4S39A

Ispg in complex with hmbpp
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
401
structure length
400
Chain Sequence
b'MRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 140
structure length 400
sequence length 401
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s39A01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s39A02
4DJFC 1Q85A 4DJFD 1TX2A 1TWWA 1AJ2A 2VEGA 4DJEA 3VKTA 4S3DA 4G38A 2AOPA 3MMCA 2OGYA 2YCLA 3MM8B 3MCMA 5GEPA 1EYEA 2YCIX 3V5OA 3B0GA 4D8ZA 3VM0A 8GEPA 3H2AA 4O0QA 4GEPA 1Q8JA 2DQWA 4NIRA 3BOFA 3H26A 3TYUA 2DZAA 2Y5SA 4HTRA 4NL1A 4D9PA 4S3EA 2XSJB 2Y5JA 4S3FA 3MMCB 1Q7QA 2YCLB 1ZJ9A 4DAFA 3MM9A 3TYDA 4DAIA 3MM6B 3B0HA 4DJEC 4DJED 3B0JA 1TWSA 2BMBA 2E7FA 4MWAE 2DZBA 4MWAA 4HB7A 3TR9A 4MWAC 3H2EA 4MWAD 3H24A 1F6YA 3OR2B 4S3AA 2YCJA 7GEPA 6GEPA 2AKJA 4C1NA 3OR1A 3MM9B 2V4JA 3NOYA 1AD4A 3TZNA 2Y0FA 3MCNA 4MWAB 3H21A 3TYCA 3MM5A 3BOLA 2H9AA 4S23A 3H22A 3TYBA 3VKSA 4S39A 3MMAA 1Q8AA 4C1NB 4CCZA 3OR1B 4S3BA 4NILA 2V4JB 3MMBA 3TYEA 3B0NA 3TYZA 3VLYA 2YCKX 1AD1A 4D8AA 2VP8A 3B0LA 3K13A 1AOPA 3MM5B 4O1EA 3VKPA 3H2CA 4NHVA 5AOPA 4S3CA 4O1FA 3VM1A 3VLXA 4DJDA 3MMAB 3H2NA 1AJ0A 4PZVA 4DJDC 1AJZA 1Q7MA 4DJDD 1ZJ8A 3H2OA 2XSJA 3MM7A 1TX0A 3AOPA 3MMBB 3TZFA 3GEOA 3TYAA 4AOPA 1Q7ZA 3B0MA 4DB7A 3VKQA 3H2FA 4G39A 3VKRA 4S38A 5JQ9A 3MM6A 3VLZA 3H23A 2VEFA 4G9PA 3MM8A 1TWZA 3MM7B 3MCOA 2H9AB 3H2MA 3OR2A 4DJFA 2GEPA
chains in the Genus database with same CATH superfamily
4CQCA 3GG1A 4X9SA 2XJ7A 1E6PA 3QZ6A 2FGBA 3B9AA 4LVFA 1ISYA 2WMHA 4Q6JA 3E0LA 5HK4A 2FZBA 1QNQA 2V82A 1TZZA 3SJNA 1JPHA 4H6QA 3CUFA 3DX5A 3HPXA 3CS2A 1DIOA 3WD1A 4OIFA 1IZKA 2DIKA 3UG4A 3U5YA 3ZSSA 4DJEC 4MWAE 2ZE0A 5A1AA 4A6GA 4LEFA 1R86A 3JW7A 4UQCA 2OWXA 1J8VA 4R5EA 2CLEA 3R5EA 1E55A 1LRTA 5AHFA 4ZO8A 1W3TA 4O52A 1TJ2A 1A5SA 1Z89A 2WZHA 4M29A 4OHQA 3B0XA 1SVDA 4S3BA 2O7QA 5HWNA 2RUSA 3CO4A 2CYGA 2CW6A 4DEFA 5A8PA 2G96A 3RUBL 3GG8A 2EG7A 4JQAA 3ABRA 3W74A 2PDBA 3G1HA 2W4XA 2XYLA 4ZQMA 8TIMA 2FYMA 1OX5A 3CZLA 1PXGA 3W82A 3TWAA 2Z2UA 2P53A 2AMGA 2Q01A 1F07A 1LBFA 2C19A 2VFFA 4DUOA 4R3UA 3CAQA 1B54A 1TWZA 3DHPA 1FRBA 1FWCC 3OR2A 3DGBA 3KRZA 1UUOA 4F66A 1B9ZA 2BBFA 2VWSA 4FNTA 4RV3A 2ZIDA 5E0KA 2P0OA 2VEGA 2QJGA 1J5SA 4ADSA 1K1DA 4YN5A 5A2CA 4HPNA 3L2LA 4IOTA 3B0GA 2CESA 2HK0A 4XAZA 2QDHA 5AC4A 4H8VA 2OQHA 2ZBTA 4MFDA 5AZ0A 5FJIA 1M01A 5DEZA 5EB8A 2Y5JA 4R85A 2FDMA 3HMCA 1B3XA 1W9VA 1WOBA 1KKOA 4FEZA 2BHUA 3GNRA 3G1RA 5A3HA 3TFCA 2RGLA 4HZ8A 4LANA 3MP3A 4LUTB 4OT7A 1CCWB 4XBJA 4F0SA 5J5RA 2GQ9A 3N18A 3C86A 4XD3A 4RPPA 3NQCA 3R0UA 1XH1A 2VFDA 1CXHA 4LUJA 4Y9MA 3FHQA 4ERIA 3DENA 3M41A 3PBMA 1M7PA 3T4CA 4CGTA 3S5YA 2YL5A 3NGJA 4CCZA 3GIQA 3OGSA 4XZLX 2Y5EA 4GE8A 5I07A 4HU4A 3G3MA 1OCJA 2DZSA 2XG9A 1TMLA 1NQ6A 3CL7A 4KBXA 4ZOBA 4EOUA 1WZMA 1XWYA 1N8IA 1K8CA 1G5AA 1EIBA 4PBEA 5CQ1A 1OQFA 4EXAA 4IIGA 1CDGA 2ZZ2A 4K1GA 3WMCA 4B9YA 3AWOA 1Q85A 2CZDA 4C6BA 4P8XA 1DJYA 3L4TA 3QTPA 2QPSA 3NM3A 3K8KA 1JZ5A 2YYTA 3A21A 1V7YA 1ECEA 5D38A 3IVUA 1Q8JA 1NVMA 3SGUA 1ZAHA 4AWSA 2VEIA 4OECA 5BYWA 1XLMA 2HBVA 3V3WA 2GUUA 3P84A 4KETA 3BLFA 1GTHA 3V0SA 5AZ1A 3KTXA 4KCTA 3WELA 4PSPA 2CWXA 2VX4A 5K7JA 4C6EA 1YTKA 2Z1VA 2VVNA 2B0MA 4Q7NA 3MM9B 3CL8A 5E9AA 2PF0A 1UC5A 4KFPA 2EBNA 3TOYA 2PTXA 4QE4A 2H3DA 4I5XA 8XIAA 4DXKA 3KBVA 1W3IA 3C0JA 2Y85A 1EZWA 1ZQ5A 2EKGA 2QCLA 2VKZG 2VCBA 1C90A 3GU1A 3UWVA 4WOQA 3OZYA 5HINA 2DJLA 4FNPA 3DHDA 3NQ8A 3W7KA 1ZPTA 4TMBA 3CMJA 3TR2A 3AUJA 4WR3A 3RLHA 5LKYA 3CYJA 3LK6A 5REQB 2JQXA 3KHJA 3K46A 3AMGA 2VOMA 4O54A 1SZEA 4WJ8A 1Y0EA 1XC6A 4XKYB 4IPPA 4QAIA 4OKDA 5GEPA 5BW6A 1BD0A 1GYNA 4AZCA 3MSGA 1IEVA 3WQPA 4ES4A 3N2TA 5DO8A 1LROA 1OIFA 4YTUA 3EXSA 2YGYA 1XIBA 1G1YA 1L6FA 5C2GA 2ZUMA 1PAMA 2PDWA 3ARSA 4GY7A 1F6YA 3SCPA 4D72A 2GGEA 3MMWA 5C0QA 4JQ4A 2RDXA 3EWWA 2ZKMX 4LPCA 3KCLA 1PIFA 4F0HA 4IUOA 2EPOA 1G4EA 2WPGA 1VRXA 2TYSA 3BV4A 3ATYA 4TTUA 3WQ8A 1XLEA 2A4AA 3UGVA 4HHMA 4BFAA 5D09A 3TK7A 4LB3A 4UR7A 3EMCA 3PZOA 1UWAA 3UNTA 1A49A 3URNA 2AGKA 2HPMA 3K2GA 2BVWA 3W38A 4HNVA 3L5MA 1W1ZA 3RIKA 3MHUA 4R53A 4PB5A 2UY5A 1XHGA 4I3GA 4R7JA 3ZR4A 3MQTA 1J0YA 3WLOA 4ZBCA 3A4JA 2WJFA 4LCRA 3N14A 4A2RA 4QFUA 1AW1A 4C6KA 4JTUA 1S2CA 3WJYA 3AYVA 5JUVA 4M1BA 3KP0A 5CZKA 3FK4A 3TONA 1RCXB 4TQTA 3CPRA 4QS5A 1K9DA 4I90A 1XI3A 4KIEA 2VELA 1JDAA 1OFRA 4JHMA 2F6KA 2DT0A 1XINA 3H21A 3TDFA 4HYVA 2XGBA 2BXVA 4LF1A 4IICA 3U2EA 3A22A 2BGSA 4QITA 1W9XA 3PTKA 4NILA 4Z2JA 5E09A 8A3HA 1D2KA 3FJ4A 4GI4A 1EJTC 1TV4A 2OG9A 1TV2A 2NX3A 2VX6A 2XVKA 4U2YA 1FH9A 5TD4A 1DJZA 2FB2A 4JIHA 1YDYA 2Z1BA 3M16A 1ME8A 1TZ7A 1XXXA 1VEOA 2W27A 2BZNA 4MB4A 2ZVRA 3M47A 2RKXA 1ZALA 2OYMA 1LYXA 3H7RA 1UPMB 4W86A 3C2EA 2QCMA 1B2YA 4GKTA 2DSWA 2Z27A 1IXNA 4UQ9A 4FIQA 2CFFA 1THFD 4C6CA 2PLMA 4DBUA 3I6TA 3PNZA 6CGTA 3FXYA 2EEXA 4GUGA 4AZHA 