4S39A

Ispg in complex with hmbpp
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
401
structure length
400
Chain Sequence
MRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 140
structure length 400
sequence length 401
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s39A01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s39A02
4S39A 3VKSA 1AOPA 1TWZA 3VM0A 3TYEA 2V4JA 4PZVA 3MMAB 3MM6B 3H2CA 2Y5SA 2YCKX 1ZJ8A 4HTRA 1AJZA 4AOPA 3K13A 3MMCB 3B0HA 4DJFD 2H9AB 4S23A 3MM7B 3TYZA 3MM9A 4NIRA 4NILA 4O1EA 8GEPA 2VEGA 4C1NB 1TWSA 4DJEA 3TYUA 4G38A 4DJDA 3VLXA 3V5OA 1TWWA 3TR9A 1AJ2A 3H2AA 3TYDA 5AOPA 1Q8JA 4NL1A 4D8ZA 3VM1A 4S3FA 3B0GA 1ZJ9A 3MM5B 2AOPA 3MMAA 3MM6A 5JQ9A 2VP8A 3H24A 3VKPA 3B0NA 4MWAB 3TZFA 2E7FA 3MMCA 2Y5JA 1EYEA 4S3BA 3VLZA 3VLYA 3NOYA 4D8AA 3AOPA 1Q7MA 4S3CA 4NHVA 2H9AA 4DJEC 3VKRA 3MM7A 4DAIA 4D9PA 4DJDC 4S3AA 4C1NA 3MCOA 2DZBA 3TYBA 2GEPA 4HB7A 2XSJB 3H21A 1TX2A 3VKTA 3MMBB 3TYCA 4G9PA 1Q85A 2DQWA 4DJFA 3GEOA 3MM5A 4DAFA 2YCIX 4MWAE 4O0QA 4S38A 3MM8A 4MWAA 1Q7QA 3H2MA 3OR2B 3MM8B 3OR1B 3MCMA 4DJDD 3TYAA 1AD1A 3VKQA 3H2EA 2YCLB 5GEPA 3BOFA 2Y0FA 7GEPA 2BMBA 4DJFC 2XSJA 3H26A 4MWAC 1TX0A 3MMBA 4DB7A 2VEFA 3H2NA 2AKJA 3TZNA 2OGYA 3OR1A 3OR2A 2V4JB 4O1FA 6GEPA 4DJED 3H2FA 4G39A 2DZAA 2YCLA 3H23A 3B0JA 3MCNA 3B0LA 1AJ0A 3H22A 2YCJA 1F6YA 4S3EA 4CCZA 4S3DA 3BOLA 4MWAD 3B0MA 3H2OA 1AD4A 1Q7ZA 3MM9B 4GEPA 1Q8AA
chains in the Genus database with same CATH superfamily
3PWIA 3TROA 3ZSSA 1VEPA 3UCDA 3O16A 4LY8A 4NF7A 4A35A 4NAFB 4F2UA 3L66A 1IR1A 5BCAA 3S2CA 3T05A 2QCFA 4XSLA 4DZ5A 4GOAA 1SMDA 3EOUA 3IJ8A 3HA1A 2EG6A 4JTRA 1OWQA 3V5OA 1FBAA 3TR9A 1KM5A 1W8SA 5I02A 4HSOA 1LG1A 4OBSA 3TTSA 3FNDA 3NL6A 3WQ6A 3UERA 3QHNA 3WQ5A 4ZO6A 1JQVA 3A12A 3WD3A 3RLHA 3VUSA 3T4CA 1NY1A 4M7TA 3CZGA 4O52A 4QS6A 3BURA 4AZGA 3WQEA 4EAYA 5ABFB 1W56A 1QHZA 1UWQA 3VOGA 3D3AA 4QLLA 2PLKA 1DPMA 2EEXA 1M6JA 2Y70A 4HK5A 2DZSA 4AYSA 3GO2A 1J0KA 2YB1A 4M24A 4XQ6A 3UNDA 1NELA 3IS4A 1KM4A 1IT0A 2I56A 1PHWA 4PE8A 2XFRA 1Q45A 2Q6ZA 2CITA 4DUWA 3NM1A 2DUXA 3VOFA 2BDQA 4GIAA 3VABA 1Z7AA 4RX0A 3B0MA 3SY1A 1OFPA 3ITTA 3MTWA 3UGRA 3N9RA 4UUIA 3WBYA 3SUUA 3A23A 4JQAA 3VKSA 3UYCA 4U33A 5CZSA 1MW0A 4ZQRA 2QCNA 3PS7A 3HIJA 4P7LA 1RLCL 4TR9A 5K9DA 4AWEA 4RJEA 3W1XA 3MM7B 1Z8AA 2ZUUA 2PI6A 2ZE0A 5D04C 1DQWA 3XISA 1RPXA 4HD5A 5GQBA 5D09A 3S1VA 1CLKA 3DUGA 3E49A 4DHGA 1AJ2A 1HJWA 5LZLA 4V2XA 5CPNA 4B5WA 1OB0A 3PB0A 1X1NA 4UQ9A 3CIXA 5G5IA 3R0KA 4DBUA 1N55A 2NQJA 1E73M 3QMSA 3PUEA 4FX6M 5DQPA 1IR2A 2JF7A 4MWAE 1Q5MA 5HQMA 1OC7A 1MYRA 2VNCA 4NNAA 5C55A 4HZ6A 3HOJA 2F61A 1M03A 5A6JA 4Y8FA 2HS6A 1VZWA 3SUTA 1QR7A 2WOQA 1HTIA 2HVMA 1ZL1A 4DO5A 5FACA 2UWFA 4CD7A 1EC9A 2Z0IA 1S39A 2GVEA 3SCRA 3LLXA 4GIEA 1CXLA 1UR3M 1Q6OA 2B31A 3CZKA 2EJAA 3STPA 8XIAA 4J3WA 4ZFCA 3HQOA 3VKKA 2WC4A 2YJQA 1EHAA 3QBUA 4X9SA 1VC4A 4MYAA 1PHQA 1LQ2A 1ZBVA 2RGLA 2GK1A 4I5XA 5CAKA 1VR6A 1GW1A 1NVMA 1UIOA 4J40A 1L6GA 2QDDA 4W93A 4V27A 4ZOBA 3DC8A 4QE4A 2AGKA 1REQA 1G4SA 2IQTA 3EDDA 1RAKA 1WDSA 2DIEA 2WVVB 4TQTA 3RAOA 3WF2A 4MB4A 2Y61A 3MUAA 4JIEA 5K9XA 5IM51 1RALA 5LA0A 2HXTA 3HN3A 5CEWA 3WIJA 1PCWA 2VWTA 1OCQA 1KM2A 3ZR5A 2G95A 1FOBA 1ONRA 3VD9A 2XTKA 3DESA 2O7SA 2V3GA 3FXYA 4LVFA 4XZ9A 1GG1A 3GX9A 1E55A 4AZCB 4LTSA 4TX9A 4HPNA 1P6BA 2ZDSA 3KLKA 4OFCA 1TPWA 2V68A 4GY0A 2YW4A 2WZMA 4EP8C 3FKRA 1SMAA 5CSUA 2PTXA 1R30A 4Q8WA 2BHUA 1NAL1 1TQJA 4X61A 4PEKA 1H3GA 1EQPA 3THAA 3T55A 4AZ7A 3DHFA 4I9AA 5JMUA 5HMFA 4Y90A 2HSAA 3O6AA 2DZXA 1FCUA 4ICNA 3UCCA 1GGOA 4QDMA 4PUWA 3AYSA 2GJRA 2BXZA 1A4MA 2QAFA 3TC6A 1RJPA 2HWGA 3DG6A 1ZJ8A 3VTRA 1YNYA 2CETA 4EF9A 3CB3A 1YTDA 5LNWA 1TTIA 4AXKA 2BVYA 2I1OA 1HNYA 3VX0A 2WPBA 3MM9A 1HJVA 2W3ZA 4CQBA 3SGUA 2Y7DA 3GHRA 4G38A 4LUSA 3PBMA 1NJJA 1QAPA 4HPJA 3NVDA 1BQGA 1TRIA 4XV0A 3B8DA 3PUDA 1VBHA 1U5HA 4RW5A 5HWMA 3VFCA 3W7DA 4DIAA 4ENLA 1X96A 4DQWA 4EPKA 1PUDA 3AO0A 2ATSA 2VMFA 1GZ1A 2QMKA 1GVQA 4MFDA 4JDBA 1XLDA 4UR7A 3VIMA 1QBAA 1A0DA 2PTDA 3B8SA 3MM5A 2PDUA 2R1MA 3SCUA 4WJEA 3CWHA 2EGZA 2G3FA 5FD0A 2XSXA 3GR7A 3KBVA 4BF5A 5E0CA 2F6XA 3G1XA 4AB4A 2VFEA 3AOFA 1XX1A 1XICA 1TO3A 3MP4A 3M0ZA 4DF0A 1SFLA 4H7VA 2QPXA 4HMCA 1J0YA 1CXEA 4C6MA 3GFYA 1QO2A 5HINA 3OZOA 3UZZA 5FJRA 3NR0A 2VR4A 3P7YA 2PDFA 5HNNA 3LD5A 2HV5A 5DCEA 4V15A 3ERPA 4GCXA 3C4UA 4X2PA 2Y8UA 3M9YA 2XU2A 3HPAA 4NY2A 3VYLA 3ANUA 4UIOA 2Y89A 3OQ8A 1Y5XA 4P7OA 3GVGA 2ZA2A 3KS6A 1W5OA 4DJFD 3CL6A 1SW7A 4DEFA 3FJ6A 3PNZA 4JD4A 5CC6A 4FO4A 4F9JA 3H2AA 4D8ZA 4W9TA 3T44A 5E09A 1OVDA 3CC1A 5JVLA 3TQPA 2VX6A 3PBWA 2R1KA 1TVLA 1KQZA 3I4KA 4O14A 1TB3A 5F2MA 2KAUC 3DDMA 4LW7A 4DJDC 2VR5A 4QEHA 5D4YA 1I1WA 3UWYA 2GEPA 2OODA 3S5YA 1P48A 3GC2A 2QW5A 3TJLA 1KV5A 1CWYA 4B15A 2FTYA 1X7FA 1BVZA 1D8WA 3OGSA 2RDUA 3QJAA 3B8VA 2GQAA 4NSBA 3WYZA 3GTIA 3NGFA 5JBDA 4C6IA 4OT7A 3DGRA 3G0SA 1KRBC 2OX4A 1UKTA 1WAWA 3TXVA 2G50A 4QJ3B 4H04A 2QGYA 3RN6A 2YR1A 4RNJA 4GXWA 2G3IA 3QQ1A 5AC6A 2CHNA 4IIGA 4S3GA 4MJ4A 4DO6A 4YL2A 1GKRA 3PSVA 1A5LC 5TD4A 3BMXA 2J7EA 1PWMA 1TVNA 5D9OA 1LBLA 4JOMA 3EWWA 1R86A 