Y61A 2AAMA 4ZSTA 3CH0A 1YE6A 4UMBA 2G4JA 3B06A 3HZ3A 1I2OA 5I02A 1KQYA 1EPVA 4IF2A 3U8GA 1WQ5A 2B7NA 4OV9A 3NWRA 1RK5A 4MNKA 4R53A 1GZ1A 3TA9A 4MJ4A 1LZOA 3M1ZA 1VFHA 1NDWA 2PI6A 2AOPA 1EQCA 5FJRA 3WK0A 3LLFA 4ZO8A 2QDGA 3S2JA 1W1ZA 1Z32X 1F3WA 3RNDA 1AMYA 3EDFA 3VDHA 3W73A 3ZLHA 1UQYA 4MGGA 3NA8A 2OSWA 2WJZA 1UH3A 1GVFA 2QUUA 3KP0A 3OLGA 2RUSA 3D3AA 1UKTA 2ZRUA 3S5SA 1GOXA 4HPJA 2ISFA 4TTGA 4AZCA 2NVDA 4GKTA 3VXGA 1TVLA 4GQBA 1NOFA 3MO7A 4KF1A 3UT0A 4E8DA 1RPXA 3WBAA 2WVVB 1L8NA 4HNLA 2QUNA 3WH6A 4Q7IA 5AECA 3INPA 1XKYA 3HG5A 2FMOA 4NI8A 4TXEA 1K7FA 3TV8A 1PYMA 4N4PA 4QX4A 3ABOA 2Q09A 3ITYA 5M2FX 2ISWA 3UY7A 3ITLA 3GH5A 5CPLA 2I5GA 3TTQA 1VC4A 4AWTA 3RX3A 1NELA 5D9NA 3B97A 2NSXA 1QHOA 3BOXA 4DXVA 3V0SA 3W29A 2VEKA 3TQPA 1GQNA 5AOUA 2OKTA 4HCLA 4KEZA 1AOPA 5U4NA 4ZQOA 2ZIDA 2E28A 1HTIA 3PPHA 1W9UA 2RH9A 5C9UA 4Z0SA 1I60A 4E3VA 1MUCA 2CLKA 4NZ1A 4QJ4B 2E25A 3ARTA 4A3QA 3GVWA 2JK2A 4Y9AA 3L68A 1UD4A 2G3JA 1G6CA 1ZRQA 4A8LA 2YX0A 4MB1A 4C6BA 3RMEA 1WKEA 1ADOA 5I09A 4NUWA 1EGZA 1AZ1A 3IGHX 1QR7A 1QNVA 3QLDA 5EMLA 3TOYA 4CUCA 4DF1A 3LN3A 2VKZG 1TPEA 3WH9A 2QDEA 3K4AA 4B5TA 5BXRA 4JTCA 1OG0A 1NM9A 1W5MA 4L6OA 4ERGA 2HZGA 3VKJA 4CU7A 1KR1A 1UIOA 4XSLA 1ME9A 1KM4A 4HMNA 3FJLA 4PMQA 3EWZA 2CZVA 3IS4A 3DGBA 3V0UA 2XVKA 1KC7A 1J12A 3UR7A 1FFRA 3LRMA 3QSTA 1O5XA 3IRSA 2ZZ1A 3LHUA 3KCLA 1KV5A 3VOHA 4CU6A 5KZMA 1Y7VA 2FJKA 2VL4A 2FIQA 1O94A 2GQ8A 1XI3A 4PUNA 1FWCC 1S3TC 2YGYA 3ZZ1A 4J2MA 3MMCB 3CC1A 1LCOA 1PTGA 5EMJA 1TJRA 2E6DA 1W2PA 3MP4A 1E72M 1Z8AA 4IP5A 4QR6A 3QV7A 1KA9F 3OIHA 1ZALA 3EWBX 2J6XA 1I2RA 3OPSA 1E71M 2QJMA 1UR2A 3N19B 1NAL1 1RJQA 3CZJA 5KSWA 3GEOA 1HP4A 2HXTA 3I65A 1SJBA 1UKSA 3I3EA 4D71A 1EO5A 3GDBA 4H2HA 3AXMA 1AH3A 3BLIA 1TWSA 1J79A 5D03A 4DI9A 3WQDA 1O4UA 4WY0A 4OT7A 5A6MA 3LRKA 4IM4A 4LAMA 4HU0A 4RKAA 1XDJA 3B0LA 3STEA 3L2MA 1VFLA 3UW6A 3UESA 3DECA 1D3GA 3N18A 2OYKA 1GVQA 2A6LA 4A2RA 2ZWZA 2PE4A 1XGEA 2ESCA 4BK9A 1WO2A 2FLIA 4WUIA 4IIDA 3PZGA 3CUZA 3SY5A 3NL6A 2REQA 2R82A 3LXAA 3QPEA 1XYAA 1EA0A 9CGTA 3AIQA 2V2HA 6TIMA 7REQB 5A94A 1ESWA 3OOQA 2A85A 5EBAA 3LXBA 3M0IA 4Q8QA 1F4AA 1BLIA 4ADUA 3KS5A 3PB2A 1KXHA