4JYEA 4KPLA 3A6OA 4FX6M 3ALGA 3DFTA 3I6RA 2ZYFA 4IZGA 2IQ0A 3HB9A 3P2VA 1A3XA 2AAMA 2Q71A 4UNKA 2WJEA 3LCFA 3ZOAA 2HVMA 1VR6A 2WJDA 4QSHA 4NJHA 2W6RA 1XUZA 2IQDA 3AIBA 4RZ6A 2FZ9A 3WN6A 1XIHA 5XIMA 4IIEA 4L6DA 4FALA 1MDRA 3KE0A 5AYYA 3AROA 3PZVA 1F2JA 4TXEA 1QR7A 1F4AA 2X7VA 3TCEA 3WF2A 4D6CA 5C9ZA 1SUXA 5FEZA 2WV8A 5HWMA 4IX0A 2ZXAA 2GSJA 2G3MA 4FLOA 1WAWA 5CPSA 1YBQB 2XVLA 3T7VA 2QGHA 4BCEA 2X1TA 2JEQA 1JPKA 4UWMA 3OODA 3Q67A 4CCDA 3HJZA 5HMFA 1TO3A 5DELA 3W1NA 1OADA 3FHAA 2Y61A 4RW5A 3PZQA 3UJRA 3IPWA 1UCWA 5I3KA 4E4FA 4LTSA 4XAYA 5JU6A 2X1SA 4WY0A 3LCGA 1C3FA 4UNIA 2CHNA 1GVFA 8GEPA 3TE9A 2XVGA 1NFBA 1F8MA 5ABTA 4CEUC 2PGRA 4W88A 2GVYA 3UWYA 3OGRA 3PJTA 4PTMA 1AQFA 3N2CA 1W1A1 3VUPA 1O68A 3PF3A 1BHGA 2Y8KA 1CEOA 4O8AA 1WB0A 1YE6A 2E9BA 2G8ZA 3MMUA 2CBJA 2C79A 3HN3A 2DW7A 1XRVA 3WNPA 4V2XA 2XUCA 1BSLA 3AXIA 3WDHA 3SY8A 1HKKA 3QGVA 1GOMA 1MDLA 3TYZA 4V27A 3VYLA 3KBMA 1A5CA 2J79A 2C18A 1RJPA 4FLSA 4V1YA 3W7OA 1EHNA 4H00A 2E5CA 4L1GA 1S2UA 4E2BA 2Z2BA 4W7UA 3E38A 4XKMA 3CUHA 1YW1A 5MKGA 2QDDA 3WLSA 1ISVA 2C8NA 3LN3A 1TRDA 5C54A 2E6FA 4BF5A 1V3MA 3URAA 1UW9A 3BH4A 3BJFA 4LV9A 1QPOA 2YZRA 4ATWA 3SI9A 3GBEA 4IMAA 2EPHA 2PUZA 1J0JA 2WCGA 1E6NA 1KFBA 1TMHA 3VNYA 3LMYA 3N2OA 2DUZA 1PX4A 1E4NA 5AKQA 3WY1A 2PDFA 3CWNA 4AAJA 1OSEA 4UFMA 1NFPA 3NDYA 2QCCA 2Z29A 1X1OA 4P61A 2YFNA 2QCFA 1OGBA 4AZCB 3RXZA 3PBYA 3ZZ1A 1UD2A 3M5XA 3ITVA 1FX6A 3T08A 4AYSA 1J5TA 3ES8A 5J8LA 1GONA 1TFVA 1SMDA 3T40A 4FIRA 3SCQA 1HXJA 5BXTA 1J2WA 3PB0A 4ATDA 4W89A 2NUWA 3SFWA 4Z42C 1I2QA 4K39A 2G3FA 2NXIA 2WNQA 1O60A 4NJIA 5G2IA 4JY9A 1ZJIA 3W29A 2INFA 3VU2A 3H4XA 2W3ZA 2C91A 4N02A 3ZSTA 5BMXA 3TQVA 3PZTA 4GIRA 4HK5A 4J28A 1DQUA 3R8RA 4M7SA 2I16A 4I5RA 4WGHA 4HHPA 3QN3A 1L0PA 3QV8A 4A21A 3DFHA 2E6AA 3IGUA 2VCAA 1W9DM 3SJ3A 4O18A 2CNCA 3APTA 3H6OA 3TQKA 1KM3A 3PPFA 1O4UA 4PUMA 1KGXA 4IXXA 2BVYA 4C60A 3L67A 3TLLA 1IR2A 3L4UA 1JD7A 3GDMA 4C6FA 1L8PA 3R6IA 2AOPA 3VIJA 1F3WA 2Q3RA 3JZUA 1JQVA 1AK5A 1BYDA 3TC6A 4JTJA 4XX6A 2CLKA 2D69A 3I6EA 1YPIA 1W54A 2PDXA 2PP0A 1QXLA 2AOSA 2ZZ5A 5T91A 2PLJA 2FKPA 1W1IE 3CQJA 2PTWA 4RXGA 3SN4A 2VGFA 4HSHA 2NXHA 2WMIB 3AZSA 5HJLA 3S1GA 3OVRA 4CQ9A 4LBRA 1OC6A 3NQVA 2RDUA 4H2CA 4NF7A 4OJYA 3E0IA 4C6LA 2RDTA 2VFGA 2WM1A 3EA2A 2J7CA 4HA3A 3VDHA 1B3OA 2WB5A 2HSAA 5DF0A 4NT0A 1OCBA 3IJ9A 3R2GA 3NQGA 3SURA 3ICJA 3HTWA 2FZDA 1OABA 3A64A 2CBUA 4I7VA 3K13A 4AWEA 4K68A 1DXFA 3NNTA 1EJUC 1HF6A 3VNZA 1BVNP 2XH4A 1T0OA 5E6ZA 2V63A 3GZAA 4C6QA 4XBKA 5AHIA 6ALDA 4X63A 2VL4A 3GNDA 3RNDA 2A3CA 2IPGA 4BJHA 2TODA 3VVGA 3OG2A 4D6HA 1CPUA 1ZENA 4TR9A 3LPPA 1FWWA 4IMCA 4YVVA 1FCUA 3N2XA 5FJOA 3NQMA 3QW3A 4V1XA 3DKJA 1MQPA 3W81A 4D6IA 1JZ6A 3AO0A 2J4GA 2XIJA 4GI6A 3ECQA 1MW1A 2FVMA 4QQUA 4C91A 3L5LA 4ENLA 3B0PA 3VIPA 3WH8A 4IQDA 3QR3A 3V0TA 3MSDA 5K3VA 4PL1A 1VCFA 4FZIA 1D3GA 1TJ0A 3LCWA 1S1RA 3DZ1A 1VB9A 2F9RA 3ERPA 4PMDA 3ZWTA 3BZJA 2ZUSA 1NIUA 3KL5A 4NYYA 3ZWSA 1W9PA 1XR2A 3ITCA 4H9ZA 1EC8A 1K6AA 2DV0A 4WX2A 4H41A 4A3RA 1JF5A 2B7QA 1YNYA 2PDNA 3W1TA 4B9ZA 3TJ4A 1JJKA 1R30A 2X0HA 3RFAA 2GJRA 2YBTA 1Z9AA 3W6LA 1QK0A 1EGZA 1HZYA 4KWWA 1W8SA 2WWDA 3FSTA 3DFYA 2FFCA 2W91A 4HOWA 4FXRA 2E8YA 3RU6A 2H9AB 4P8UA 2VUYA 4Z2IA 2YLAA 1I9CB 4UTUA 4CQ8A 3C56A 1F3EA 4K8GA 4NVTA 1V0KA 4JFSA 5I2UA 1GPWA 3FEMA 1B4EA 2O9PA 3L2MA 2XIMA 1RV8A 3ITTA 4WY0B 3KX6A 5F4XA 3AWNA 4HNTA 4RK8A 1MEHA 3UEQA 3WMLA 4CN6A 2OPJA 4AZ7A 1EQCA 3GY1A 3B0JA 4GYKA 3H2EA 2D2GA 2J77A 3K30A 1TWDA 1FQ0A 2EHHA 3GYEA 3RLGA 3BMVA 5CC7A 3SCNA 2NVDA 3PNUA 1AUSL 3UD6A 2EPKX 4L56A 1JF6A 3D6NA 2NQLA 4IP4A 2W67A 1KTBA 1EXBA 2HEJA 2ABAA 4QLLA 3TYEA 4K7VA 2YCKX 1QWKA 1JG9A 3QYQA 4NU7A 1K8ZA 3RHGA 4IQJA 4P7QA 4LWWA 4S2CA 1SR0A 3DECA 3RRAA 3GIPA 2PF8A 2VCCA 3PPGA 3VD4A 2ZX7A 4JTSA 4EWND 3A9IA 2YCEA 2W0UA 3GAYA 1XBYA 3L12A 3S1UA 4DI9A 6XIMA 4MJZA 1TRIA 4QP0A 1QNVA 3M64A 3PC0A 3R1ZA 5GPRA 1UIPA 4TMCA 2E28A 4GVFA 3CUXA 1FWJC 3ZJ8A 2XTKA 3VNKA 4YTTA 2Y6ZA 5E93A 5MKGB 1OG6A 2DQXA 1O5KA 2NLIA 3BQ5A 3NDOA 1VEPA 1GKPA 2IW0A 3LENA 2NUXA 3UR8A 5CAHA 3HPFA 3CHFA 4HJFA 4CVWA 2XN2A 2VDIA 2VR5A 4LAZA 4X9YA 1R85A 1OINA 2UZ9A 4PRRA 4AEEA 3WJWA 2W61A 4PTNA 1F3TA 1B4KA 1YYAA 4JTEA 4K2SA 4FK9A 1EZ2A 4LYKA 3L5AA 1GGOA 1DTUA 1YMYA 4AD0A 1E1CA 3WQFA 4H83A 4JTTA 2C16A 4A22A 4XAGA 3EXRA 4RPQA 2OWCA 4E6MA 1V6TA 3KAOA 1NELA 1IT8A 2DZVA 2XZ7A 4UIOA 4S23A 1KC7A 1LOSA 1YPFA 3N6JA 1W5PA 3PWGA 3SY5A 4LB4A 4LVGA 2VRKA 4UTKA 4F40A 2A21A 3T07A 4TX6A 1Q6EA 5K2ZA 2UY3A 2VEKA 2J7FA 4KKXA 4Q33A 1VBGA 1RALA 4GQQA 3IK4A 2WSPA 3QTGA 1VF8A 3FS2A 3LPFA 1KNWA 2DH2A 1PWLA 1KB3A 1KGWA 2J25A 2HK1A 1IV8A 2X8RA 1ZP3A 2PDUA 3EKZA 2X42A 1PZ1A 3HO8A 2OKTA 2WWCA 3D3AA 4O19A 3TP4A 1TX2A 3DFQA 1HJSA 2ISSA 1PJ9A 2TAAA 1KM2A 2ADAA 5D05A 4FA3A 1DJIA 3F5KA 1UR4A 3EDFA 1WZLA 1C8XA 1B3YA 3O8AA 4DF0A 1BQCA 2V3EA 4KESA 