5FEXA 1W5QA 4PZVA 3SQLA 1EQCA 2W91A 4HTRA 3N9KA 2O0TA 3R11A 1UR9A 2J8TA 3CUIA 3WQCA 3S6TA 4UQAA 5M17A 1Z44A 3H7UA 4AD5A 1ONXA 2AQVA 1TPH1 2PDMA 2CXEA 3MHGA 4ATWA 5T8GA 2PDNA 3OTRA 3S9ZA 3POHA 1PEZA 3TZFA 4Q8NA 1LG2A 3GH4A 3QN3A 3B0YA 1XDLA 1ECQA 1EJXC 4HNTA 1QPOA 3BSHA 4B4FA 1HIZA 4UQEA 4OOZA 2PC4A 3PAJA 2P3ZA 4LSBA 4O1AA 3WQ8A 3WF4A 3BICA 1K77A 2ZC8A 4E4FA 1G4TA 4AMAA 3ZT5A 4B5NA 1KCKA 1R0MA 3EX2A 4ZTYA 1S46A 5JH1A 3GG7A 3PZMA 5CAHA 4GXMA 4LVDA 2J7BA 1ITQA 4AAJA 4JDYA 1WPCA 3W2LA 1OK6A 2F2HA 3FV9A 3UYIA 1FXQA 3P6LA 1AD4A 1HL8A 2VFFA 1NEYA 2VEPA 1JD7A 3VCCA 3LGDA 2YA2A 3CMJA 4HMEA 4IHCA 2QT3A 1XCXA 3WNPA 3EOLA 2DSWA 1EF3A 2YW3A 1DXIA 1KFWA 1X39A 4MTVA 1R3SA 3FYOA 1LWIA 1QK0A 3PPCA 3TYDA 3C0JA 1S2TA 3L68A 5H8PA 1QPNA 4NNCA 1KR0A 3S1WA 4XUYA 5K7JA 4ZEPA 4PMJA 2WJZA 2PGWA 1VB9A 4JTUA 2ZQ0A 3R1ZA 1Z32X 3ZLFA 4Q4PA 4OUIA 1E51A 5CC7A 1W5NA 3W7PA 2IKIA 4YCPA 7TAAA 2XM2A 3A21A 4R88A 1HKVA 2W27A 3UNTA 1UZDA 4YVPA 2J66A 2GZXA 5EB8A 4H6EA 1OY0A 4U4MA 5LIUX 1KB3A 2VWSA 1H50A 3OHIA 3CMGA 1PTAA 3GAKA 1PTGA 2A1YA 1ZBKA 1UD3A 4NAEB 1E0TA 1E4IA 1OIFA 2ZXBA 5CSSA 1FWTA 4S3EA 1OGBA 1US3A 1L9WA 4JQ2A 4XD5A 3CUZA 4TV6A 2I5IA 4H8HA 1XD1A 4D6GA 1IWPA 3H54A 3GFXA 3V5CA 3LRLA 3AU2A 2HTMA 3H6OA 3W2MA 1H0GA 3TN6A 4F48A 2FLIA 5DMMA 4DZHA 1HJUA 3AUJA 3W7CA 1DIEA 3EWUA 2QJMA 1IQ8A 3U2CA 2VZUA 3H7RA 3WLNA 1GJUA 4ZOCA 4S3KA 1KXHA 1E4MM 4L9YA 3W88A 1YPXA 3ARZA 1JDAA 3L4VA 3BGAA 4PL1A 1WX0A 3SRHA 3VX1A 1YBQB 4PTDA 2QUVA 3S1GA 2W61A 3GLCA 3SGGA 2P50A 5HOSA 1ONEA 3OA5A 1FWRA 3S2MA 3T07A 2FMNA 1ZAIA 1DJXA 4ZMGA 3O7UA 1G7VA 2ZUNA 1E6XM 3R8HA 4HK6A 4UZUA 4GABA 1WZLA 3A64A 5GPRA 2FGBA 7GEPA 4DI9A 4KCVA 3TXZA 1TX0A 4GZIA 1XJBA 5BRPA 2B4GA 4H6QA 4P8XA 1OC6A 4PTNA 4IH3A 4C6JA 6TIMA 5HULA 4HCLA 1V3JA 2BHYA 1OCJA 3F5LA 4ML9A 1BXCA 4EXBA 3ITLA 1FFQA 2CXGA 4KWVA 1ZGDA 3H4GA 2JBMA 2FPYA 2VD8A 4M29A 3OVGA 4M5PA 4U28A 1OX4A 1QW9A 1XLKA 3L4YA 3W1QA 2VELA 1FWJC 5HNTA 1E72M 3NQ7A 3TSMA 1KM3A 3LU2A 1ZALA 2YDQA 3LLFA 1XLCA 4TIMA 3LLDA 3VGGA 2A4AA 4JNYA 3VM7A 2NW0A 4B3KA 3UY8A 3ZLHA 1RY0A 4E8DA 3KOXA 3A9BA 3W87A 3I68A 3PK7A 3WNOA 3NQDA 3NSMA 1NDWA 4XAYA 1A3XA 1A4LA 2EJ1A 4GC3A 3EXSA 4A22A 4KW2A 4LB4A 3N29A 4FNQA 2QHAA 5FAJA 3KHDA 4JN7A 1M3UA 2ALDA 3WJZA 3O9NA 3QPYA 4WQ6A 4G7FA 1GOWA 1KM1A 2Z28A 4DYEA 2XSJA 4CU6A 3UJ2A 4KCUA 1UP3A 3BLKA 1E6ZA 1VPXA 3VMNA 1K1DA 1MW3A 3NL2A 3NXFA 4N6FA 3NURA 3SCQA 5FL0A 2V3EA 4LEQA 3G6LA 3IGHX 3OZPA 4GI8A 4TUFA 3W72A 2V5CA 4MNLA 1QOXA 2YDRA 1JRCA 4FNTA 4AISA 3ZJKA 3DAQA 3MUCA 3AXXA 3M4HA 3RXZA 4YTTA 4C6FA 3NQGA 3EYPA 3LNPA 1LWHA 4JBRA 3DEQA 3WD0A 1A3HA 3QFEA 3K13A 5AHMA 1KGXA 3EA2A 4GYPC 3BARA 3EMCA 1DXFA 2Y6ZA 2WHKA 4JX4A 4QG9A 1YE4A 3LX9A 3CO8A 5T9BG 3H55A 4O13A 1FA2A 2ZZ6A 1TIWA 2FPTA 2OT1A 4QE5A 4Z1AA 4Z2HA 4HHMA 4KRTA 2CZ5A 4Z1DA 5REQB 3VOCA 4EPBC 3KBWA 2Z00A 5CPSA 1GUVA 3GTHA 3EDJA 4JNZA 3NFUA 3NL3A 3S6DA 1GHSA 1G1YA 1VPQA 1OFDA 2RFGA 3WMCA 1QATA 3MUY1 3W1NA 4E2DA 3SR7A 3UXIA 3VAVA 4DAFA 4ZFMA 3KEHA 4F0KA 3KE0A 3TNBA 2AQOA 1A47A 1UZ4A 4XK2A 1WUEA 2XH4A 1P6CA 4JY8A 3GG1A 1LLOA 1NP0A 1LRNA 3SCTA 1W3JA 4CGTA 3AYVA 3O1NA 4W7UA 5LGZA 6GEPA 2TYSA 2VFGA 3N2CA 5FESA 1XLIA 1B9BA 4H2HA 3LRKA 4BA0A 5F2GA 3ZLGA 3UY7A 1PX8A 1H1ZA 1R9XA 5AN7A 1G67A 1CB7B 4S3JA 1MEWA 3QZAA 4K38A 5D02A 1GVEA 3ZM8A 1V6YA 4QFUA 3CUGA 3MMAB 3CPGA 4Z1BA 3NQCA 2WMIA 4CCDA 4HBKA 4WSHA 3TYZA 1PE1A 3PM6A 2HE8A 5G4HC 2BY3A 4BY3A 4WX2A 2V5LA 3U57A 1UHVA 2X7VA 3PJWA 3Q67A 3EXTA 1PDYA 4GQRA 1P0KA 1O12A 3OZYA 3CT2A 5I00A 4K1GA 1S38A 1GQLA 1JR1A 4PCPA 3U2OA 1LL7A 3UD6A 5CBBA 3TYBA 1D2KA 4GKLA 1ISWA 3M1ZA 4I9TA 1LQAA 5A2CA 4P8UA 2YCIX 4WJ8A 6A3HA 4XIAA 2PF0A 4K8GA 1XCWA 3LGEA 1W9XA 1R6WA 3H2EA 1P1MA 3P8JA 2Q01A 4OWGA 2E8YA 3PAOA 3TLLA 1JYWA 3NDYA 2PA6A 2QCEA 1NFBA 4F2BA 1UWAA 2CLMA 2P0OA 4LC8A 1EGZA 4WR3A 3N2XA 2JKPA 2WXDM 2VEIA 2PP0A 2BWGA 2WNQA 2P53A 5AOUA 4BI6A 4NP7A 4GEPA 4G1KA 3S9YA 3A3HA 1RCXB 1Q6LA 1UOZA 1TPB1 2I17A 1MDRA 3W27A 2P8CA 1ADOA 3APTA 4MAZA 1K7XA 2GK1B 4A3RA 2Y24A 5FJPA 1GW9A 2DT0A 3UZJA 4YVXA 3ZQ9A 1REQB 1LWJA 2X1IA 1HKIA 3WF3A 4K37A 3O6YX 4BF9A 1QNSA 1XWYA 1EWDA 4A29A 1XC6A 3W75A 3XIMA 2VKZG 4LCSA 4E3VA 3M5YA 3VGFA 1IE7C 3HQPA 1JZ3A 4DBSA 1Q4WA 4HP5A 3O07A 3VGEA 1I0BA 4MUPA 3LPFA 3CHFA 3IVUA 3M7SA 5AHLA 1KXTA 1UP2A 3GG8A 3EB4A 2WSKA 3N73A 3EXRA 4JTSA 1T41A 2D2JA 4C60A 2HK1A 4GH1A 3WDHA 3POCA 1IIHA 2CLFA 5KZMA 1CIUA 5E93A 4PR4A 1EJTC 3PZGA 3WZ0E 2WHLA 1N8WA 3STFA 3UXLA 4OTKA 3WY1A 4NZ3A 1O7AA 1BXNA 4K2SA 1UCWA 3UEQA 4LY4A 3W1LA 4C6LA 4QSFA 4MNJA 1VBUA 2DIJA 3I3DA 3WELA 4W89A 1UH3A 2R24A 1YPIA 2XSBA 4HJWA 2C71A 3LGGA 1XIIA 3CPRA 3WH9A 3EX1A 1BEUA 1ISXA 4GYKA 4IG2A 2CZVA 3A3XA 4RPPA 3TMQA 3GK0A 3HPSA 3OVPA 3OVQA 3LA4A 4W88A 1OIMA 1UD4A 3STEA 4QS5A 2A85A 2CLKA 4DX3A 4G5DA 4ZB2A 3OG3A 4N02A 4UR8A 1ITUA 2HVNA 4S3BA 2PRMA 4D6IA 5KETA 3LN3A 1KQYA 2Y8KA 4ZO8A 3Q94A 1EXPA 1OHLA 1UR0A 1VHNA 4YIWA 2YBTA 4X0NA 1WKYA 1NFGA 3QY8A 2OCZA 3W2UA 4AY7A 2J47A 1WUFA 5DELA 3LCLA 1OYCA 3V1HA 3S3GA 1U2YA 5DO8A 3L0NA 5C5YA 3FHAA 3TLQA 2CLHA 4EK7A 2A6NA 1V7AA 1UH2A 4GPNA 