3T09A 2WVTA 3MWAA 3W7NA 2BXYA 5D2WA 2DJXA 3O06A 3EOSA 3ITOA 6ENLA 4MDPA 4D1IA 2HNEA 3TX9A 3S0CA 4IT1A 3MV11 1U30A 1X6NA 4Q3MA 1F8IA 3VOFA 1Q6FA 4ALDA 3JUGA 3H54A 2YXOA 3VD5A 1K9FA 5KZEA 5CLTA 5A8NA 1GW1A 1M1BA 2ZRZA 1W3KA 3L2IA 3RN6A 3NOYA 3TTOA 1NH6A 4IFKA 1W5MA 3T8LA 3CV1A 1ITCA 4INFA 3W7GA 4X22A 2FB3A 1PVNA 3PSWA 4M56A 3KEHA 2XIOA 3MMBA 3WENA 2B81A 4C6MA 2XISA 3IGXA 1XIJA 5HMEA 3UP8A 2XPKA 3VNLA 1UBPC 4RCXA 5D03A 1RP8A 3GTFA 5LNVA 2P76A 4UXDA 4P7NA 2P3ZA 4RR4A 2IXUA 2C13A 3CIVA 1C7SA 4EAMA 1JNEA 2NQ5A 3MHGA 4GI9A 1ZL1A 2WQPA 1U5JA 4G9PA 4JNMA 1ONRA 5FEWA 1XW8A 4PB4A 5HJYA 1PCWA 1TMQA 5CZTA 2P5NA 1LL4A 3LBCA 1OFOA 5FF2A 1ME7A 4YXGA 3CWOX 1XX1A 3S2CA 4Y9OA 4ZENA 3CPUA 1ONEA 3KDOA 2VRQA 4JEQA 3C2RA 2NX9A 2WNZA 1XCWA 1KKRA 2WANA 3VKJA 5LHEA 1PKYA 3TJLA 2QJMA 4PUWA 5EMKA 1EA9C 4LX4A 1BLIA 1LM1A 1W9BM 4RNFA 4E4UA 4GO9A 2ZVIA 3PZ9A 4MKVA 3GDKA 3VXGA 3CUJA 2JIEA 3VNJA 4Y9AA 1FHUA 1QFEA 5JBEA 2D24A 1S38A 3WD2A 1GQIA 2HWGA 4KH2A 4IJRA 3TQPA 5EFDA 4UOZA 5FEPA 1I6NA 4W87A 2QT3A 1ZJAA 1GOOA 3RG6A 3DXIA 4GIEA 3W23A 1GOXA 4H9YA 3UVAA 5HOSA 1W6TA 3M0VA 3IWPA 2YSWA 1XPYA 2WQDA 1GKRA 2OB3A 4JTDA 2GWNA 1OK6A 1DIDA 2Y1HA 4S3KA 1W5OA 4TVUA 4F3HA 3ZLFA 4DZIA 1TPWA 1ZZMA 3C52A 4NJKA 2VZVA 4JKLA 2DP3A 3VLZA 1Z7AA 3UG3A 1TYGA 3L0GA 3KCJA 4CU8A 4IGMA 4ZSTA 1JDCA 2J8FA 4MF4A 1EH9A 3PR2A 1VEMA 4HNCA 3IANA 2BNJA 2BTMA 3VKKA 4JQ2A 1POJA 2VENA 3QY6A 2CLLA 4PMOA 3VGFA 1XM3A 2YX0A 1SMAA 3IACA 2VC7A 1UWQA 1H49A 2AGTA 4MVAA 1TV8A 1XLBA 3WLIA 1L2UA 4DLFA 1LORA 3LHUA 5HATA 1QNPA 2VC6A 1W3LA 2J75A 1KA9F 1OY0A 3IVSA 1LJYA 1YIXA 4MNKA 4MZYA 4BY3A 5BRQA 3GHRA 2PCQA 5AYBA 1FWTA 3NZPA 2Z1XA 3OO2A 1EF3A 5HR7A 4JFWA 4D6DA 2NSOA 2C6QA 3H22A 4MSSA 5LA2A 1MSSA 1XL9A 5I03A 4GC3A 3DDMA 1RD5A 5HNNA 3B03A 3SCTA 2NXGA 1HNYA 2ATMA 3IUDA 1XCFA 3BO9A 3AHVA 3CHCA 3OJGA 3B8DA 3W85A 2VMFA 5CPTA 1RHCA 4ZODA 6XIAA 3MY9A 3N04A 4Q8PA 3O7UA 1PDZA 2PD5A 4FOJA 3W7JA 5LGXA 2B31A 3PANA 3QEZA 1WZKA 2GVEA 2QCHA 3FA3A 4HA0A 1GPFA 1WKYA 4DUXA 4IMGA 3DC8A 3ZIZA 2YCIX 3WBYA 3LHVA 4P7OA 1YADA 4JN7A 3USZA 3WX7A 3NQFA 4LYRA 3WDIA 1S39A 1V6UA 1IWPA 3M0HA 1IIHA 4KWOA 3TOPA 1XIGA 3ENLA 1Q3NA 1KCKA 4JX6A 3GHSA 4NJGA 3ANVA 3PM6A 2ZX8A 4EPEC 4OFCA 1BGGA 1OJXA 1BTCA 1GZ1A 2ZX5A 3KDNA 3MZ2A 3U0HA 4DBDA 4R27A 4PRTA 4A8RA 1KV8A 4DWDA 3STFA 1MWOA 4Z08A 4BR1A 1BKHA 3UA3A 5TIMA 5HBFA 3CUGA 3S1VA 3KBSA 3S1WA 1E1CB 3O3RA 4FLRA 3KHDA 4WF7A 3ZJKA 4QE1A 3P61A 3FLUA 1UR3M 4JTFA 2OVLA 4JL2A 3TW6A 1QU4A 3OA5A 3GDRA 2ZTJA 3CPGA 2DGAA 1JEZA 2WKLA 1VS1A 5CPMA 1YDOA 1CXKA 3H4WA 3VM1A 2G3NA 1R3WA 4QG9A 4UZUA 3HQOA 1XBVA 1JGIA 3UR5A 1UZHA 3L23A 3MM6A 3R7MA 4S3GA 3ZFHA 2MNRA 3T44A 3WQWA 1PYFA 1UKTA 3IARA 1SJAA 4RE2A 3TN5A 2D22A 4L65A 3AU6A 3QVQA 3E12A 2WMJA 2BGNE 1CBGA 3WH6A 3KOFA 1XLAA 1NEYA 3KLLA 4KFNA 3U7VA 3KL3A 3TTSA 3SSZA 2NWSA 3JU2A 3I3DA 2P50A 3P14A 3IIPA 4BA0A 1IZCA 4LV4A 5CLWA 3GK0A 4O10A 4BF7A 1EJXC 1HTIA 2XGIA 2PU1A 3UQNA 1MEIA 1Z42A 3HV8A 3MW7A 5T9BG 1KM6A 1OBAA 5HA7A 3IGHX 4O0ZA 3EXTA 3G0XA 3GTXA 3GH5A 3W76A 3W1MA 5BXRA 3AC0A 2CITA 4OVXA 2QNEA 1EEXA 3NWRA 4I9AA 2OSWA 2ZOXA 3N9RA 1XSIA 3CMFA 5KTLA 5K9DA 2ISFA 4EP8C 1EA0A 4IFKB 4GQBA 3CL6A 3E2SA 3CV6A 3LNPA 2PDPA 4HMNA 5C9UA 4IIFA 4J3XA 2QAFA 2AKMA 1ELSA 1HKIA 3LU2A 1IXOA 3AIEA 3VOHA 3MMBB 5JH2A 2P0IA 3EDKA 4ZFCA 1P1XA 2OZ0A 5B80A 1XJBA 3MP4A 2QKFA 1GW9A 1Q6QA 4M51A 3EMZA 1TSIA 5ABHA 1XFBA 1ZTVA 3KOYA 5JVLA 4OV9A 5BOEA 4KIRA 3CZEA 3U2OA 3T6CA 1FDYA 4B91A 2Y24A 1HKVA 3UZZA 5C2CA 3ABXA 2E8ZA 1RPXA 1WDRA 2HVOA 2CKSA 1U33A 4M6PA 2YBVA 1XYBA 2L5HA 5G2HA 1DJWA 3E6EA 1H7NA 3BJTA 3T55A 2GVLA 3LOTA 2ODOA 4YIWA 3I7RA 3FCPA 2XU2A 3BG9A 3LTSA 4GUHA 2I17A 3WFAA 4W8AA 3WK3A 3FNDA 4H7CA 1WAUA 1EPXA 3LGDA 5EMMA 3RCYA 4I7UA 4M7TA 2OMAA 3E1F1 2J8GA 1T6MA 1QW9A 4QSFA 3AHXA 3PWAA 1P6CA 1MW2A 1IHIA 2TMDA 5I7GA 6PTDA 3LQLA 3FYPA 2H8XA 3PUGA 4R9OA 1VH7A 1RZMA 5LNSA 3V1HA 3NVTA 1EOKA 4PUJA 5CEWA 1EO7A 4E38A 3L68A 3AOPA 1SZRA 3TMLA 3PBWA 2FGLA 1R7OA 1VBUA 3PG9A 3M0MA 1XQKA 3W2JA 3C2YA 3RR4A 3ANUA 4KT2A 3MTWA 3S6DA 1LP6A 3AU2A 2PP1A 4UTJA 3FW6A 3IAPA 5BRBA 4CD6A 1Q5MA 1PTGA 4PFHA 4DJFD 1WDQA 1H11A 2CLPA 3AXKA 3UJ2A 1AH3A 2WVSA 3AS3A 4GVIA 1UQZA 4PCTA 2CLFA 3GW0A 1KXQA 3MYPA 4LVDA 3AHYA 3MT1A 4AD3A 4XWUA 1JCXA 2WSRA 3GVQA 2WC4A 4B5WA 5ABGA 5T26A 3IV3A 1K7XA 5GJPA 2PLCA 3B8SA 3GR4A 4Y2WA 2YB4A 5EY5A 3E2RA 1KWKA 3SQLA 3EGJA 1KM0A 1L2QA 3W1PA 3KOXA 3V35A 3SIZA 3VC5A 4HYWA 4Y9NA 1U1UA 1WZAA 4YU1A 2Y0FA 3BLIA 3A4WA 3TYCA 2IMRA 1FWGC 1VKFA 1M53A 2GL5A 4NZ3A 1CGYA 3WQOA 5HNRA 1KRMA 3VKSA 4DUVA 3EWBX 1NWRA 4BEQA 5FKYA 3UCCA 4EACA 5HMSA 3WBEA 3CEPA 3WUFA 1ML1A 1AMYA 2E68A 4NZ5A 1LTDA 4RL3A 3BSGA 1S5WA 1VPYA 2X2YA 1C8YA 3CK5A 1TJ1A 2D2JA 4XIAA 4MJMA 1V3KA 5E1QA 5D04C 4AOPA 2D3LA 1XCXA 4NZFA 4D2JA 3ONCA 1E6QM 3MUZ1 2GDQA 1JFXA 3SY1A 1O66A 1AQHA 1K3UA 4DJEA 2BS9A 2HE8A 4M6VA 1VIZA 3MMCA 4AVNA 4O12A 1NOWA 3S6TA 2W63A 1V51A 3GC4A 3M43A 3TYUA 1SO3A 1ZCCA 1GQJA 3CV2A 5G4WA 1N2VA 5DANA 4A35A 4EKJA 1OC7A 4DX3A 3KM8A 2E1WA 1TWSA 3TR9A 3CAVA 1UD5A 4GISA 3KRSA 4BHYA 5FI8A 3WF1A 4WOZA 1V8EA 1J10A 1KV5A 4X0NA 3VMNA 4UFJA 5I3FA 3B06A 1OZQA 2J74A 1HL9A 3KZPA 5H2ZA 3C2VA 1IWBA 3JRKA 2D20A 3BTNA 5A8QA 4DWSD 3O07A 1F73A 3WH9A 4KRZA 1VC4A 4UTTA 2CZ5A 4LT9A 3B0NA 2VP8A 2GDUA 1NTHA 3IVTA 2PRHA 4DM1A 1T99A 4B5XA 2Y8VA 3DYOA 3VLXA 4B5UA 3BOXA 2VURA 2O4QA 5DX7A 1KLZA 1TVNA 4GOAA 4EF8A 1JAEA 4NYUA 4W4QA 1QMLA 3SQMA 2VT0A 2ZUUA 5K9CA 1ZBCA 1H60A 1Q66A 5AOUA 4ZE4A 2REQB 3MDWA 3ITGA 3W6MA 3NSXA 5KSWA 4RDYA 3LYEA 3N15A 4B3KA 3SO7A 5CGTA 3LHZA 3BL3A 3LXBA 1E6ZA 3R0DA 2A3AA 1DE5A 4C90A 3NL5A 5CG0A 2FVKA 3GWQA 3VC6A 9XIMA 1CI1A 1W2PA 3DFNA 1TTIA 2J13A 1CB2A 4BWLA 4CU7A 1VQTA 4EK7A 2ZADA 1P0NA 1UD3A 3T05A 4KCUA 3O63A 4L1WA 1BQGA 1T8XA 3II1A 2YJQA 1L6WA 5EBAA 5ENLA 3NQEA 3GX9A 3K4DA 2B7PA 3WLRA 2O0TA 1TUXA 1S5MA 1CIUA 3AS0A 4KCWA 2R1LA 4PTDA 5CSSA 1Y5WA 2Y7EA 1R3YA 1I1WA 1JXKA 1EJRC 4JD4A 3EX6A 3P6LA 1MXGA 4GZIA 5IBXC 1H7OA 3NXLA 2Y63A 2PBOA 4DJDA 5HPCA 3LB0A 2FGZA 1JCTA 1FXQA 1J4EA 1WUFA 1UWRA 2FMNA 1TA3A 1XP3A 4WIWA 3EEZA 3BAYA 1L6GA 3GTHA 3CZKA 2POZA 2QJHA 3UXDA 3AS2A 3V1PA 3RO6A 3E0WA 5E0FA 2EPNA 5H1WA 3PFMA 5BZAA 4G2DA 3C4UA 4LW7A 4Y8FA 3O05A 4O4WA 1GOWA 1JCMP 3WG6A 5CCZA 2OGYA 3S5NA 1NOUA 1HQTA 1Y8BA 4O53A 3UESA 3H7UA 1H5VA 3W6YA 5A6AA 3DFOA 3SCOA 4HTRA 1XRFA 1OFEA 5I3DA 4B5TA 1QPNA 2VYOA 3LV6A 1GWJA 1PB0A 3W24A 1F05A 1ADDA 4LF2A 2ZUTA 4RZBA 3S9YA 4J1OA 1DVJA 1MUCA 2BX7A 3C0QA 3L9CA 4Y96A 1I2OA 3KWSA 2JFEX 3RX3A 5D9NA 3GNPA 2DZWA 3INPA 1VD6A 3P7YA 1RY0A 4M5PA 5I09A 1OF8A 2KAUC 1A5NC 3BOLA 3W01A 3PAJA 4YTQA 3QQ0A 3TYBA 2NVCA 4GBDA 3LMZA 3U5UA 3VDAA 2NV9A 4AH7A 4E2VA 2RH9A 3ITXA 3QSTA 4EXQA 2FIQA 3WQEA 2VC9A 1E4LA 3R89A 3ARRA 5BXSA 3ALFA 3GC5A 5IDZA 5JQ9A 2W62A 2CERA 2QUTA 3WD3A 3NDZA 5PTDA 1UZ1A 1YEYA 1EC9A 3GD6A 1OGGA 1BWLA 3G1SA 3N6HA 3O0FA 4J2PA 4XVDA 2YCLA 2I5QA 1OFPA 4TVCA 3WKZA 3FAXA 3SB0A 1W1PA 5A8MA 1R47A 3LHWA 1Q2RA 3FY1A 5DCBA 1IYXA 4DJED 4PB3A 5EMJA 4XIMA 3P8JA 1JCNA 4HNOA 1K70A 3NQAA 4C7FA 2BOFX 1JUKA 3IIZA 1GJUA 4PMVA 3E0VA 4MIMA 2XINA 4M0XA 1KFKA 3IUHA 2QW5A 1OCNA 2E9LA 5J04A 1DWFM 2GGJA 3CUIA 4UCFA 3HQ1A 2ZXDA 1XYMA 2X0SA 1KCXA 4WSKA 3VKAA 5AC5A 5JBDA 3GH7A 4JKMA 2JE8A 4HOZA 3PZNA 6REQA 2ON3A 3U8GA 3RMEA 2NZLA 4Z1BA 1V0NA 1GOQA 1RBOB 4N2YA 4JHOA 1UKQA 3KVKA 3HQNA 3L7RA 4JBRA 3EX3A 2G3IA 4QCFA 3SRFA 2VDGA 4S3DA 3RF9A 3NCOA 8RUCA 1N82A 4AIEA 3T0DA 4A8IA 4EIVA 4QR6A 4D8ZA 1GNXA 2PWVA 2XHYA 4RXFA 1GG1A 4QLKA 3TQ0A 2Q8ZA 4JTKA 1W3NA 3W7PA 5IM51 4IGSA 3MMCB 5FEXA 1KXHA 5C55A 1RBAA 3LBOA 2Z1WA 2ACQA 3QM3A 1OVDA 4MWAA 3AI0A 4AZBA 1PYMA 2IPJA 4GXWA 1JULA 3RITA 3QZEA 4IHCA 2VWTA 3HU7A 4GK8A 4ZO6A 2J6VA 1LT7A 1M65A 4H7VA 3HJEA 6TIMA 2OZ3A 3A3HA 4AZ5A 3TA6A 2PDGA 4OGZA 4GX9A 3NZQA 3WH5A 1V03A 1FWBC 4DIAA 4AD4A 1QHPA 3N19B 3W7QA 2X09A 4OWGA 4M8UA 4N6FA 2FZMA 4MNLA 2EJAA 2R1NA 1FVPA 2WM0A 4GJ1A 4IMDA 4YJ5A 2B4GA 2JIWA 2HNHA 1EJWC 4LRTA 4MDOA 1BXNA 2VZSA 3RAOA 1OX6A 3G5EA 1HVQA 1HUVA 3W2MA 3CBWA 4RDVA 3GFYA 5F4WA 1WPCA 1BRLA 1E70M 3EMQA 1PWMA 1EGVA 1OT1A 4QHRA 3ZT6A 4BS0A 4NSBA 4BQ5A 4NL1A 3KLKA 1A80A 4X2RA 2XSJB 2XZ9A 1D8CA 3CQIA 1D3HA 3RM8A 4U3AA 2J62A 1FH8A 3B9EA 3AMKA 4CCEA 3G77A 1KFLA 5G4HC 2DT1A 4ORMA 3KVMA 4N7QA 1B57A 1XS2A 1IIGA 1MNZA 1V79A 5TQLA 2IUZA 3TA9A 5JIWA 1QW8A 4L9YA 3N2MA 1ISXA 2WMGA 5C5YA 3B8UA 1F76A 4O14A 5DT5A 1UWTA 4AVOA 2JALA 3UG5A 4B2DA 3EDJA 3EOUA 1M41A 1OF6A 4LBSA 2CHOA 5ECUA 1HL8A 3VA8A 4IMEA 2BY3A 1K02A 1QATA 4MM1A 3OYXA 4JTLA 1JCYA 2ACRA 4DO4A 1E5JA 4NHVA 3UXKA 3C3UA 2FPYA 3KS5A 1XC4A 2AL1A 3GBDA 4F9DA 3OVPA 2YDQA 3AHZA 1L8NA 2YL6A 4LH8A 3GVGA 1QVBA 1RXOB 4NY2A 4IIBA 1AW2A 9XIAA 3SQSA 4NI3A 4B15A 3O16A 5RUBA 1XGZA 2I14A 1DJNA 3W1UA 3S5ZA 1S46A 2GEPA 3ELFA 1JYXA 1N7KA 3I7QA 3TAOA 1HT6A 2XSBA 3VKTA 1KRCC 2O4MA 1NWSA 4FF5A 1RLCL 4DVOA 1NJJA 3NOEA 4DBWA 3OPSA 3AJ7A 4JXCA 2J47A 1GHSA 1WNOA 4NZJA 3A4XA 3VINA 1WDDA 2Z6JA 4S3FA 1G6CA 2DPEA 1E40A 4BQ2A 2CHRA 3GVWA 1OEPA 4BF9A 4UOQA 4MPQA 2D2HA 2J9YA 1JQXA 2CBVA 2BDQA 1KR0A 2D23A 2R1MA 4GXMA 5CZSA 1PKLA 3QLDA 4JTRA 1E6SM 4N9BA 2A3LA 4FMVA 4UTWA 3VOCA 1CZ1A 4JOMA 2PU0A 1R3SA 4O0KA 3E2QA 5L9FA 3T2QA 1WV2A 3OBAA 3KOWA 3PBGA 3EYPA 5AYZA 4JTCA 5FAJA 1RQEA 1UIOA 3UXLA 1OYBA 2ICSA 7PTDA 1IZJA 1GUVA 2PWDA 2VRJA 1NWTA 4XG1A 1EF2A 3BANA 3KTCA 2XFFA 1CXEA 2EAWA 3WQ6A 1AG1O 1RSCA 2DSVA 2QZRA 2WSYA 3DYPA 3N17A 4F2BA 3NEHA 2UV8G 1TPUA 4DI8A 4FNRA 3GFZA 3I7SA 2ZRXA 1Z8AA 3VDCA 1W5QA 4GEPA 4PGLA 1V0LA 2DZAA 2Y5SA 2J9ZA 3JZEA 4EX4A 4U5KA 3GHUA 3QHOA 3W7EA 1AA1B 3B97A 4RE3A 1PBGA 1P7TA 4M6QA 2YCLB 3P67A 1H0IA 5A2AA 3UGRA 1QUMA 3ONBA 3K8MA 1R9ZA 3RYSA 4K7YA 1WXJA 4OQVA 1RD6A 2I9EA 4F48A 