4MKVA 2A7RA 3MZ2A 4ORIA 4AMCA 2NXIA 1M1BA 1PIGA 2CWXA 3ZS4A 2XGBA 2J75A 4S3DA 4QJ4B 3DN5A 3T8LA 5A6LA 1QPKA 4NYYA 3PUOA 1XXXA 1J0JA 3N13A 4AZIA 2VZTA 3P84A 3LMYA 3VD7A 5D38A 1XLMA 1OJXA 1TTQA 5FAGA 2PWVA 1YXCA 1BSIA 3KCOA 1A53A 3L4UA 4G7EB 2VEGA 3LY0A 4KH2A 3TYUA 1TIMA 1Z6KA 2G0WA 4DJDA 4I9MA 5JUVA 2HXUA 4ZZ9A 5EU9A 1SM9A 3UVAA 4MWAB 3B40A 4IMDA 1B31A 3W83A 1ZZMA 3KUMA 3G1AA 3ZSTA 4FSAA 3AC0A 3VKRA 1BSLA 4XZMX 1E1CA 3HM7A 3U7VA 5C7HA 3P61A 3D5HA 1FWFC 3CAWA 1XIGA 4JICA 4AWUA 1H0IA 1BXBA 3OR1B 4N2YA 3MMDA 3MMTA 4AZHA 4M8UA 4FOJA 1CCWB 3NSXA 3WJXA 2YCLB 4HHLA 3WQVA 2V69A 2BG5A 3CGTA 3VA8A 4JFSA 3U8GA 1ZU8A 4ACYA 4WEVX 1WCGA 1YMYA 2HS8A 1HGYA 1F8IA 3L67A 2MNRA 3IJQA 2Z1KA 4XZHA 4GO9A 4GZ7A 2OEMA 5BXTA 3G2GA 2R82A 1OFRA 4DNHA 4J9JA 3EBVA 4C6DA 3QLDA 1QI5A 3N2OA 3QKZA 1ZJHA 1QMLA 1B3YA 2FVKA 3B97A 6XIAA 1XRSA 3KOYA 1QUMA 4MYXA 1RJRA 4D6EA 3JU2A 2J7DA 2G3NA 2POTA 3DG7A 4KEMA 3FFSA 1VFMA 5DFAA 3CNYA 3KW3A 5A6TC 3I65A 2X09A 2IQDA 1V0KA 1A80A 1R3YA 1R87A 2BOGX 2H3DA 3H8AA 1I0DA 3PF3A 3K8MA 2QCHA 3WH7A 1E43A 3OLEA 3SDOA 3CM4A 3V3WA 3UA3A 3VD5A 5A95A 4GZEA 1EXBA 4ERIA 1I2OA 2ZADA 5G2HA 3LYEA 4NZFA 3WF0A 3URNA 4JTEA 5HK4A 4Z42C 1ISZA 1Z69A 2CPUA 4KRZA 2V2CA 1GOXA 4PBGA 1ZS2A 3RX3A 3MMBB 4CN4A 2WSQA 1VENA 2WLYA 1US2A 5A6BA 3OYZA 1FCVA 1RP9A 4XWUA 1RR2A 1V5XA 4GG9A 4PUDA 1E6RA 1R2SA 3B8WA 1F7BA 3QGVA 4QIUA 1K8CA 1GQNA 1CNVA 3KOZA 1SFSA 3ZOAA 1PO9A 3KRBA 4H7CA 3THDA 1Y0EA 1M7JA 2WK2A 2GGGA 1X97A 1LUCB 4N4QA 1SUXA 4HSNA 4C6CA 3RJYA 3V7PA 4AY1A 4KEVA 4BEUA 5SWUA 1XSIA 3TW9A 4R7OA 4JHOA 1R3RA 2OEJA 4H1ZA 3HZ3A 2D2HA 3FGCB 2VVSA 1EJUC 3GFZA 5HDRA 4RV3A 1XYFA 3W7NA 1OFBA 1SR9A 3BAYA 2Y7FA 1EP3A 4Q32A 4KT2A 4MF4A 5H8MA 1ZENA 3DU0A 5BXSA 4PEEA 3AYRA 2WSYA 2PU0A 4XBJA 3VDCA 1BTCA 4Q8PA 4Z0JA 5HJYA 1WO2A 5M1TA 5HWNA 1ALDA 1Q6GA 5D33A 3GR4A 2FKPA 3H21A 4CNUA 3P81A 3HG4A 1DIDA 2IUZA 2OJPA 1E70M 5M2FX 4HN8A 3KRUA 1GCYA 4HT3A 1ADDA 8TIMA 3LHTA 5I3GA 1TTPA 1TWDA 1BRLA 4BI5A 2E68A 1JULA 4IXXA 5AC4A 3V16A 2YXGA 1J5TA 5FF2A 4PYSA 4DB7A 4O0KA 5LYRA 2OZTA 5TIMA 1K4HA 5HQEA 2WKLA 4W85A 4UBPC 4FI4A 2J9XA 1E9ZB 1RD5A 5TQLA 1Q7ZA 5BRBA 3WUFA 5FF0A 5A2BA 3RMJA 2VM8A 1XQLA 4WXZA 3SY8A 4W5ZA 2OSWA 2GJXA 4IX0A 1Q4NX 3C2FA 3T6CA 3NQ2A 3PFMA 3B04A 3VKBA 3CHCA 3RO6A 1JCNA 3FLUA 1W3NA 4J4KA 1W9UA 3K4DA 3ZYZA 2HZGA 2B7OA 2BBFA 2Z24A 3UR8A 2PLJA 4AF0B 1KC7A 1UA7A 1MXSA 3F1QA 4F66A 1VJIA 4FX7A 3XINA 3G0UA 3GXIA 4EWJA 4HZ8A 1WYIA 3MCOA 1V03A 3UWEA 5LNSA 3BQ6A 2WCGA 1GTEA 2YYUA 2YFNA 2E67A 1WP6A 5K9CA 5CJ5A 2VVNA 1MRAA 2PDGA 2XZ9A 2AMXA 3ZZ1A 4IJCA 4JZ5A 3R10A 2I57A 2VGBA 2WZHA 4JTKA 1JYXA 4JTGA 2EPHA 3BE7A 2XFYA 3C56A 1P0NA 4MPKA 4JR5A 3LENA 2C13A 1MW1A 2OZ0A 4P8WA 4I6VA 3TCEA 4MWAD 2RDXA 3UXDA 3GC5A 4RXGA 4JTIA 1FWNA 4UTMA 2A0NA 1X1OA 3URQA 3MKVA 2EBNA 1S3HA 3HG3A 2EG7A 3VNJA 5I06A 2O9TA 4PUKA 2VCCA 3VKDA 3TOPA 3C0LA 3S9IA 2JQXA 1KLYA 1A5NC 3TA9A 1XIEA 3A6OA 4XG1A 3VNZA 3ONBA 4L64A 2YFOA 4A8LA 1KNWA 1OGGA 2YZRA 1B2YA 5GVJA 1PAMA 3JVAA 4U3AA 2Y5JA 3VDGA 2YBUA 5FKYA 3CK5A 1FWWA 4PH6A 5AECA 4GIRA 1GKQA 3N4EA 2FB3A 1KA9F 1J5SA 3PTMA 1XRTA 5CJMA 1UKPA 2AQWA 2Z1WA 2V9DA 4BQ5A 2GDVA 2TODA 3NO1A 3T08A 3LCWA 1KKRA 4BWLC 3AS2A 2C1GA 4K7YA 3ARUA 4HNCA 3AHVA 5HR7A 1H4PA 1LM1A 5EPDA 2PE4A 4EF8A 1JCJA 1U30A 2DUZA 3WLHA 4JEQA 3ZJ6A 3O2LA 3QKEA 1C7TA 3P14A 2ZDRA 1GOIA 4RZ5A 1UUMA 2XN2A 2J62A 1BKSA 2GLKA 4GYPA 5FF7A 3DOPA 4ZOEA 3EZ4A 2OWWA 3EA1A 2BY0A 3WLRA 4HU0A 2HRWA 4XKYA 3RM4A 1T8QA 3WNLA 4O10A 4M3PA 1CGVA 4HYVA 1CZ1A 4JTCA 3H7VA 1VD6A 4QG6A 3FSUA 4NXSA 3G1YA 1HO1A 4NILA 4L5ZA 3P5ZA 2WO5A 3EX6A 1AQMA 2R91A 3P8IA 4AEFA 1KTBA 3WEZA 3GHSA 5BYWA 3MWCA 1OF6A 5D9MA 4MDPA 1VFTA 3VNKA 2NX3A 2C7FA 1TCMA 3VK5A 4XD3A 4KWWA 3E9AA 4GFSA 1NSJA 3BW4A 1CPUA 3VDHA 1RH9A 1WXZA 2QDEA 3GEOA 3MDWA 2WMJA 3NDOA 5AB3A 1GOQA 1BFNA 2YPIA 3HQ1A 3P82A 5GEPA 2Z1SA 2EKGA 2VUYA 1JI1A 1ICPA 2VCAA 3REQA 2WMKA 4JTLA 1ZP4A 2CHOA 2WJDA 4ZQCA 2OQYA 1KXQA 4RDYA 4IX2A 2QDHA 2WLZA 3IK2A 1OX6A 1XSJA 2RUSA 4URIA 1A5MC 1ZY9A 3IJLA 3KOFA 4GKTA 3IARA 2PDQA 1O66A 3ABZA 1Q66A 4AHOA 3C52A 2WZIA 2EPKX 4FMVA 1JZ8A 1HW6A 3UP8A 3STCA 1DJQA 2Z6IA 2X0YA 3OP2A 4JHMA 3SGZA 3WQWA 4ES4A 1IWBA 3WLMA 4IZGA 2HVOA 3D47A 1CW2A 2ACQA 2DVXA 4BFAA 3MMCB 1UPPA 3TR2A 4FIRA 4POCA 2CNCA 2WMIB 4U5KA 2PMQA 5EFFA 4NG3A 3UG5A 4BI7A 5D30A 1LROA 3NYDA 1S5VA 3DG3A 1XYLA 2YL9A 1W1TA 2ZZ4A 1OM0A 3NZGA 3KRZA 4UTIA 1H2JA 1F4AA 2XN0A 1XYMA 4Z0SA 2DZWA 3C61A 4DAIA 4DXXA 4NRRA 3ARXA 1BGGA 1WAUA 3MSYA 1SJDA 1X7IA 1LBFA 4NX5A 1W9DM 3WUBA 1FHDA 2UBPC 1I75A 4J3TA 3JW7A 4RLIA 3EDFA 3F4NA 8CGTA 2O9OA 3IEBA 2CLIA 3DFOA 2WC7A 1VFLA 4WDUA 3P5YA 3EX3A 2XVLA 1VFHA 1PKMA 2W92A 1V7YA 2J25A 4M6PA 4BZYA 1V0MA 4HU3A 4CD5A 4GFIA 1J6OA 1V3KA 2PAJA 3SO7A 5AYXA 5IHSA 2VTFA 1Q6FA 4A8IA 3W37A 1A5CA 2BHZA 3F2BA 3QHOA 4YMZA 4PMQA 4DXVA 3DFPA 3K1DA 3EAUA 3MS8A 1JCMP 3RM8A 1PKNA 1YIXA 2Y5SA 1HP5A 4QLKA 4XZNX 1OC5A 1L2UA 1SJBA 4H8NA 2UZ9A 3VGHA 3VIPA 1UWUA 3AWNA 3BSMA 1FKXA 2X7WA 3DH7A 4NU7A 5I24A 3KOWA 1VJZA 4UWMA 5G4WA 5CQ1A 1DWJM 2WKJA 3ZMRA 4WIWA 1TKKA 3K4AA 3SCWA 3DI0A 1LRTA 4ADUA 1TYGA 3R79A 1GJWA 1ZCCA 2REQA 3WL1A 2IMRA 3MT1A 5M5DA 1BYAA 1MUCA 2Z27A 3TWBA 4LYPA 3N25A 7TIMA 5DMYA 3W3OA 3W7KA 1MZHA 3P0WA 3W70A 3G3MA 3NO3A 5DMNA 5PTDA 1U5VA 2QUNA 1TPEA 4GVHA 1C93A 3FK4A 3H26A 2ZXAA 4JNMA 3LBMA 5MKGA 1IGSA 3PZQA 1VKFA 2CLOA 4PCNA 1P7TA 4JIQA 3B0LA 1CYGA 2YX0A 1XHGA 3H53A 2XVPA 4NXKA 2J88A 3QOMA 4BR1A 1K9FA 2Z26A 3EMZA 3GG0A 4FA3A 1KGUA 3IJIA 3N6QA 1QK2A 1KTNA 3ARSA 2UY2A 5BW6A 4DBWA 1XPYA 4KERA 2OYLA 2HNEA 3NQFA 3M0KA 2E5DA 4PN2A 1N82A 4X22A 5C9XA 3LBCA 3W84A 1BF6A 2UY5A 3TNOA 5BXPA 3APYA 4PGLA 1OK4A 1LLWA 1I2NA 3VGDA 3P2VA 2B7PA 1K3UA 5H2ZA 4DJEC 4W7WA 2ZZ3A 3FEMA 2QQ6A 2ZX6A 3IJDA 2C79A 3OBAA 3LV6A 3MANA 3OGVA 5D05A 1YQ2A 4PB5A 4HNNA 3GH7A 3SCVA 3TTOA 5E9AA 3WD4A 3M43A 3AIVA 3QTGA 2IPGA 3UWVA 2CZDA 3B03A 1E0WA 5DT5A 4Q4SA 4S1FA 3QRHA 2O9RA 3W1AA 4Z08A 3SURA 3CYVA 1E1EA 2HE5A 1SO6A 1RD6A 5XINA 2ZX8A 1SSDA 2G8ZA 4HCDA 3DGBA 2OGYA 4I5UA 3VXGA 4EPDC 4J3VA 4UR9A 4EANA 3C0SA 1Q6DA 2Z7GA 1JD9A 1R47A 2YBVA 1TR1A 1L6WA 4UTKA 4GQQA 4LUTA 4N9DA 2GOUA 5BMXA 1ITCA 1OBAA 1ZTVA 3I10A 2PD9A 4AD2A 2HK0A 2WVTA 4L9XA 4J3UA 2X42A 3QGAC 3J7HA 4FOKA 4U2ZA 1OZQA 1TVPA 3KL5A 1JRBA 5A5WA 4FALA 1ZJAA 4W84A 1XI3A 2WZEA 4HTYA 3I3EA 3VKCA 4ZTXA 2EAWA 2YXXA 1EIBA 1JZ7A 4W87A 5I5RA 2VX7A 1JDDA 2ZUVA 1I45A 2D22A 2YL6A 5D9NA 4GZJA 4CN6A 2YSWA 3VCNA 3QGKC 4L4OA 4QLJA 4UB9A 4ZO7A 2IPJA 4BCEA 2X2GA 4CQAA 2O92A 2Y1HA 2PGRA 5A6MA 4JQ4A 3WK2A 2ZUTA 3G8EA 5FA5A 3SUSA 5CZTA 1XR2A 4PL2A 1WA3A 4UMBA 4IPNB 4Q7NA 5D8ZA 4IIEA 4KBXA 3TN4A 1O6IA 2O55A 4O57A 4DO4A 3E6EA 1O95A 2VRJA 4HOWA 1KM0A 4C6EA 2W0UA 3N18A 2YB4A 3PTDA 3IUDA 5BOEA 3H22A 1EGVA 3MP5A 3VIFA 3RX2A 3CHEA 1VCVA 4BS0A 2O4QA 3W7EA 2QCCA 1JDFA 2Y4SA 5CLWA 4Y6GA 3CEUA 2H8ZA 2X2YA 1W32A 4LEFA 1DE5A 3VOIA 4KF1A 4LBUA 4I3GA 2WNNA 1DWHM 3N1AA 5MF5A 1CGXA 4MJZA 1I60A 3GY1A 4JIIX 5B7ZA 3THCA 1S5MA 3W2KA 3ENLA 4ACZA 2X0SA 1FWHC 1U5JA 4V1XA 1RUSA 4AY8A 3W85A 4WHBA 4CD8A 4H9XA 3AIRA 4C1NA 1W1PA 3BLFA 3OBKA 2PRLA 1OCNA 1UR1A 4UOZA 3F2DA 1ODZA 3WG6A 4XVEA 2DQXA 3PZNA 1V02E 3R8RA 4GGBA 4GI4A 5G1YA 3RFAA 4QROA 5DT7A 2D69A 1LOSA 3ZWSA 1CXHA 2VQUA 2VL4A 2XVKA 3NIYA 3QW4B 1X8FA 1D7KA 4H9ZA 2J13A 1F73A 4OIFA 3NEHA 3P3BA 3EWDA 1QOQA 3QPEA 3BGGA 4Y8EA 2V4JB 1AZ1A 2J79A 2PDLA 2VC6A 1HL9A 2Y2WA 1HX0A 1TQXA 1MI3A 2H3BA 1XG4A 3VCRA 1IXOA 3WF1A 3ZXWA 3HU7A 5GNZA 2F6KA 4GGHA 1FHUA 4RV8A 2BP1A 1IEQA 2BVDA 3WCZA 1FP9A 2GVJA 3FY1A 1DIKA 5D8WA 4JAWA 5CG0A 4UTLA 2VFDA 3TKFA 3AJ7A 3UU0A 3WKZA 4AOPA 4ZQMA 4PSRA 3O06A 5CZ0A 3A4AA 3GIYA 2OQHA 3N17A 1FDYA 4IIHA 4ALDA 1EJVC 4BJHA 2ESCA 1QI2A 3E96A 3FA5A 3ICJA 4UQBA 3MM6A 3EPOA 3FVMA 3VKPA 1EDGA 2JIEA 3BUVA 1EBHA 1UH4A 2OO6A 3UR2A 1G0CA 2D2GA 3T42A 2QCDA 4B3ZA 1NH6A 4IUOA 1J10A 1PZ0A 3SJ3A 3TOYA 1O5QA 3E38A 2YLAA 3ARTA 2CKSA 1QNPA 3BTNA 4TTGA 1FTXA 1XGEA 2QXWA 2FHFA 5K3VA 2NUYA 3FN9A 1NDZA 1O60A 4GUHA 1OINA 1CGTA 3NZ1A 3ZR6A 1BYCA 3BDKA 3W01A 1J0HA 2DW6A 3FJ4A 4YTQA 3S0CA 4C91A 1EPVA 2ZCGA 4DPQA 3K5XA 3M0VA 4J2PA 2CIPA 3VC6A 1XISA 1O5RA 4XAZA 4HZMA 2Z29A 3BWWA 1JIBA 4W86A 1XLHA 2XSAA 2X1TA 4S39A 4PRWA 4GQBA 1UMLA 3A22A 1RBAA 1H7XA 3BZGA 1U33A 3W7GA 5CKSA 2VC7A 2X1SA 4S23A 2YGYA 2DPEA 1MRQA 4I7UA 2E4TA 1JZ5A 5HAOA 1VRXA 5EYWA 2JGYA 2DORA 3C8FA 4IIFA 1FY6A 2OVLA 3DFTA 3LHWA 3LSCA 2FGLA 4REQB 3H24A 3F4VA 3BPWA 5C0QA 4D71A 3W7LA 1LLZA 1GG0A 3IPWA 5DCDA 1PX4A 3AYTA 1DJWA 4EOUA 1F4HA 3VNDA 3K46A 4UMCA 1LP6A 4IMEA 4RE4A 4LAMA 1LDCA 3QMRA 5HQLA 3UWQA 2BB0A 1DWFM 4ZQPA 3COTA 4PMXA 4EPEC 3VKQA 4GNKB 3PG9A 2VENA 4ML4A 1PZ2A 1W0MA 3THUA 1FUYA 5K4XA 3WLOA 1Z42A 5E70A 2Y5EA 4F8XA 1A0CA 5H1WA 5HXMA 4N7QA 4PBFA 3ES8A 1AH4A 2ACRA 2Z7KA 3MKKA 5EMYA 3P0XA 3T0CA 1QNRA 4QQ3A 1VBGA 2DUAA 1POKA 1D9EA 3SFWA 3T4WA 3V1PA 1DWIM 3B9OA 3I6TA 4UXDA 4AC7C 4RDVA 2XH0A 3W81A 2P0IA 2JKAA 1H60A 3BAXA 1ZB5A 3B05A 3GXFA 4XD4A 4ATDA 3A47A 4PA8A 1DL3A 3W7RA 4ECLA 4JTJA 4O1EA 5CBIA 3AS0A 1HT6A 1E9LA 2PC8A 2ISSA 4UFJA 2V30A 9XIMA 2XJ7A 1J01A 3W25A 4YVVA 1XYBA 2NUWA 1V02A 2E7FA 2TMDA 5CJNA 3WFZA 3W9ZA 2ABAA 4TVUA 1PKLA 4BWLA 2BASA 3B9AA 2I9UA 1TA3B 4KFOA 4B5XA 1FVPA 1PX3A 3KWSA 1CXKA 1WNOA 1CX9A 3UPMA 4ZB5A 3H70A 1RCOB 3G24A 4MGGA 1QASA 1ESWA 5I0DA 3V75A 2ACSA 4AEOA 3OLIA 4JQ1A 1QW7A 5E5CA 4D6JA 2FZBA 3SY5A 1F76A 3NPWA 4FXSA 1SYTA 2PDJA 2V82A 3SADA 1SZEA 3TFXA 4I7WA 3C6CA 3S42A 4GACA 1BG9A 2NZLA 1OEPA 3BLPX 3KRSA 3N6HA 3H23A 2VQTA 3W7MA 2PU1A 4W5UA 2ALRA 4IQJA 1U83A 3PWAA 4UFIA 4O12A 1M7PA 5I6SA 1ICQA 1GORA 3DFSA 3B4UA 1UROA 3QXBA 5FEWA 2WM0A 3RG6A 1KXVA 3K30A 4Y9PA 4FOUA 1UBSA 2E5BA 3HGJA 3MDUA 1JPDX 6REQA 3EWYA 2XG9A 4LF1A 4AIBA 3MKCA 3KAOA 3ONCA 4GRSA 3CLWA 5A6BD 3SCSA 1E71M 3F4WA 3PJUA 4PB4A 3VZZA 4UTTA 3U2EA 1XLJA 1T96A 2X8RA 1C92A 2E6FA 1HKWA 3EEGA 3HFTA 3RPTA 3GIPA 5AHIA 2LLEA 2CW6A 4ORMA 3TN3A 4MJMA 5IRPA 3MBDA 2GOKA 4RDZA 1OFOA 1Q63A 1E4LA 4L7ZA 3KCLA 4M82A 4H6KA 2WBGA 3CYJA 4UOQA 3ZVHB 1TWIA 1KFBA 4JYFA 4TXEA 3CTLA 4ZODA 4MFEA 4TMBA 4NZ5A 3EWBX 4MHBA 2Z2UA 4QGCA 4OQVA 1THFD 2J4GA 4MY8A 2GPTA 4RE3A 1XW8A 3ITYA 4I9JA 4XSMA 3EKGA 1M9HA 4O8AA 3EX4A 1OYBA 7CGTA 3LCIA 2HISA 