4YTRA 1R2RA 3MO4A 1IWAA 1EJSC 2C1GA 2PRLA 5C7HA 1XYAA 1TIMA 5CSRA 3XISA 5IRPA 1VFLA 4XBSA 1RA5A 1QNOA 3QQ1A 3ZR6A 5DT7A 3MMAA 3GVRA 1E3ZA 4K1WA 2JEPA 2XSAA 4O1AA 3BWWA 5CBIA 3TXZA 3B0LA 4YCOA 3R79A 4UZSA 1XF0A 4LVBA 3LGEA 1XLCA 3QPZA 1XQLA 4PZVA 5C9WA 5D2YA 4ICMA 1B30A 3A3WA 4PCFA 4WDXA 3R0KA 1GEHA 1PX8A 6REQB 2ZZ7A 2F84A 3BW4A 1CB7B 2ZUWA 1Q63A 1KD0A 4W7WA 4H01A 2A6NA 5G4EA 2QPXA 4D6GA 3HZ3A 2A1YA 1UASA 4CNOA 2V5LA 3QKEA 1EYEA 2GGIA 3A5VA 3M5VA 3VZYA 1JL8A 4JR5A 3N3TA 2H8ZA 1CTNA 1C8QA 1FFRA 3E3HA 4ROPA 1GOIA 3U7BA 3VIIA 1SJBA 2I9UA 5LNRA 3WFZA 3F4DA 2ZZ3A 3MI2A 4BQ3A 2PDIA 3MO7A 3GTIA 4WDWA 3ARPA 1ADSA 2DT3A 2R6OA 2XN0A 2VR4A 3W25A 4A29A 4F2TA 3N73A 1EWEA 3Q4DA 2E5BA 3C5QA 3MCNA 4MWAB 2NX1A 2PS2A 3YPIA 3ZQ9A 1C29A 3NXFA 1JUEA 3OVQA 5CBJA 3TN3A 1HP5A 1FWNA 3BQ6A 3RLUA 3S5SA 1MUMA 3GAKA 4GMEA 1R2TA 4UTTC 2ATSA 2SFPA 3BAXA 5EMYA 4ZB0A 3BCDA 1ZSXA 3A4AA 1VYRA 1ZAJA 2ZICA 1ESWA 1TTPA 3B8VA 3AZRA 4HTYA 5D9OA 1GEQA 1TIWA 3W7IA 1MQRA 3D5HA 2Q8LA 3T0TA 5I06A 2QLYA 3FJLA 4Q4OA 4CD7A 2C0AA 3UY7A 4PMJA 4JCMA 3TTQA 1J6PA 4I8YA 1H41A 3AIVA 1LWHA 2UY2A 2CLHA 3VGHA 3KW3A 1R3RA 1YQ2A 3GB6A 3VM0A 2RJGA 3L4VA 1JYVA 3QMTA 5DFAA 1E0XA 4FR1A 5FSDC 4PTXA 4XO6A 4J7RA 3GR7A 1BRLB 3TTYA 4K37A 4R33A 2ACUA 1I2NA 3TYDA 1YBQA 3O2LA 1OHLA 2A3EA 4QX4A 3NA8A 4BWLC 1PTAA 4H6KA 3W3OA 3CQKA 4GYJA 1FWFC 1HP4A 2YLLA 3DCPA 4C7DA 5BU6A 3QHNA 3R94A 4LXFA 4L6OA 1PO9A 2JKAA 1BG4A 3G18A 2YBUA 1LOQA 2F7FA 1Q6CA 2CEQA 2NT0A 1AD1A 3BG5A 4GO8A 3QXBA 7TIMA 2WHJA 4KFOA 1KFEA 1J93A 4HKPA 4GGBA 2WVUA 3GNNA 2QIIA 4CQDA 3A5FA 2R14A 3MMDA 4DJDC 1IE7C 3PBUA 4P7RA 2OFJA 1TTJA 4AZ6A 3WUEA 5AC8A 1S3HA 1OFAA 2QF8A 3UFYA 3CHEA 5KZDA 2V3DA 2ZX6A 4ZB2A 1TREA 3RGTA 5AHEA 3EB4A 4IPIA 1WKFA 5HANA 4HOXA 4E3VA 1W56A 1GORA 3E02A 2QR6A 1DWAM 3DI0A 3D3FA 2WYSA 1IXPA 3V5OA 5AHNA 1YXDA 3OHMB 4H8NA 3PPHA 1OX4A 4KS0A 4W85A 3UZWA 5DMLA 1KM5A 3AAMA 4GIYA 4UMCA 2CXGA 4KCVA 1G4PA 2QEZA 2OLAA 4C5YA 4GFIA 1AL8A 4TVDA 1UH3A 1EKOA 1V7AA 3L0NA 4C1LA 1PS9A 1W32A 3VOIA 5HJXA 3DH7A 1XV8A 4Q32A 3EDDA 5BOOA 4C1NA 3T8QA 3VDGA 3VM5A 1OB0A 3GHTA 3UWEA 4WK9A 2MUCA 4NZ4A 1EUNA 4LC6A 4Z2GA 2GSHA 4LAUA 4LFYA 4GQRA 1XUUA 4J27A 1O1ZA 2CXEA 1ZY9A 4QJ5B 1SW7A 2INZA 3AICA 2VD9A 3OGVA 3AJXA 2FQIA 1VLIA 3BAKA 2FDSA 4GXPA 3S8HA 3E5BA 5GJNA 3KUMA 1KBLA 4QQ3A 3WUGA 3B0MA 2GJNA 4DLMA 1EP1A 1UD8A 4FOKA 1NDWA 3EZ4A 1GVQA 1WP6A 1TCDA 3CIXA 4AY7A 1DJHA 5CC3A 3L4ZA 2QIWA 1AFSA 2BV9A 3R25A 3VKCA 2GLKA 2BOGX 3FXGA 3E0FA 3P81A 3RPDA 1XLIA 4CVUA 1CLVA 3N4EA 4LY4A 1QNSA 1CGWA 1VAHA 2QDEA 3BLDA 5E9XA 1SJDA 3GQYA 4W9TA 3PN8A 1QI5A 3Q2DA 3CAKA 3FKRA 3PJUA 2FVLA 3TTEA 3O6DA 2YDRA 3F03K 1SZFA 4MGGA 4MYAA 1P7TB 3I3BA 3RX4A 5LGZA 1DOSA 2TRSA 4QDMA 4AD5A 1YX1A 4A8LA 3WIJA 1F7BA 2A3BA 2FH6A 4YTSA 1GVIA 3LCLA 1QRQA 1YKWA 2GUBA 4C6OA 3GS6A 1LRQA 1C92A 1LWJA 2PRMA 2WMFA 5A6TC 1XLJA 1UOZA 4ICNA 3LLXA 4S39A 2NWRA 1PL9A 5EMLA 4PMNA 3SFKA 3SGGA 4ZMGA 1QAPA 2DEPA 1LL6A 1CENA 3A23A 3CC1A 4MPKA 4OE7A 3MMAB 1E71M 2CZVA 4TV5A 3DHFA 4DZHA 4GNJA 5A6LA 1FWDC 3H4GA 1DJGA 3MBFA 1EDTA 1CGUA 2Y4SA 3GDTA 3WLHA 4AW7A 1QO2A 1SPQA 1XRSA 5EBUA 3B9NA 3U6WA 5JBFA 3GXPA 1JZ4A 3KRBA 2WMIA 3QV7A 5DMNA 4IG2B 1WQ5A 4JIEA 2UY4A 1A0DA 4Q8QA 1OIMA 1XBZA 4HT3A 3OP2A 1E9IA 1JZ3A 1VJSA 5T9CE 4GUJA 4UMAA 4K38A 3WNNA 5AECA 2WHLA 2OZTA 3SECA 3QYSA 1AVAA 1C91A 2IKIA 4K36A 3B0VC 2HPIA 1SSDA 2ZRVA 2ALRA 3CHVA 5DY2A 4L4LA 4MWAC 5LXEA 5FAGA 4GI8A 2EPMX 2BOEX 5AVNA 3HPSA 3UNDA 4DF1A 3VE9A 2QJIA 3HMJG 1HVXA 3W28A 4U4MA 1EXPA 3VIOA 3L66A 3JS3A 3N4AA 3DN5A 2ZRWA 4JYFA 4EPKA 3WK0A 4ACZA 3SRDA 4J3UA 2PTYA 3B0YA 3LXCA 4NXSA 4WSHA 2DUXA 4PMZA 1MMFA 4Q4QA 2CC0A 5KITA 1HG3A 5I24A 4JFVA 1IQ8A 1RUSA 4JKKA 2V67A 4PBGA 4W7VA 2F6UA 5EFFA 1DL3A 1E9ZB 7ENLA 1SO6A 2WBKA 2PWEA 4X0VA 3VFCA 1K7EA 1A5LC 4OBSA 3WH7A 4PEEA 4C65A 1UD6A 3G1DA 3QFEA 1L6YA 4IXHA 2O9OA 4ZO9A 1KCLA 2PEVA 2RGMA 2R24A 1DYSA 3THCA 1O12A 2PD9A 2HE5A 3OLGA 2Q3OA 3E74A 4UR8A 2PA6A 4QLJA 1LOLA 1R87A 4M24A 3OOQA 2PI6A 4PCSA 4OU1A 2FFIA 3IJ8A 1RCQA 3MUIA 3QY8A 5IHRA 2F2HA 2GDVA 4ADTA 4HB7A 2Y2WA 2Z00A 3UR7A 3H24A 4ICCX 4CEXC 1U83A 3EDEA 1WE5A 3V75A 4B5NA 1WKDA 5F1VA 1IR1A 3GSMA 3W7LA 1X39A 4MLJA 1AD4A 1PV8A 3R4IA 1CLKA 1XG4A 3O1NA 2H9AA 3FAWA 3QLLA 2IPFA 1QJWA 4NX0A 3IIOA 5GVJA 1PZ3A 1ZUAX 1US0A 1EJ7L 1WBHA 1XIEA 4E2OA 1XYLA 3WLKX 3G3DA 3LCXA 4O1EA 3N34A 1ICPA 3AXXA 3CQ0A 4JYDA 4F79A 3GNOA 2G41A 3LPOA 1UJPA 5CC6A 4HZ7A 3PZIA 1V93A 2Z7KA 3GW3A 5H91A 3ARVA 3MZNA 3MB9A 4Y9PA 3WK1A 1K6WA 1E1FA 1TB3A 4KRUA 4G5DA 3ARQA 3HIJA 4GZ7A 1X7IA 4UUIA 3Q94A 1JZ7A 1NDVA 1VFFA 1VRDA 1OZMA 1YRRA 2HS8A 1QHOA 2J66A 4AXNA 4A3QA 1NOFA 2PDJA 2XN1A 4QRNA 1SYTA 1YLVA 4CQBA 3BVJA 4AX6A 3CJPA 4GACA 4MAVA 3IJIA 4ZXOA 3CLWA 3P93A 2GQ3A 3BLOA 4HCHA 3O6AA 4ZTYA 1OX4B 4XK2A 3W84A 3FOKA 2IKHA 3KP1A 4H8UA 1FWIC 2VFEA 3SCSA 