4IGNA 1WDDA 2NQ5A 3VGBA 4JKMA 1V0LA 3R58A 4AD1A 3GXTA 4KWOA 2PTZA 4O1FA 2E9LA 2ZOXA 4A05A 4DZAA 3HO8A 4QJ1A 2YZ5A 4FHAA 1TMLA 3PTKA 3N9SA 4L4LA 4B5TA 2NUXA 3ITCA 2F2KA 3VIKA 4IJBA 2VRKA 1AODA 2VUNA 2EO7A 4Q7BA 3BLDA 2Q3RA 1V6UA 1JL8A 1TV4A 2PDBA 3RGTA 4GQGA 4NJJA 3F5JA 4RNIA 4L6HA 2C15A 1H11A 3W73A 4HA4A 5CXPA 3PY2A 2D24A 2W4XA 3VO0A 1H63A 3HBLA 3VINA 3U7BA 5FSEC 4NAFA 3BC9A 4IJRA 4GI9A 3ZO9A 3IIVA 3F4DA 3K1GA 3FAXA 7XIMA 1VFFA 3BANA 4DM1A 4HA0A 2WSRA 2UV8G 1Q65A 5EBAA 1A5KC 3PUGA 1ZLPA 3QYSA 2A3EA 1KR1A 3TAKA 3QZEA 4RZBA 1B90A 3GNRA 2GGEA 3VIIA 2ZFAA 4U3CA 1TJ1A 4IP5A 3G77A 1I6NA 2D3NA 3TTEA 3HURA 1WQ5A 5AC8A 2C8NA 4G6CA 4KPLA 1Z9AA 4R3UA 2YA0A 2Z2AA 2NQ9A 1GOMA 2DFAA 4XVDA 3VPLA 2HQAA 5ABFA 4J28A 2R1NA 1DORA 3HFYA 1PL9A 3L65A 1K03A 3NJ3A 3IRSA 3UBPC 1QJWA 3NM3A 5C6MA 1Q2SA 1CT5A 1JUBA 2GUBA 4L4MA 2PPGA 2F7FA 5TF0A 3CUHA 3WBEA 4PRTA 1I8JA 1YXDA 1FRBA 1AL7A 3GM8A 5D2WA 1RP8A 1OFQA 2WQDA 4KESA 3I6RA 4MB5A 3SZ8A 2YCKX 5A8QA 2TAAA 3RHGA 1AJZA 3NZQA 2UY4A 4JY9A 1US0A 4UFLA 1D3HA 1MUMA 2ZC1A 2WQPA 1XDJA 1MXGA 8GEPA 2IS7A 3CQKA 2ATMA 4O1CA 1QWKA 4NZJA 2DZVA 2G3JA 3M5VA 1J79A 1WDWA 1QI4A 4DELA 2ZZ1A 3UFYA 3LHVA 2CYGA 4A3YA 3G1VA 2HBVA 2INEA 5KINA 3LCXA 4GD0A 3MM7A 2DSZA 1W31A 5C9UA 1C8VA 1QT1A 4ONVA 1IV8A 3QVQA 1MFUA 1FWBC 3ATZA 1GWJA 2DT2A 5JXQA 1TG7A 5AZ0A 3VVGA 3QMTA 3CBWA 1B3OA 3G1RA 1GVIA 3F5KA 4J3ZA 2QJIA 3H4WA 3VMOA 1BLIA 4HYWA 5E6YA 2I7GA 4NRSA 1TPVA 2A3CA 3E74A 2FJUB 3MP3A 3ID7A 4IQLA 1KFCA 3O63A 4XTIA 2PLCA 4DLMA 1NF7A 3NQ6A 4CVUA 3TC3A 3MV11 2L5HA 2OXNA 3BQ5A 3UZ5A 1PIFA 4QAIA 2OB3A 4D1IA 4JTTA 4KS0A 1UKOA 4DJEA 1G5AA 3AROA 2A6LA 4B16A 5ABEA 3WMLA 3CS2A 1T0OA 4CUCA 3N15A 4Q22A 4D1JA 1EO5A 3EB3A 2BLEA 3GAYA 2JEPA 2PDIA 4JN6A 2DH2A 4FLRA 4YLWA 4OU1A 3B06A 1GOOA 3T0AA 3ZVIA 3BOXA 3RPMA 4K1WA 1NQKA 1OX5A 4Y2WA 5I3KA 4IFKB 1L8PA 2DZBA 4K39A 2VOMA 4WDTA 1W17A 4GJIA 2TPSA 3BMWA 3VILA 4GUIA 4GIYA 4QNWA 3RRXA 5CC3A 3EGJA 4TX8A 1KKOA 1SVDA 2XYLA 1KBJA 2V6AA 2FTPA 1NF0A 3KZSA 3WK0A 1ZJBA 3LBOA 1J96A 3QR1A 5G1TA 4FXJA 5AHFA 5DRCA 4BKNA 3LG3A 3PZTA 3TC7A 2Y7GA 4AZCA 2H8XA 2BVTA 2GSEA 1K9DA 5CZJA 3H2FA 1UBPC 2PDXA 4QM1A 4G39A 2HJPA 3CIVA 3MMUA 3VI2A 1O1ZA 3OZMA 2YXOA 1EO7A 2EHHA 1QTWA 3NTYA 3OVRA 2XINA 3NXLA 5F4XA 2PDPA 7ENLA 1FQ0A 3CTTA 2V5KA 4KGJA 2WJEA 1G9HA 3WJYA 4N9CA 2PLMA 1XLLA 2C1IA 2ZZ2A 2ZX5A 3RK8A 1RQEA 4FB7A 1YDOA 1HJXA 1VJSA 4JN8A 4M81A 5AY7A 2GJNA 1DHKA 4Q4OA 2PWFA 2ZUMA 3QM3A 3VDBA 3CIWA 4UNIA 4Z2JA 1ZAJA 1M41A 3SN1A 4MIMA 2EPNA 2QIIA 1H41A 3SIZA 1OG0A 1IIGA 1LBMA 2Z1VA 1IT8A 3ARQA 1J18A 1XKYA 3TUUA 1MWOA 3SEPA 1WKEA 1BQCA 1P1XA 4YTUA 2DV0A 2QKFA 3IV3A 3GXNA 1KBIA 4AVFA 4MB1A 2DQWA 3VE7A 3TONA 3DC0A 4QQUA 2ABBA 2O56A 2CZEA 3M7WA 4JYDA 1RQBA 2WBKA 3O8AA 2V0TA 5IDZA 1Y8BA 1FH8A 2WM1A 3W1RA 2PWHA 3SQMA 4KGLA 1PYFA 4V1YA 3W1PA 4L9ZA 4B4HA 1DWGM 2AKJA 2B7NA 1DYSA 3W53A 1S2WA 1MW2A 3TSBA 3NQBA 1F3EA 3Q2DA 3M41A 3HMJG 1E0XA 3IAQA 5I07A 3UPWA 4ASTA 1LZOA 4AHPA 1GPWA 1Q6CA 5AVHA 4GJJA 4HA1A 4CD6A 5ECUA 3S46A 3QSTA 4JGDA 3H2CA 1XFCA 4O54A 4BHYA 4XAFA 1YW1A 2H9AB 5FOOA 1TPC1 1NU5A 3WDPP 3AHTA 3EA3A 3GBEA 3NQEA 3AI0A 4GUJA 3BAWA 4ACZB 2OU4A 2VEMA 4CN1A 2RH9A 2I9EA 1EC8A 2CHRA 3R7MA 2JEQA 3PZVA 1HQTA 3GDMA 2O4MA 1SO5A 1N2VA 4XTDA 1E56A 1J6PA 3E0IA 4M51A 4AU0A 3ANVA 1B4KA 3E12A 5KEZA 1C90A 1FHVA 4AZBA 3QPZA 2OT0A 3UWUA 1B54A 1MSSA 2JFEX 1F07A 1SO3A 2W5FA 2YA1A 1GVYA 3UXKA 1T99A 3S1XA 1H61A 2IPWA 4HN4A 4D6CA 4RZ6A 4K6AA 1TSIA 3OLGA 4MWAC 1GVOA 3O0KA 1TV3A 2NT0A 4IICA 3ZR4A 1FH9A 1M04A 4LAZA 2GDQA 5C9WA 3GIQA 4MZ1A 4C1KA 3CV2A 3I7SA 1GHRA 2PCQA 2OX1A 2OEKA 4IWWA 3W7IA 1DIOA 4RNFA 3S4TA 1C8XA 5DMLA 2ONEA 3KWXA 3DCPA 1R3WA 1V08A 5AYIA 1TWZA 2EQDA 1HJSA 3LCFA 3PJTA 3AMDA 1BWKA 3HG5A 1ZQ5A 2D23A 3GW3A 1XLAA 3WEOA 3FA4A 1SZFA 2VDIA 1EPXA 4LWWA 4DWSB 4QAWA 2J74A 5EMKA 3GYCA 3GDLA 4LVGA 4ATLA 1PYMA 4DM2A 5LNRA 1KRAC 1J2BA 4LAOA 3ARVA 1CTNA 1FCQA 1MNSA 5JQ9A 4R9XA 3SBFA 4A8RA 5FJJA 4US5A 2WV8A 3FCPA 2R9RA 5DXXA 1W3IA 4I8YA 5A1AA 7A3HA 4AIEA 2AAMA 2RAGA 2WJFA 3VZXA 1H5YA 1F2JA 3KDNA 4C7GA 1DVJA 1UWTA 1Q85A 3AIQA 3TQVA 3QFWA 3AICA 5DEZA 3OR2B 1EDTA 3LXBA 3RITA 1NTHA 2DT3A 4H8VA 3BLIA 3DHDA 1W9VA 1ZAHA 2NT1A 4GVIA 2BMBA 3L5MA 4AG0A 3S8HA 2OLHA 2ZYFA 5HNUA 1NARA 1UWIA 1ZUAX 4A6GA 4QBXA 3CU2A 1UKQA 1J0IA 3KDOA 4GISA 4NX0A 3V35A 1ME7A 5CCZA 1VAHA 4O4VA 3ORWA 3TJXA 2NSXA 4DWDA 2BGQA 1QW8A 4FPSA 1XBVA 1A50A 3QLLA 1RA5A 2EPLX 1OF8A 3CQHA 3WQGA 1SR0A 3WNNA 3DIPA 5GJPA 4JFTA 2V3DA 3UWWA 2R14A 1AA1B 2A21A 3Q45A 1MXDA 1KGWA 2ZRWA 5A8PA 3L0KA 3TWAA 4ZVJA 1MQQA 4B3LA 1H7OA 1A5OC 2XWDA 3W2JA 5AOPA 2ON3A 3S2JA 2ZRVA 4GBUA 4GY7A 4YN5A 2V63A 1Q2RA 3EMQA 4NZ1A 3GUWA 2OOFA 3PVFA 3RF9A 3S83A 1TV2A 3RR4A 3CV7A 3U9IA 3HPXA 4GHRA 4Q8OA 3M0JA 2NQZA 3OW1A 1W3KA 1XLBA 1W5PA 1BD0A 2PBOA 3LZ3A 3HGOA 3PPHA 4WVXA 3M0XA 4R9OA 2DGAA 1B9ZA 3JS3A 2OGJA 4UTHA 1OQFA 4QDWA 1JZ4A 2XIJA 3HV8A 1W91A 4AX6A 4Y9OA 1QCWA 3PANA 3AS3A 1P5BA 4TTUA 1C91A 3WEMA 1AJ0A 2HROA 4H6RA 1ZJIA 1VYSX 1CI1A 3NPVA 1IT7A 1R7AA 1JCYA 4PMDA 1DJIA 1S1PA 3MUZ1 4LVAA 3UW6A 1V51A 1VS1A 4Q7IA 