2E9MA 3B8TA 4JHZA 1AH0A 5H8MA 1Y5VA 4AU0A 3POHA 4DYEA 4UTWC 3EOLA 3WF0A 3AIWA 3O6YX 4IFOA 1JXJA 4C1NB 4JTIA 2GQ8A 4LNYA 2QUMA 1ADOA 4UR9A 4PMXA 2YW4A 3L0KA 2PDLA 3RJYA 3TJXA 2QMKA 4LUSB 1Z6KA 3QW4B 5A6KA 2VHLA 3W07A 1Q7ZA 3ZLGA 3LY0A 3CTLA 2AQVA 1SZGA 1VFSA 4PFMA 2FHBA 4NJJA 4Q8MA 2GYIA 4MFEA 3H2MA 2ZFAA 2OODA 1TPEA 4DO7A 4W8LA 1TUFA 2XDFA 1RLDA 1XLGA 4QEEA 3SUSA 2Z4GA 3GTNA 3CZGA 3CM4A 1Z32X 3U2CA 3NO1A 1XDMA 2H6RA 5TF0A 1JAKA 1YDNA 2ZXBA 4IL2A 3HFYA 3AYRA 2OLHA 4JQ1A 3LQGA 2WLZA 4B3ZA 2OJPA 2WZTA 3ZT7A 4P5UA 4J3ZA 4ML4A 1LBMA 1LQAA 3M0IA 3UZJA 3VTRA 3UWWA 3QV9A 3AOFA 2BWGA 3WQVA 2QQ6A 2XH2A 4CKQA 4NRRA 2XFYA 4YMZA 3SM0A 4J40A 2AKZA 4H19A 2YOCA 5MHBA 2ZCGA 1CXLA 4FP1A 1T7LA 2JKEA 2PC4A 3CZJA 4LNCA 1UH4A 2CCRA 2JF7A 1S3TC 1RK6A 3WL0A 1S2WA 3BLPX 1MXDA 1B90A 4LJ3A 1K9EA 5FJRA 4JTAA 4TX8A 1H4PA 3UZYA 3PJWA 1DTNA 5I79A 3V36A 3ARWA 3AMLA 2QUVA 4UC5A 5I3HA 4RNIA 4DWSC 3DBNA 4LEQA 3NIYA 3W1QA 2ZXQA 1TR1A 4MAZA 3LTYA 4DPQA 1P0KA 2GVGA 1Z41A 1NU5A 3T4WA 2WBGA 4GNVA 5LIUX 3NYDA 5KETA 1KTNA 3WLPA 4O50A 4EPDC 5IXEA 1SO5A 3PBVA 3B40A 1C93A 3F4NA 5G1TA 3M7SA 1HFBA 4GJJA 3GE7A 5GNXA 3EWUA 3IUIA 1U2YA 4POCA 1AZ1A 5AYIA 1UB3A 1LLOA 3G24A 2J7EA 1NARA 1ITQA 5LHFA 3GM8A 4D8LA 1DKWA 4M3PA 3V16A 4R9XA 5D9PA 1XD1A 3G1AA 4TX9A 4UFHA 3BGGA 1Q6GA 1QOPA 3H53A 1JNDA 1M6JA 3N2BA 3W73A 7TAAA 2HQAA 2OR2A 1I8JA 5FJTA 1JR1A 4EVZA 3B0UX 1JGMA 2V81A 2GJPA 4PTWA 1HKJA 3WNMA 1V6WA 2J9XA 4H9MA 1H5YA 4PR4A 4XAPA 2AQOA 2ZWYA 4ACZB 3VKDA 1TV3A 1ICSA 2GZXA 1MFVA 1R38A 3CIWA 3F5JA 4JY8A 1E73M 3P5YA 3KBNA 5AN7A 3VKQA 4KWVA 1K77A 4ERGA 4U10A 5LSMA 3IIXA 4UQEA 1JDDA 3MSYA 1U1JA 3GR8A 2ZE3A 3DUGA 3W2NA 4QDPA 2XWDA 3RLVA 2B7OA 5BWFA 5L6UA 2FJUB 2Z25A 4G38A 1V3IA 2YXGA 3VNIA 3ZXWA 4LSBA 1B9BA 3W1AA 1WDSA 3UPBA 1YE4A 3KVLA 3KWXA 4JDYA 3BOFA 4QXIA 2A6LA 3MUAA 2KX9A 3TROA 4PMUA 4QG8A 2D73A 5H8UA 1V0MA 3LI1A 1ITXA 3UXAA 3VAVA 5C9XA 4GCXA 4DAFA 3HGJA 1PUDA 4C6PA 4PULA 4GZEA 1EGMA 4UTIA 1W2VA 1AW5A 3QPYA 4XZHA 1OD0A 5CJNA 3TZNA 1HKWA 4JS3A 1F61A 2JGYA 3TFXA 4GC4A 2Q8XA 1JPIA 2PWGA 3HPZA 4IJCA 1Q8AA 1X8CA 2V5DA 4NQ1A 2HZGA 5KZMA 1UR1A 1V3HA 5A6BA 1HJWA 5AHLA 4Q8UA 1DXIA 4A3HA 1M68A 4O4VA 4XUYA 1US3A 2G4JA 4C6JA 3LRKA 4P2VA 1HL2A 1I75A 3FN9A 4FNQA 1GJPA 4Z2HA 1S5NA 3VIGA 4BI7A 1LWIA 3W70A 3WQDA 3WDQA 2ISWA 5IHSA 4YPJA 1Y65A 1FCQA 2V0TA 5DMMA 3NQ7A 1VCGA 1XLHA 1P0DA 1H7RA 4ERAA 2Z28A 3ABZA 4XD5A 1S2AA 1QO5A 4HZMA 2PTDA 1XLFA 3IEBA 1W3HA 3OIXA 2YIHA 2X0YA 4ZQCA 3BARA 5CG7A 4RKAA 3BURA 1W3JA 3EA1A 4B3LA 4HHLA 1ZFJA 2GOKA 4AXKA 2QVNA 1LQ2A 4LU0A 5GNZA 2CETA 3LRMA 4MB1A 3WZ0E 2OELA 3W2UA 3E2VA 4GH1A 3M6YA 4HN8A 4ZCWA 2A3HA 4TOQA 3I4EA 4U3CA 3LD5A 3VIHA 4IF2A 1ONWA 2VVSA 2I56A 1E43A 2OWWA 1YPXA 4WSJA 3F2DA 4O28A 3SUUA 5KMYA 4HN4A 1N8FA 3WQ4A 3S9ZA 4DN1A 3PZUA 4LAMA 3NPWA 2BHYA 1Q6OA 3TH6A 1E4MM 3A24A 1R3QA 1RP9A 3H2NA 1KXTA 3UW6A 2QAPA 3G6LA 3WLNA 2VQTA 1QI3A 3LS9A 3ANYA 1PDYA 5KINA 2ZC8A 2XFWA 3BSHA 4GWEA 2Z2AA 3TNOA 1X6LA 3TWBA 3VZZA 1GJWA 4QM1A 1HJXA 5BWAA 3GKAA 3M1ZA 1NAL1 3MBDA 6A3HA 4Q8VA 1ZP4A 4HCDA 1GT8A 3WMBA 3SADA 5EPDA 3OZPA 4GYFA 2XH0A 4Z1CA 5AC6A 4A3YA 3MCMA 3BGAA 3EPNA 2X2GA 2PWFA 1S2VA 1G9HA 4UQDA 4WKFA 5A8OA 5F4SA 3I65A 3BC9A 3GG0A 1DJXA 3EB3A 3PTQA 5FF0A 1ZJ9A 3IJQA 3B0HA 3VDBA 5FF7A 1GHRA 3KBJA 4NAEA 1X98A 5HQLA 1M9HA 4GQGA 1EIXA 2HISA 4RLIA 1V02E 2FHFA 3N1AA 2I1OA 1PSCA 1NFGA 4MUZA 2Y70A 1KBIA 5M03A 3FA4A 2AL2B 3BMWA 1JCJA 4JIQA 3LTPA 4JCLA 4PMRA 4D8AA 4D6EA 1BF2A 4W5UA 5IFPA 4JICA 1UR0A 2G37A 3UG8A 4JFUA 2EG6A 1J79A 3MM7A 5I78A 4J5NA 1DP0A 3EEGA 3M07A 1I2RA 1QI2A 4RDWA 4FF7A 4ZOEA 4E2DA 3WBWA 5A8GA 2O7SA 3MYOA 3SUTA 1PE1A 2ALDA 3G2GA 4AEOA 5FSEC 4RZ5A 5F2MA 3MUXA 1K8XA 4L9ZA 1TWIA 3EWDA 2YXXA 1PIGA 1Q4WA 1QWGA 1T41A 3ZLHA 5FF3A 1FWEC 1LLWA 2PODA 2FTYA 1OM0A 3QC0A 4WUIA 2CLIA 4C1KA 5MF5A 4HU8A 1LDCA 2GK1B 5IDIA 3SCWA 2FHCA 4Z0JA 4TV6A 4LBUA 4HMEA 2QCEA 2BODX 3UETA 4N6EA 4ZR8A 2EGZA 1EPVA 4K8HA 4JN8A 3MVTA 4DO6A 3NSNA 5IBXA 2BY0A 4O8RA 1A5KC 4Q6XA 4PCNA 4FX7A 3ZR5A 3LZ5A 1KWGA 3VFLA 3PUOA 3E9AA 4O1CA 3V18A 4S2BA 3W83A 3T81A 1GK8A 2Z1KA 2ZZ1A 1P43A 2YA1A 4H6RA 1IF2A 2GSEA 1BSIA 1J96A 4UOJA 1TPH1 3SAZA 3JR2A 3B04A 4HSNA 4FS9A 3WEZA 5HWJA 5C71A 1AJ0A 1YHTA 5T8GA 9CGTA 3ZVHA 3R10A 1R3VA 3BLEA 7A3HA 2F61A 4LYQA 3TVAA 3F1QA 1ZGDA 3S2MA 1ICQA 4DF2A 5A69A 5A6BD 2DIJA 3QGAC 4GH3A 2WK2A 3KXQA 3P8IA 4IIHA 2EJ1A 1JYNA 1G67A 2W5FA 3BLLA 2BHZA 2J7BA 4ORIA 2WVVA 7XIMA 3OB8A 4H4IA 3SCVA 3M6DA 2GWGA 5BXPA 4D6FA 1EQPA 3WJXA 2OT1A 1SSGA 4M80A 1ENUA 2V2CA 2PAJA 2V8ZA 2BGQA 3WQCA 4MY1A 4DO5A 4J3SA 4XD4A 3CZ8A 4Y90A 4E8CA 3Q65A 2Z1SA 4Q8OA 3HBLA 3OU8A 1FWRA 2PE4A 1ALDA 2JK2A 4IWWA 4UNLA 3SRHA 5HQEA 3ARZA 1D7FA 3ABSA 1QI0A 2D2OA 1MUWA 4CUCA 5LZLA 2ANUA 2GJLA 3MM5A 3NTYA 3TV8A 1B3WA 1QNRA 1MW3A 4G56A 1LG2A 2OYLA 4ACYA 5M17A 2UWFA 3UERA 