1XLFA 3HV9A 5B80A 3RLVA 2DDXA 1P43A 1IYXA 3KBNA 4NAEA 3WDJA 1OG6A 4X0VA 1EWEA 1W1ZA 5FJTA 3SFKA 3QH2A 2DSUA 4JIRA 2GVLA 3L4TA 1BYBA 4ICCX 1EUAA 1XD0A 3SB0A 1JQXA 2H90A 4EIVA 3WL0A 5FEPA 3GNOA 4YHEA 1LTDA 3W22A 2AOPA 4KMQA 5LKYA 1F3XA 3G6MA 1E6SM 4HHHA 3S1UA 4WD0A 3PPFA 4GH3A 1XPGA 2RJHA 2GQ8A 2VZVA 1M65A 4HTBA 1ISVA 3E2RA 2YYTA 4GX9A 5ABTA 1EHNA 1DHPA 4MKNA 1DJZA 1BTMA 4N9BA 2X1RA 3NEVA 4JKLA 3RNDA 3MA8A 1HGWA 1UP0A 2JKEA 3GH5A 4H9TA 2CLPA 1YBQA 3PBYA 3CQJA 1EIXA 4K8HA 4B5VA 2KX9A 2GL5A 4PSPA 3IACA 3DBNA 2QJJA 1K9EA 4L1GA 4HA3A 1VLIA 4LOCA 3BAKA 2OTDA 2NLYA 4KQNA 3H2NA 1IXNA 3LQLA 3WMBA 2PZ0A 4JHZA 3VFLA 3DERA 4WGXA 2Y7EA 4H2CA 4H83A 3PULA 1R2TA 4U31A 2WAGA 4E6MA 4IIBA 3R6IA 3AZTA 3NZRA 1ZCOA 3ARYA 1V0NA 3LHZA 1GTHA 1LL6A 3G8RA 1FKWA 2CLEA 1EX1A 1X6NA 1VRDA 2OQLA 3NYZA 2VFIA 1VP5A 1QNOA 2G96A 1LOQA 2FZDA 5I09A 2J7FA 3GQYA 1N7KA 4QR6A 4R5EA 2DIKA 3WENA 4R7WA 1BVWA 2DJLA 1EA9C 2VD9A 3CB8A 2JF6A 4AEEA 9XIAA 3QC3A 5CPMA 1FWEC 1BWVA 1BVNP 4IPPA 1TJ0A 4QSHA 4HNVA 2XWEA 3KTCA 4O53A 1B1YA 2PFHA 2PTWA 1OD0A 3VOHA 1V3LA 1PVNA 4BF7A 1WOAA 2FDMA 4O15A 4CNPA 3AMCA 4UOJA 1SO4A 2HBXA 5D2VA 4G56A 2GGJA 1Z48A 2QZRA 1FFRA 2ISFA 4L6OA 4DWSD 3E1F1 2E09A 1SZRA 3QV6A 2ZVRA 3LM7A 7REQA 3U4AA 3T7VA 1F3WA 5BWFA 4RL3A 3WDQA 1TELA 4DF2A 1S2VA 1KW1A 5DLCA 1T8XA 5A6AA 3IAPA 5DBUA 3VMPA 2PDKA 3D0CA 3R0UA 4C6QA 3A4JA 4GNVA 4X60A 4AIUA 1D7FA 3VU2A 2PGFA 3W82A 1EJSC 1EH9A 1RZMA 3LV5A 1TV7A 2QJNA 3PBGA 5AHNA 4ZSTA 4CQ9A 2W6RA 2OSYA 5AYYA 3B0GA 1X6UA 4Z17A 2YDAA 4OHQA 1TREA 1NDVA 3WJWA 1EOMA 4GYFA 1DWAM 3E2QA 3RMEA 3KVMA 4UZSA 4P7QA 5FEZA 5C54A 1C9WA 1EP1A 1TPDA 1P0DA 5D9PA 2OWXA 4UTUA 3WH8A 1UJQA 1PZ3A 1VFOA 2W62A 1P4CA 3LHYA 3AWOA 1CGWA 4J35A 1ENUA 5REQA 3SCNA 1JCTA 3NQ8A 4JPGA 4MAVA 3EWZA 1GEHA 1XUZA 3ITOA 1QNVA 2E6AA 4ROQA 1EEPA 3RIKA 2QV5A 1VYPX 3N2MA 1G4EA 4B9ZA 4A3UA 2PODA 3N3MA 4HNOA 3M5ZA 1XF0A 3CJPA 1LCOA 4K36A 1R7OA 3RLGA 4YWSA 1DQXA 4OE7A 4LRSA 4I90A 3GVRA 2GVGA 4IL2A 5BU9A 1VEMA 3QYQA 3NA8A 5ECVA 3G22A 1GJPA 1OADA 5EMUA 3UZXA 5D2XA 3GSMA 3PHAA 5F2LA 1ZNNA 3MI2A 4PC8A 3SRKA 1PWLA 2PUZA 3ZJ8A 1XCFA 4LALA 4PB3A 1X98A 1J93A 1M53A 3MMAA 1F8MA 1WDQA 4NUWA 4XZLX 3SN4A 4JTQA 5CGQA 1E9IA 4ZBCA 3WQDA 3T2OA 3EKLA 4M56A 2QUTA 2V38A 1FCBA 5A94A 1F05A 2OOGA 1MVYA 3MC5A 3WLQA 3KL3A 3GDRA 1H1YA 4PUJA 3LMZA 3WD1A 1UJPA 3W23A 3JZEA 1W2VA 1GT8A 4FK9A 3PG8A 3V36A 5AC7A 1KLZA 3M6YA 2VC9A 1Q6EA 1GOKA 3O05A 2BOEX 2VI0A 2VEFA 1EP2A 4IP7A 4WGHA 5EFDA 2B7QA 1YDYA 3FAWA 1EB3A 2XIBA 2BFGA 1RJQA 1R9YA 5DANA 1R46A 3NVTA 1UD8A 1I2QA 2J77A 3MM9B 1MUWA 3CZEA 4ZE5A 1QWGA 3CHDA 4CEUC 4LUSB 4AUBA 3F7JA 1R2RA 1XRVA 1GZGA 3W00A 1ME9A 4ZR8A 5C9ZA 3UPBA 3W1UA 4TX6A 2YCEA 5C2CA 3KBSA 4C1LA 2GUYA 1W3LA 2GDUA 3T0BA 1ELSA 2ZWYA 3SAZA 4UTJA 1K6AA 3SRFA 3DHPA 2QUUA 3FKKA 3MJMA 1B30A 4TMCA 1QHOA 4P2VA 3MM5B 2VDGA 5AYZA 5HJXA 3WLKX 2DVTA 3LCGA 4YPJA 1B3VA 5DBTA 3OYXA 3UF9A 4OUEA 2FVMA 4LV4A 2WC3A 4QTGA 1E15A 2ZRUA 3DBPA 4L61A 3TH6A 5HPCA 2BZNA 1XP3A 1XKJA 1O5KA 3CZLA 1EEXA 2NV2A 4S38A 3S47A 4F2TA 4BK9A 1H09A 2WWCA 2OLSA 2P3EA 3A4WA 3MI6A 4O18A 2ICSA 4QE1A 1XV8A 4RXFA 2Z4GA 3W7HA 4XAGA 1KCLA 1RSCA 1EUNA 4PTVA 3IJ6A 4EX4A 4R85A 1AW5A 3OEXA 3CV6A 3HJEA 4H19A 4FNUA 4IPJA 1BG4A 2G3MA 4LUJA 3IK4A 3NQMA 4QEEA 1OFEA 2E5CA 4JIPA 3GKAA 4C6KA 2JALA 3KL0A 3LB0A 2CERA 4WZHA 5D2TA 3TFCA 2XDFA 4CNNA 1DKWA 4TOQA 1PPIA 4AHQA 2D2OA 1H1NA 3WLJA 2XIQA 3PZUA 4G2DA 3N4FA 2PDHA 1GNXA 4ZGYA 4NJHA 5FF4A 1UIPA 3DYOA 3LSBA 5I3DA 1JXJA 4FR1A 1E4NA 3BCDA 1PXGA 3NDZA 4HGXA 3CZ8A 1RPKA 2ISVA 3BH4A 5T91A 1AMYA 3IUIA 4FZIA 1FWAC 2GJPA 3RLUA 4QJ5B 1XDMA 1A5BA 3B0NA 1OFAA 2GGIA 4AWTA 1CGUA 4EKJA 4INFA 4GY1A 2C91A 2OELA 2FFIA 4F79A 4PUEA 5CG7A 1UG6A 1AH3A 5EMJA 3LZ5A 8RUCA 3C2YA 1X6LA 3N3TA 2E6YA 3ELFA 3PZOA 1W54A 1H62A 1P6WA 3W07A 3QV7A 2OG9A 4LCQA 3R12A 3WNMA 1CENA 3VZYA 2CBIA 4AD0A 5JBEA 2FJKA 3A24A 3AIEA 1PJ9A 1IGWA 3HGSA 4AYGA 3GHTA 3BW2A 1F5ZA 4MDOA 2VGFA 1J0ZA 1JEZA 3RCNA 1RBLA 1YPFA 4WKFA 3LRMA 3R13A 4LNCA 3TQKA 3IVTA 4WK9A 3C2OA 1G4PA 1ZFJA 4XO6A 2J7GA 2GSHA 4M6VA 1CGYA 1CXFA 3MY9A 3WH6A 3GYEA 3B0HA 3GVQA 3FEQA 4QCEA 5U7SA 4H3DA 3W38A 1PTDA 2E25A 1RLDA 1FWCC 4H9MA 1MO0A 1CEOA 1TZZA 5DF0A 2A7PA 3WSUA 4CNTA 1IZKA 2AAAA 4PMZA 5HNRA 4G7EA 4Z1CA 3AOPA 2GSJA 2ASHA 1V79A 3ABSA 3AHZA 2WPGA 2WMFA 3FYPA 2D0HA 3C0QA 3MU7A 1GYLA 1TE1A 1W1YA 4MWAA 4F4RA 3AXIA 3ARRA 4GUGA 3WK3A 5A8MA 5F2IA 4KCWA 4WSJA 3GVWA 3LXAA 4AH7A 2ZZ5A 2X0HA 2VGGA 1Z41A 4IMFA 5D37A 3F4CA 3TA6A 4F40A 5KZEA 4AW7A 4MY1A 1B3WA 4R53A 3LOTA 2FZ9A 1AK5A 1R3VA 1KFKA 1LL4A 4IGHA 4MM1A 1QPRA 3OR1A 3DXIA 2YCLA 3NAVA 2DSVA 2Q02A 3FJNA 3GDBA 4R27A 3TIMA 5CGMA 2OMAA 1F6YA 3F03K 4XKMA 1JPKA 3HMCA 3T0TA 4HHPA 5LXEA 1Q3NA 1B0IA 2B0MA 1KWGA 1AOPA 1ZRQA 1EFZA 1DJGA 1M7XA 2ZTJA 2VHLA 5HWJA 4CNSA 2PSNA 2V8ZA 2FQIA 1O1HA 5DCBA 3TVAA 4MG4A 5CC5A 5FJOA 2O7QA 3BG5A 2UY3A 5BXRA 1Q8JA 1LF1A 3Q37A 2R6OA 3ISIX 1L6YA 2OLAA 4HB7A 4L1XA 3TDFA 4AVNA 3WDIA 4A3QA 2QR6A 1AFSA 1GYMA 5KZDA 1XH0A 1NOFA 3ZFHA 1YDVA 3O6DA 3UXAA 4DPPA 1IZJA 3P74A 4GC4A 3N6JA 3SW6A 2AKMA 1V8EA 5EL1A 3URBA 2R1LA 2PP3A 4KWSA 1IEXA 3MMBA 2GWGA 3IVSA 3IV8A 3UA4A 3CLMA 3ALGA 4AFYA 3NPUA 4D6HA 4DJED 2QYGA 3STGA 4PUUA 1NWTA 2J8FA 3FW6A 5FSDC 3CMFA 1HL2A 2RDWA 2XM1A 3SQSA 4XB3A 2VCBA 3CASA 3RUBL 3OHMB 1JUKA 2ZZ7A 1EA0A 4PCSA 1SFJA 1C7SA 1V6XA 1MQPA 5BROA 1Q6QA 1EZWA 2ADAA 2QCMA 4PMNA 2E1DA 2Z1BA 4UQCA 4WY0A 3KBJA 2P8BA 1WXYA 3S5OA 1LUCA 3HTWA 1K02A 1FH7A 5C9RA 1P0BA 3R94A 2FH8A 3W74A 1LORA 1RA0A 4IIDA 1VH7A 3WQ4A 4LU0A 1GPFA 1KRCC 2J24A 3B8TA 1TUXA 3FGCA 3MUXA 4H7ZA 3MB9A 3AHYA 3VLYA 1FDJA 4NKCA 1EBGA 5EBUA 5DRIA 2BGNE 4J3SA 3FDGA 3OO2A 3RJXA 4DRSA 3TTYA 3A5VA 4IMAA 1J2WA 1LJYA 4FXRA 2G4FA 2WW5A 1QRQA 3W7JA 4QITA 4EVZA 5TBOA 1ONWA 3M0MA 3SCPA 1WZMA 1TE6A 5M03A 2NLIA 4P5UA 3WNKA 1A49A 1RHCA 3R8GA 3IIPA 1UQYA 4ICMA 1XGZA 3OG2A 1ZSXA 1T5AA 3LNMA 3QY7A 4MADA 4QISA 1OX4B 5LNUA 1TMQA 3CAKA 3W6LA 5ABHA 1WKDA 2ZBTA 4GBDA 4S2BA 3BZJA 4GQ0A 1K6WA 4ROPA 3SM0A 2VDHA 4O16A 3KTSA 2BGSA 5IHRA 3KBMA 4DLFA 4U2YA 4DF1A 3HPZA 2CKRA 4KKXA 3ANYA 3ARWA 2XH7A 2WVSA 4RDWA 2OO0A 4LS2A 1XBYA 2GVYA 4E2VA 4LB3A 1HKKA 4I5RA 4QX4A 4B2DA 3T81A 3RM9A 3IGSA 3IIOA 1JUEA 1F9CA 5BU6A 2XGZA 3GNPA 4KIEA 3LTSA 4S3AA 4XUGA 2B81A 4BQ3A 5AZ1A 2XSJB 3ABOA 1BKHA 2BSLA 1RVKA 4L6DA 2G5WA 2Y62A 4AF0A 3MM8A 1LQ0A 5U4NA 3N2TA 3MCMA 4LF2A 2SFPA 1XLEA 8A3HA 3M0LA 2HPIA 1SZGA 5EKYA 5C7VA 2C0AA 2NV1A 5DN1A 2XVNA 1R3QA 3DFNA 3DZ1A 2HNHA 2KZHA 4FX8A 4CQ8A 3I7QA 3KM8A 2ZA3A 4A2RA 2YDSA 4HPXA 1UYQA 2DZUA 4FNRA 1JPMA 4IUGA 2DEPA 2VURA 1KO0A 2H6RA 2XFWA 1SJAA 2QCLA 3QY6A 3AISA 2POZA 1XSKA 1RQHA 4IISA 5FF3A 3M0HA 4YJ5A 4LBRA 3VIOA 3ZWTA 2EXOA 1UW9A 1JZ2A 2QPUA 1O94A 5E6ZA 4LC6A 2AKZA 3PBUA 3QW3A 4QP0A 4JL2A 1J8VA 2VYOA 3EWXA 2DZTA 4OECA 4UTTC 2PP1A 4YS1A 5I3JA 5CH9A 1NM9A 3HGRA 3VM1A 1QFEA 3GRIA 4PUNA 4XIMA 2IKHA 1YTKA 4PTXA 1IWAA 2C19A 2XVGA 1EYEA 1VCFA 3R25A 3USZA 1G69A 1NOWA 2V2DA 1KCZA 2C16A 4J1OA 2QF7A 3TYCA 4OV4A 3PFRA 3TE9A 3M16A 4O8RA 4EAMA 3VDAA 3N12A 3GUGA 5HA7A 3TJ4A 4GLEA 1K8YA 1DP0A 3HG2A 2BY2A 3W76A 4N6EA 5LHEA 5L6UA 4O1DA 3PZIA 4YWIA 1LRQA 1V3MA 3SRDA 5T26A 2XIIA 3P67A 4FLSA 3C5QA 3S2NA 3VIJA 1W5MA 2V3FA 4P7RA 4PODA 2NWRA 3B0JA 4E5TA 7REQB 1W37A 2AGTA 4WDWA 1W3HA 4TVDA 2PWEA 1H49A 3LPOA 4US5D 3SIMA 3RYSA 1V93A 5G2WA 2VFHA 5A8OA 2Y8VA 4HNUA 1AMKA 3HQNA 3QHMA 3RU6A 4YU1A 1JNDA 4NIRA 4KWUA 4R7JA 4K68A 1B57A 2QVHA 3WJSA 3AQUA 2PWUA 3QQ0A 2XZ7A 4LFYA 2ISDA 4S3FA 4Q8QA 3NQAA 3QOKA 3E5BA 3H4XA 4B91A 1DXEA 4MZYA 4IFOA 3MSGA 1XM3A 4M80A 3CUXA 5E0FA 2V5BA 5LNVA 4S3CA 1X1ZA 4CCCA 1ECEA 3RR1A 3W1MA 3CUFA 2HMCA 3TSDA 2R1PA 2ZUSA 1MMFA 3WH5A 1EOKA 5G2IA 3R2GA 4ZB0A 5J04A 2FZMA 3KTXA 4L80A 3AIUA 1E6NA 3PB2A 5BMWA 2DH3A 3BOFA 1C29A 4G1NA 6PTDA 1QU4A 4ZQNA 5A69A 4C5YA 1JPHA 3N04A 4DJFC 4JIHA 1K4GA 5DY2A 4KRUA 1XC4A 4UQDA 1LYXA 2V2HA 2EF9A 4YHGA 2DZPA 2WB5A 4WJXA 1IZCA 4QNEA 4B5UA 3GKFA 4AIOA 3CL8A 6ALDA 3VIHA 4CCZA 2ZIDA 3B9NA 4E8CA 4CQCA 1CLXA 1YEYA 4XBKA 4PFHA 2D0FA 1YDNA 1UD2A 4GINA 3VM5A 4J5NA 4PMVA 1VFSA 1OSEA 2DSKA 4JQ3A 3M47A 1F3TA 3L9CA 5GNYA 5A8NA 2Z25A 1KBKA 3KX6A 4YXGA 3OA3A 1JZ6A 3R5EA 4RKAA 3GWQA 5EGRA 3RU8X 2ZXQA 3E0LA 4US6A 4D8LA 2F8QA 4WDXA 4C7FA 4E38A 1FWSA 3B8UA 4OBRA 2I14A 1KFJA 3DYMA 1BGAA 2BODX 3MMCA 4NJIA 3MUIA 2BXYA 3R43A 2HDJA 4D8AA 2OZ3A 3GZAA 2E1WA 4GE8A 1PB0A 3DX5A 2RDTA 4Q8UA 1O4UA 1A3WA 1KFLA 4WLCA 4KIRA 3PBVA 2XN1A 3W6MA 5LIWX 1G7UA 1A5UA 1JDCA 4FS9A 2D0GA 3JZUA 3TU9A 4Z1YA 2MUCA 2PDYA 2V67A 3WLTA 3A9IA 4S2CA 1XQKA 4L1WA 5BOFA 1W8GA 4I6KA 2VO5A 2R8WA 4BQ4A 1HP4A 1HVXA 4JX5A 3SI9A 3SECA 3UZWA 2XUCA 4MOZA 3O0FA 3OOQA 1L8NA 5HMSA 4FEZA 4H9VA 1PSCA 1XFBA 1L6SA 2P88A 3CQIA 3SCOA 2WVUA 1JFXA 1AZ2A 1KCXA 2WSPA 4IG2B 1WBHA 3BLLA 1LT7A 4AD4A 1CBGA 2GJLA 3LI1A 3WMSA 1YE6A 4IPIA 4RR4A 3BLEA 4GA8A 4F3HA 1ICSA 4C6PA 4JXCA 3H12A 4RE2A 2XHYA 4PFMA 1U1JA 4MLJA 4DYKA 3DFHA 1TZ7A 4JFWA 3I4EA 3FIGA 1H7PA 2ISWA 1E0VA 1WZKA 4E3TA 3AMGA 3CZJA 3VLXA 2JGQA 1XIJA 1WOBA 4FLOA 3TEVA 5JU6A 2A3BA 2W66A 2C18A 4LXFA 1EJRC 5LXXA 1YXYA 4M0XA 2O9PA 2NVAA 3GXPA 5EA9A 1QXLA 4RK8A 4EXAA 1BHGA 1TX2A 3V5FA 1ZBWA 1UWRA 3W71A 3WUGA 1EYWA 5M3WA 3GHUA 1Q7QA 2IPFA 2CU0A 4ADSA 2PRHA 4DZIA 2QIWA 1EDQA 2FDSA 1BF2A 3G0XA 2ZA1A 2Y63A 3ALFA 3O6CA 2P1FA 2Z6JA 1FDZA 3TK7A 4IPLA 1IF2A 4U10A 4Y96A 3T40A 2J9YA 4KETA 2VXNA 3GBDA 4UNKA 4QHRA 2VOTA 1W6TA 1JF5A 3KVKA 3M6DA 4ILSA 3L2MA 1UR2A 3LQGA 3R0DA 3SJNA 3KP1A 2VRQA 5BOOA 3LHUA 4ZXOA 3AFBA 3MMWA 4LQ1A 1R38A 2QGHA 1U1HA 5J5RA 1HO4A 1E1CB 3UWZA 1T40A 4K3ZA 1GK8A 3PNUA 4MLRA 1TR9A 1H7NA 4YYFA 1ZJ9A 1HKJA 3L5AA 4RW3A 5CGTA 4ZO9A 3T0DA 4D72A 5MHBA 3QQWA 3ZIZA 3SUWA 1W9PA 4GWEA 1Q7MA 1AW2A 1KTCA 4M1RA 3UETA 1HVQA 3G1FA 1TRDA 3GZ3A 4LT9A 3UVIA 3VNIA 1XIFA 2C0HA 5A6KA 2IXUA 5HUPA 3LDVA 5D32A 3W29A 3NSNA 1XIMA 3CAVA 3LEPA 5LIKX 1VIZA 1LOLA 1BYDA 2YLLA 1XGDA 4CVWA 3JUGA 2EPOA 4OGZA 2E40A 4NZ4A 5I3HA 2JE8A 4ZL1A 2Q8XA 1IXPA 3CPUA 4FIQA 4WUIA 2FHCA 1XIHA 3RCMA 2PWGA 1WKFA 4OZOA 3UT0A 1Y7VA 3TX9A 1ZP3A 3ABXA 2FPVA 2XPKA 1V3HA 3BL3A 1E9YB 4JTDA 1R5YA 1I2PA 1PDZA 3V0TA 4IP4A 1VIWA 3TYEA 4QDPA 3WFAA 3LM3A 4NYUA 2E9BA 2QCGA 3CXOA 3BLOA 2XISA 3ABQA 