5I0DA 2FZ8A 2JBMA 3K8LA 5F2IA 1MYRA 3SCRA 4AUBA 4IGHA 1X7FA 4MY8A 3DI1A 3OBKA 4MNMA 5C70A 2P1FA 4AD2A 5J5DA 5JH1A 3IJDA 1R0MA 3AHTA 4A05A 2E67A 3WD4A 3UPWA 4AFYA 4HVXA 3ATZA 4ZOAA 3KFTA 1F5ZA 1QASA 4QROA 1EUAA 3PAOA 4UFLA 3KTSA 3RK8A 4NNCA 4NAFA 1LUCA 3OLDA 3CT2A 1YTDA 2ESCA 1E0VA 3RRXA 3B05A 2B7NA 4HNLA 4U2ZA 1NSJA 4YWSA 1XG3A 3OZOA 5H6HA 4S3EA 4KRTA 5D4YA 1XPGA 5ABFA 1OD8A 3M4HA 1REQA 1TE6A 3C0SA 2WC7A 3CAWA 2WKJA 3APGA 2CLMA 1E0TA 4JPGA 4Y6GA 4M6UA 3R13A 3OG3A 3NURA 1OYAA 3UF9A 5AYXA 1VFHA 1UA7A 5C8BB 4L64A 4RE4A 4IPLA 1R2SA 1EBGA 3V0UA 2QV5A 4C5ZA 2HMCA 3EOOA 3WMSA 4OZOA 2W66A 1V6XA 3WLLA 3APYA 4D1JA 1I4NA 4NASA 2VO5A 1HJUA 1QT1A 1KTCA 2V6AA 4W8BA 1QPRA 4TU1A 4G39A 2E09A 2HXTA 1HO4A 3ZO9A 1BEUA 1WXZA 4RDZA 3P74A 5CPQA 3UU0A 1H51A 3FGCA 1J0ZA 3PULA 4IL0A 4XQ6A 1CXIA 1DV7A 1G01A 3P3BA 1UKSA 5DBUA 3VGGA 1ECQA 1RJRA 4MYXA 3W86A 2QVHA 1UHVA 4NRSA 4GUFA 4ATLA 1WYIA 3U4FA 3FKKA 3GFXA 1KM4A 2DFAA 5KZ6A 4E8DA 1O5XA 2P8BA 3ZJ6A 5CJMA 4U28A 4ZA0A 4XZNX 2XIBA 2XWEA 3HM7A 4AHQA 1BG9A 4QDWA 3OR2B 1UOKA 4S3AA 2F6XA 3VUSA 1V08A 3HPAA 5HNTA 3LGGA 2DZPA 2WJZA 1J18A 4N9DA 2EPLX 4X61A 3EKGA 4NAEB 3OLIA 4MJ2A 5EU9A 2VX7A 3P62A 3UYCA 1E0WA 2REQA 1KW1A 5HULA 1DIKA 4HYRA 1QOQA 4GYPC 4DHGA 4MKSA 4KEMA 2BFGA 1HO1A 4IPNB 3G1YA 3PTDA 3BAJA 2PGEA 2XFRA 3S2NA 2QJJA 3LV5A 3P82A 1IGWA 3LPGA 3F4WA 1I45A 1G4SA 3UPMA 5FL0A 2VTFA 1P1MA 3MM7B 2VZTA 1UP2A 3BJSA 2F38A 3QFWA 3PSVA 3CXOA 3LI0A 1KM1A 2ZTKA 1DE6A 4EF9A 3ZYZA 1QI4A 5B7ZA 4JZ5A 3WQGA 1WDWA 5M1TA 3LEPA 4US5A 4XZBA 3DESA 1UYQA 1OFDA 4E0CA 4H3DA 1FHVA 4D6JA 1XYCA 3AQUA 2PC8A 4XTDA 1E3XA 4D9PA 2PWHA 1VCVA 2G3JA 1Q7QA 3FJNA 4Q4PA 2PURA 3LG3A 2X1IA 3SR7A 4UBPC 3FDKA 3N6QA 4IP7A 3OQ8A 4EANA 1Q13A 2BY2A 2G97A 1S5TA 5EKYA 3SIMA 2I5GA 3SZ8A 4KQNA 5IFTA 3KZSA 2JGQA 5TNVA 1OCQA 4C6DA 4UTLA 3BGJA 2D1ZA 3OA3A 4MOZA 3MI3A 2YKKA 2E77A 2FZNA 2R91A 1U22A 2XGZA 3TIMA 3QF0A 4FR6A 4BKNA 4MG4A 2ASHA 1M7XA 1OYCA 2EQDA 3UJEA 2WC3A 4NZ1A 5A6JA 1JDFA 3WBXA 5K4ZA 4S3CA 1IEQA 2YFOA 1GZGA 1P0BA 4E8GA 1V3JA 2VUNA 4R7WA 7CGTA 1E9YB 4HCLA 3L21A 3T0AA 3W26A 1F74A 1P0EA 3BMXA 3C2FA 1V4YA 3VX1A 2OX4A 1XDJA 3DFSA 1XRTA 1XKJA 3F2BA 2CLOA 1MW0A 2PPGA 1IEIA 3WLTA 3ZVHB 1KBJA 5BU9A 2PGWA 4H9XA 5CPNA 5M2FX 2F2KA 3DOPA 2R8WA 2XIQA 2E6YA 4UFIA 2Q6ZA 3QC3A 1M03A 4FNSA 4WKAA 4B4FA 3W27A 4H7ZA 2RDWA 3W02A 4HGXA 1SZNA 1DWGM 3GU2A 2J88A 3QR1A 1QW7A 3WFLA 4HPHA 1CWYA 2WVVB 4S3JA 2O9RA 1H7XA 4XVEA 2YA2A 2PFHA 3GXDA 3K5XA 4AIUA 4GLEA 1P6WA 3WEOA 3GUGA 4MY9A 4RNHA 2J78A 3URBA 1KQYA 2RHGA 1TQXA 5ABEA 2OQLA 4AF0A 3S46A 4A8NA 1MZRA 1F4HA 3LCHA 4N0RA 2V30A 4ZQRA 3LLDA 1AQ0A 3SEPA 5I5RA 1YXCA 1MRQA 3MS8A 4N4PA 1BTMA 7ODCA 2D0HA 4W93A 4MTVA 2A79A 1JYWA 1HX0A 2XVPA 2HXUA 2VQUA 4GCAA 4LS2A 1FTXA 1GTEA 1O5RA 3MM5B 4KGJA 5DRIA 4OUEA 4A2SA 4DPPA 1UP3A 3EKLA 3OBEA 1CNVA 3Q45A 4O16A 1DJQA 3NZ1A 1H1YA 1EJVC 1K03A 4EAYA 1NWUA 3W9ZA 4S38A 4DYKA 3I68A 4WRHA 1XYFA 1ZJBA 3S6OA 1M5WA 3NL6A 1E6XM 3S2LA 5AC7A 4HJWA 2ZDSA 3MJYA 2QGYA 1OK4A 3GXNA 1W91A 4UMBA 4UQBA 4YLWA 4AZGA 3VI2A 4PL2A 2J7DA 3PPCA 2W9MA 2WMKA 1SFLA 5I00A 1K9TA 3BK0A 4J35A 4Q7BA 1UC4A 1FHDA 1ZRQA 4UQAA 5IOBA 2Q02A 3S2JA 3U4AA 3M9YA 4HMDA 2G5WA 4HMCA 4QIUA 1A47A 4NAFB 5DXYA 1LUCB 3ITYA 3HA1A 3MA8A 1QTWA 2IQTA 1JI1A 1KO0A 3ABQA 4LC8A 3DG7A 1M7JA 4U5IA 5ABFB 2BVDA 3FFSA 2C3ZA 1REQB 3SDOA 1J0IA 5D30A 3DYMA 1BAGA 3GLCA 3S5OA 1GVOA 4GY1A 3PUEA 2E0PA 3MU7A 4GIAA 3FEQA 4XB3A 5DN1A 3LBMA 1ZAIA 2NT1A 5LA0A 1AOPA 1FDZA 1RA0A 2VX5A 1GZJA 1A50A 1B5TA 3LCIA 5AHMA 2WXDM 1A3HA 2GJXA 4CNSA 3RU8X 3P0WA 4P7LA 4F8XA 3TYAA 3BLKA 4J3TA 4KWUA 4YWIA 1M7OA 1UBSA 4GG9A 4V33A 2DH3A 3C61A 4NP7A 1FWAC 3QGKC 1RVKA 1ZNNA 4LS0A 4F0MA 3B4UA 3LRLA 3UBPC 4K8EA 3FYOA 3RJXA 1W9UA 4GKLA 4OBTA 1TQJA 2OGJA 4TO8A 3FGCB 1SFJA 2DSUA 1VZWA 2PWUA 1UP0A 1N55A 3VNDA 3S47A 2E7FA 2PGFA 1US2A 5TAOA 4US5D 5FCZA 2OEKA 5CC5A 2YCJA 3CB8A 3AFBA 3VILA 5DY3A 3IJLA 5DCDA 3A12A 1MZHA 3T42A 4ECLA 1AMKA 4IX2A 2PCEA 3CQHA 3P0XA 2P8CA 3W88A 3EBVA 2DVUA 3EWCA 1Q2SA 3EWXA 3W22A 1TV5A 1S1PA 3F4VA 2P88A 2FTWA 3AXMA 1JCLA 4B16A 1ZB5A 3M5ZA 2TSYA 4GZJA 2BVTA 2Y7DA 1KGUA 2I57A 1H1ZA 4IIDA 3DIPA 1TV7A 5K9XA 1UUQA 1F3XA 4BEUA 2ZRUA 1HKMA 2XSJA 5CXPA 1H63A 1FXPA 1RVGA 3BPWA 3BW2A 1NY1A 2GFTA 4MKNA 1EP2A 1TKKA 4L1XA 2WZMA 1V77A 3ARUA 4GGHA 4WHBA 2WOQA 5EYWA 3N25A 3O9NA 2QYGA 1UWIA 2XVNA 4ZO7A 5M3WA 1R46A 2IPWA 4AMCA 1JRBA 3UYIA 1BYAA 1RY8A 2ACSA 5FL1A 4PC8A 3M0KA 4IM4A 4WJXA 1CX9A 5DBTA 3C3NA 1E51A 2EG8A 2QF7A 1UMLA 4MB3A 2Y8UA 3WEMA 4LQ1A 1Q4NX 1HGYA 3H70A 4HK7A 1T5AA 2INEA 2VZUA 4IQLA 1H0GA 2DZUA 4BZYA 1NP2A 3AIUA 2YW3A 1X1ZA 2OTDA 3NM1A 4R88A 3UCDA 1CGTA 4U31A 3F5LA 1VJIA 1ZBWA 3V5CA 2H3BA 1KRBC 4LAKA 1U5HA 3VOJA 2G0WA 5HXMA 1PEZA 4W5ZA 4I9TA 3F4CA 2X30A 4QCEA 4PH6A 3PP7A 3W2KA 4IH3A 2Y89A 3FX4A 1I0DA 1WXYA 4AISA 4D71A 4DBSA 