3GXMA 1OT2A 2D73A 1J9YA 3BO9A 4Q6XA 1XL9A 1RV8A 1SPQA 3WBXA 3CEPA 4M7SA 5KTLA 3JR2A 3OIHA 3BJTA 1MNZA 4XBSA 4F0LA 3C2RA 7ODCA 4H9UA 3AMLA 3LTPA 4Z2IA 1VBRA 3T09A 1D8CA 2E9MA 2P76A 5LIXX 3OPSA 4V33A 1XLGA 2YIHA 1ITXA 1NP2A 1XG3A 1DJHA 1GQKA 4Z2LA 4AX7A 4YYCA 4JTFA 3OODA 1MQRA 4G9PA 3FOKA 4WKHA 4B5SA 2FTWA 3C3UA 4EXQA 3C8NA 3S5SA 3BW3A 3Q4DA 3L0GA 1FP8A 2FGZA 1SFTA 1V4YA 4J7RA 3O15A 4UTWC 3WN6A 3W0KA 2FZ8A 1OABA 3MI3A 4PMOA 3G3DA 1V3IA 5AKQA 3KZPA 3LUTA 4IM4A 2IXVA 3TQ0A 3CV1A 3PN8A 4MNMA 1GYNA 2V5DA 2FH6A 3MHUA 1KWKA 2PEVA 1QDSA 3BAJA 3E0VA 3L4ZA 3E0WA 3MWAA 4HPHA 2V81A 4XZWA 4NT0A 5LIYX 5L9FA 4C90A 2WHMA 3L12A 1M68A 3AHXA 1MZRA 4NJKA 3M46A 1W3TA 3BV7A 1KV8A 3W28A 1C3FA 2HCVA 3HF3A 3VNMA 4FNPA 2DT1A 3E3HA 2ZX9A 4NL1A 4Q4QA 5C71A 1RXOB 4R33A 3IUHA 1UMYA 4PMUA 4N42A 4OKDA 2ZRXA 3KFTA 5F1UA 1MDLA 2BXVA 1BRLB 1YYAA 4PCFA 1OYAA 3FHQA 3T2QA 5ABGA 3VC5A 1U1UA 3QV8A 4MSSA 3EOOA 3WLPA 3E02A 1SU5A 4XZBA 1LT8A 4YTSA 4CQDA 2NVCA 4LUIA 3S6OA 3NG3A 1VEOA 3NQVA 1NQ6A 3BCJA 2QLYA 4EACA 2Z1XA 2HEJA 2V5JA 4CU7A 5FIPA 3MO4A 1RY8A 4WF7A 1TJRA 3RCYA 3V4BA 5I03A 5BZAA 3V18A 1UC4A 2ZRYA 4ZOAA 3UZYA 2GJXB 2XH2A 1EKOA 3PPGA 2PB1A 1A5SA 6TAAA 1DOSA 4WOZA 5IBXC 2X16A 4MVAA 3H2OA 3N4AA 5LGXA 1EF2A 2W79A 4IL0A 3D6NA 2Q8LA 3MYPA 1AQHA 1UD6A 1VLWA 3KLLA 3BSGA 1C9DA 2V4JA 1GONA 1HZYA 1I9CB 4D2JA 5EMLA 1R3TA 1PV8A 2E3ZA 4WY0B 4RUBA 4AWSA 3LK6A 3ABRA 3ZJ7A 5DXYA 2X40A 1DTUA 1EL3A 1B5TA 1AQFA 2ACUA 4E4PA 3EWCA 3WO8A 4LH8A 5D2YA 1CDGA 1KFEA 1Y5WA 1JAKA 3MZNA 1VF8A 1QBBA 1EC7A 3UG4A 2FIQA 2Q09A 2G37A 1E5JA 5HJLA 4LS0A 1D3CA 4QG8A 5HATA 3NL5A 1TPUA 4HCHA 3GDTA 4HU4A 4W8BA 3TW7A 4O50A 3SSJA 2ZUWA 1UB3A 4Z2KA 1W1A1 2CBVA 4OV9A 4K8EA 2NX9A 3MQTA 4DWSC 5CSRA 4DJDD 2HPMA 2EKCA 5CPLA 2NV9A 2CZFA 1OD8A 3AXMA 2INFA 2Y0FA 1JYNA 1YADA 1SSGA 1YX1A 2WMGA 4WRHA 4F0HA 1GQIA 8XIMA 4X63A 2XFFA 3NGJA 1WZAA 1PCKA 1UASA 2CEQA 3EKZA 1YNQA 1SJCA 4JYEA 1A5AA 3THQA 5CPOA 3IGUA 4E4UA 1VQTA 4DBEA 5GNXA 3JRKA 2W63A 1H7RA 3ITGA 2OYMA 2ZICA 3EEZA 1Z3NA 5G4EA 3V0SA 4GCAA 5I79A 5FI8A 3KP0A 3DI1A 2OKTA 4FAMA 4LYRA 4F9DA 2X30A 1X8CA 3GTFA 1OT1A 2YKKA 4QXIA 2JK2A 4NASA 3B0VC 3LPPA 4O0ZA 3SUVA 2W67A 1XIDA 3W86A 3MO7A 4NHVA 2FMOA 2A5HA 1F6KA 2C6QA 1RCQA 3FVDA 3FX4A 3GW0A 3L2IA 3PP7A 4NVTA 5K4ZA 4REQA 3UJFA 4HOZA 4M1BA 5J8LA 3MM8B 2AL2A 3RILA 1S3TC 3L4XA 2WANA 3PZ9A 3FS2A 2F9RA 1OGSA 2WKGA 2C14A 3WX7A 1KBLA 1GVSA 5LHFA 4JCMA 3ARPA 5JIPA 4DI8A 2QDGA 1AG1O 4XKYB 1N8IA 3AJXA 5IDIA 3BCFA 4Q4MA 3MCNA 4PCTA 3CHVA 3TMLA 4H01A 4C6OA 2PCEA 4MMWA 3S2LA 4LGXA 2ODOA 3P80A 4W8LA 4L65A 3KVJA 1NOUA 2NXHA 4F0SA 2OYKA 4DYJA 4A2SA 2XGIA 1N8FA 3MV01 1AVAA 4MJ2A 1TTJA 4XO7A 3AUOA 2J7CA 3AIWA 4I8DA 1JGIA 2BX7A 3U4FA 4X2RA 2OFJA 3W6YA 4R34A 3EDKA 3MVTA 5IFPA 5B7YA 4N4PA 2INZA 3TTQA 3SN0A 4RCXA 1XYAA 4PUMA 2BVWA 3M0IA 4Q3MA 3E2SA 4EWND 2NVDA 3AIBA 3L23A 3W2NA 3B0UX 1JFHA 1XS2A 2XIOA 2FZNA 2DY3A 2VZOA 1PZ1A 1HFBA 1K7FA 5DX7A 3REQB 1CECA 1PBGA 1UPMB 1YHTA 2CBJA 3QEZA 3U6WA 1FHLA 2WYSA 3UR7A 3P62A 4M6UA 1JDEA 1JJKA 3U48A 1E3ZA 4GUFA 4ZENA 1UD5A 1K8ZA 3L21A 1F61A 3PJXA 1QHPA 1TA3A 1NWUA 3GS6A 4CKQA 3URAA 4LV9A 2C3ZA 2PDWA 4B92A 1JNEA 2DW7A 4PRRA 1U22A 4O17A 1SZNA 5A8GA 3HPFA 1E6PA 4CU8A 4UMAA 9RUBA 4HPGA 2PBGA 4L4PA 4GO8A 2D3LA 5AFDA 3RDKA 2VZSA 1UKSA 3BV4A 3QR0A 1YNPA 4DVOA 3DECA 2F84A 1AH0A 4OJYA 1G01A 4LNYA 4Q33A 4LRTA 4CNOA 2G41A 3O3RA 4XX6A 4CCEA 3T8QA 4KFPA 2F6UA 1E40A 4D6FA 1QNQA 4O19A 2A3HA 3AS1A 3I6EA 3OLDA 2QV4A 4C6NA 5G1MA 4NI3A 1EJWC 1UR8A 1XYCA 2AL1A 5BRQA 1XIBA 2Y88A 4JEJA 1QO5A 5I77A 3VE9A 3NNTA 1TUFA 3VNYA 4NJGA 2QVNA 4LYKA 4C65A 4ZE4A 3GVVA 9CGTA 2J9ZA 3ZT7A 2OR2A 2QAPA 4Y9NA 4HMDA 4OBTA 1XRFA 3S5NA 4DJFA 2YL5A 3U5YA 2NSOA 1X38A 4UCFA 4L56A 1XINA 3AU6A 3U3HA 3RO8A 3E0FA 4UC5A 2VGIA 3NZPA 2CBUA 3A13A 4QCFA 4W7VA 4YCOA 1TFVA 4ZXLA 3SSZA 3W7QA 1R9ZA 4IFRA 1GEQA 1FXPA 2PURA 1BWLA 5K2ZA 1DTNA 2E6DA 2QULA 2OZ8A 3ZVHA 2IKGA 1V6WA 5EMMA 2A3AA 2J6VA 5H91A 4TU1A 1W1IE 3DFYA 1NIUA 4H00A 1L2QA 3R89A 1RVGA 2VEKA 4PMYA 2C1HA 1TV8A 1GVFA 3VKJA 3GE7A 2D1ZA 3NPXA 1SW0A 1Q13A 1IEVA 4J3XA 1EX5A 3F2CA 2QUMA 3EOEA 4M19A 4DXKA 4JX6A 2YOCA 4C6BA 4XZIA 4HVXA 1TPFA 1ML1A 2E0PA 3VD4A 2A7NA 1WB0A 4HOXA 3WD2A 4JKKA 4UFKA 3UG8A 4OVXA 4LBSA 2REQB 3MVIA 4HNLA 2PGEA 4KEUA 2VP8A 3UESA 3RX4A 4PTMA 6CGTA 3G18A 1JF6A 3BG9A 1ZPTA 4LCRA 2DU2A 6ENLA 2VX4A 3PWGA 4IXHA 2ZRZA 4HQVA 1DEDA 1M7OA 1HUVA 4GJ1A 2X1UA 4HYRA 5MKGB 3INPA 2A2IA 3M07A 1T7LA 4NQ1A 1IHIA 2RKXA 1P7TB 1GKPA 4H9YA 5DY3A 2TSYA 1BAGA 5KZ6A 5I7GA 1JGMA 2Q8ZA 1VCGA 1KRMA 1BPLB 3GU2A 4MB3A 1ISYA 1JPIA 3PTQA 3E5PA 1J4EA 4UNLA 1W1VA 2Z2BA 4IMCA 4LPCA 3CQ0A 3EB2A 3N34A 5CSYA 2ZXDA 3WBAA 2ZKMX 2RJGA 4NI8A 3MW7A 4CLMA 4AZ6A 5C2XA 4C7DA 3BMVA 4FF5A 2PDCA 2YCJA 5E0KA 3IRDA 4LYQA 4B2DD 1C8QA 2PTYA 4E0CA 1V77A 1S2AA 4Y7EA 5CLTA 4WKAA 3UQNA 1K7EA 3BK0A 4Q8MA 1O5XA 4J2MA 3GNXA 3ME3A 3DHUA 1IEWA 4N0RA 2R94A 2E77A 3R4IA 2Q71A 3W24A 3UG3A 4OOUA 7PTDA 2PD5A 2BS9A 2OPJA 1XYZA 2WVVA 4RZ4A 4YNGA 3QSRA 3G5EA 3GXDA 1YLVA 1VGAA 1UUOA 1QPQA 4A4AA 1OCBA 3DYPA 4QRNA 4K7VA 4FP1A 3CO4A 4YTRA