7REQA 3G8EA 4OBRA 4AY8A 1CGXA 5A95A 1EBHA 2LLEA 3M0YA 1H3GA 3MHFA 1SW0A 4QNWA 2NQZA 4YL2A 3QMRA 2DSZA 1W31A 2P3EA 4L9XA 1QPKA 4XZIA 5I77A 4FXFA 1EHAA 4Z1AA 4U33A 4JX5A 4HNUA 3QV6A 1D8WA 1BPLB 1LT8A 3GKFA 3W00A 3C6CA 1W17A 4RX0A 5CZ0A 3QPEA 3VCCA 4ZB5A 5BRPA 1W8GA 3UJFA 4CN4A 3ABOA 4DXVA 2VZOA 4HIBA 2ONEA 2QCDA 2PZNA 4G7FA 4BI6A 3UZXA 2EO7A 4IMFA 2R1PA 2R82A 2OEJA 3K4WA 5D9MA 3CMGA 4ZQPA 2Z0IA 4YNGA 7GEPA 4WCJA 2OSXA 1JZ2A 3D47A 4UTMA 4L4MA 1IGSA 2HDJA 4FXJA 4H9UA 3ID7A 1H62A 3GIYA 3QMSA 4YHEA 2V2DA 3TKFA 4Z2LA 4N9CA 1FKXA 4JIRA 3OLEA 1BWKA 3NGFA 4AF0B 1KFJA 3VGBA 1GCYA 2GVJA 2Y7GA 3DBPA 4MUPA 4LALA 2CBIA 2ZDRA 3GUWA 4KEZA 3NR0A 1S2TA 1VP5A 2YDAA 1EYWA 1E4IA 3ISIX 3W7CA 3UT0A 1E72M 3MJMA 3AYSA 4FO4A 4ZXLA 1MQQA 2DIEA 4Q7IA 2J7GA 5BNKA 6TAAA 4CNTA 3QRHA 5M5DA 1LZOA 3GH4A 4FOUA 1U5VA 3MM8A 4QNEA 3MCOA 1Q65A 3JVAA 1RQHA 2D0GA 1W0MA 1MFUA 1A5UA 3BUVA 3W7MA 1WUEA 3CWHA 2QUUA 1L9WA 4KWSA 4HZ6A 1JPDX 1KCZA 3CHDA 4AYGA 4EE9A 1UA3A 1SO4A 3SBFA 3WQ5A 1XDLA 3MSRA 1O94A 3QSRA 3IJ7A 3PHAA 4XO7A 2NLYA 3VCRA 1PIIA 3NEVA 2ZWZA 1BGAA 4F2UA 4G7EA 4JX4A 5DXXA 3B3DA 1A5BA 1GVEA 2J27A 2X05A 4YHGA 4XZMX 3VCNA 4OOUA 2XIIA 2J24A 2OSYA 3E49A 1VBJA 4YYFA 1EX5A 1V6YA 4PRWA 4LS1A 1P48A 2G4FA 3RCNA 2ZRYA 3F2CA 1Q6RA 2WNWA 4HU0A 2IS7A 1WO2A 1PKMA 1MRAA 4HPJA 4QISA 3REQA 3FVDA 2A85A 4NKCA 2XM2A 3UWQA 5C7VA 3DC0A 4L4PA 5LXXA 5AOPA 3HGRA 1KFCA 5SWUA 5LIWX 4FX8A 4V28A 2HRWA 4G1NA 4Q8WA 1P6BA 5DCEA 4I6KA 3WYZA 1XIFA 5A5WA 1BFNA 2OXNA 3HG4A 2GJXB 4PMQA 4LOCA 1Z44A 3VMPA 4B5VA 2WW5A 1XBXA 1H61A 3N29A 3MI6A 1FP9A 3WDJA 1BYBA 8XIMA 4LVAA 4NNAA 4AHOA 5GJMA 4PUEA 3BZGA 4H04A 1VENA 1OGSA 4DM2A 2CZFA 3W0KA 1A4LA 4QEHA 3H26A 3W72A 1W1YA 1P4CA 3U2ZA 2FH8A 1UD4A 4MB5A 2CKRA 3F7JA 1VBRA 3STPA 4KMQA 2QCNA 5CKSA 1YXYA 1WCGA 3UVIA 2R9RA 4GD0A 2V5CA 3SW6A 4CNUA 2BP1A 4R7OA 1ZBKA 1IEXA 3OHIA 2PLKA 5B7YA 4IISA 2YZ5A 2C14A 4O57A 3VKBA 1WKEA 1NQKA 3W75A 3UXIA 2EF9A 1K8YA 1PX3A 1PCKA 1EWDA 2UBPC 2O55A 4I5UA 1JIBA 5HMDA 1FWHC 5G2WA 3PY2A 1Y5XA 4L61A 1SU5A 3BAWA 1UZDA 3VLYA 4H6EA 1MI3A 1EL3A 2VNCA 1JD9A 3LERA 3VABA 3VX0A 1QK2A 4QBXA 3RR1A 3TUUA 1EP3A 4CN1A 1CXFA 2HROA 3EA3A 3W1XA 2QXWA 5HR6A 4DJDD 2V3FA 3L4WA 3VMOA 1YNQA 5AB3A 3TSBA 2YL8A 5AY7A 1F6KA 2DZXA 2QMJA 1PZ2A 4KEVA 4ZQNA 4E5TA 1XH0A 2V68A 3AYTA 3MKCA 2X41A 1LF1A 1J0KA 4GHRA 1MVYA 3G1XA 3O6CA 1ODUA 4GA8A 1DHKA 1PPIA 3GXFA 1A5MC 4AVFA 2GUYA 4JAWA 3W37A 4QJ3B 3I3EA 1TTQA 3KRUA 1ME9A 3NVDA 3UCQA 3MUY1 3IV8A 1FH7A 3RCMA 5HPOA 2FJKA 4DZAA 4GJIA 5LNWA 1XICA 3W2LA 4PTVA 2OKOA 3C2OA 5A2BA 2PZ0A 1MXSA 2ZA2A 1VFOA 2JKPA 3RM9A 1GYMA 1PHQA 3FYYA 4AY1A 1UJQA 2PBGA 3H55A 4MMWA 3HOJA 4NX5A 4B92A 5HDRA 4K6AA 1QDSA 1OFQA 1TE1A 1FHLA 3UZ5A 4PA8A 4HP5A 3G1VA 2HTMA 3UR2A 4QJ4B 3DFPA 5LIKX 3S1XA 3VKPA 1G69A 4Q8TA 1X96A 4LYPA 4O1FA 4FLQA 2DUAA 3SSJA 1ZJ8A 3NFUA 2ZUNA 1XLLA 4WQ6A 1X97A 2VFHA 3VD7A 3T2OA 1LLZA 3QH2A 4PUDA 3QHMA 2D0FA 2J7HA 2VM8A 4DJFA 1EFZA 4WKHA 7REQB 1D3CA 1ZHAA 4JNYA 1RR2A 4J9JA 2R94A 5E0CA 3MWCA 1EEPA 3IGSA 2FPTA 2W79A 1YDVA 4ZE5A 1I60A 3B9DA 1XKYA 1XSJA 1RH9A 2PMQA 4YYCA 3LLFA 3HG5A 1EDGA 1X1NA 2NV1A 4O13A 2ZQ0A 3LUTA 1OWQA 4XISA 5BOFA 5D2TA 4IGNA 4HPXA 4ZZ9A 3MC5A 4XV0A 4XZWA 1C9DA 2QCDB 4KERA 4V15A 3ZM8A 3NQ2A 2OZ8A 1O6IA 4L7ZA 3GC2A 3G0SA 1ZU8A 4I8DA 2V4JA 2QUNA 2NV2A 5G1MA 1GQLA 4HA4A 3PFRA 1G7UA 4O17A 3T2PA 3V5FA 2OOFA 3ARXA 3AMCA 4LY8A 3RPMA 1OFBA 2OOGA 3A3XA 2WAGA 3V7PA 1HGWA 3VNMA 1IT0A 1ODZA 2E40A 1X38A 2FPVA 4HHHA 3RM4A 3LHTA 5TBOA 4JN6A 3HGSA 4P8WA 1Q7MA 4KW2A 3TW9A 3HGOA 3RPTA 4O11A 1AH4A 2ZUVA 4AB4A 3PJXA 4FHAA 2V38A 3K1GA 4PE8A 3TAKA 1J9YA 1ZS2A 2J6XA 4GFSA 3J7HA 2ZZ6A 3B4YA 2C7FA 3HURA 3GNXA 2DU2A 3STGA 3FDGA 4GPNA 3WUBA 4J3VA 3VIMA 2A7PA 4M1RA 1TWWA 1XGDA 1J2BA 5CGMA 4F0KA 3COTA 1FY6A 2Y7FA 2POTA 2A0NA 3BICA 2QDGA 3MM8B 3TLQA 3U57A 1O7AA 4MJ4A 5U7SA 1OC5A 2BG5A 3HV9A 3P60A 2OX1A 3M0ZA 1XH2A 1UUMA 4OOZA 4PMYA 3PS7A 4DBEA 1GVYA 3CASA 3B8WA 3SN1A 2V5JA 5CSYA 4I7WA 3M0JA 4MWAD 4ONVA 3XINA 1NDZA 2QPUA 5D32A 2WLYA 4XD6A 2NQJA 1ISZA 1GG0A 1QHZA 4L6HA 1LQ0A 3NYZA 2G50A 4G7EB 2VGGA 2PB1A 3GYCA 3BCJA 3OW1A 1VBHA 3T0CA 4IG2A 3TJIA 4DWSA 2AMXA 2EXOA 1H1NA 3G0UA 3GXTA 1XSKA 2GGHA 4AEFA 3W1RA 4Q4RA 3P5ZA 2VC5A 3S3GA 4JIPA 2CZEA 4AWUA 2RAGA 1S5VA 4RZ4A 3TCSA 2ZA3A 4PSRA 3FA5A 4H8HA 3C8FA 3TZFA 3REQB 4N4QA 2DT2A 4EWJA 3GO2A 1CECA 3R11A 4TTGA 3R8HA 4NG3A 2OEMA 4A3UA 2OLSA 3BV7A 1FA2A 4AG0A 1F9CA 3S83A 1OG0A 1UR9A 1BXBA 4GY0A 1OT2A 3POCA 3N13A 5FESA 1XYZA 2MANA 3LA4A 3GU9A 5CBBA 1VHCA 4JL1A 1GVSA 1P5BA 3HF3A 4B5SA 3NQBA 1W5NA 1M3UA 4Q8NA 5F7UA 3BCFA 1AQMA 4RW3A 4WDUA 4K3ZA 2DY3A 3OEXA 3VIKA 5G1YA 1HN1A 1Q6DA 3THQA 2C71A 4O15A 3MANA 4YCPA 3ME3A 2E6DA 5JIPA 3M0XA 2X1RA 5CJ5A 3GXIA 4B2DD 4P8VA 2WKGA 5A94A 1A0CA 3TC7A 4YVPA 3UWUA 1MO0A 2Y88A 2FLIA 3WNLA 3SUVA 5JXQA 1XIMA 5D02A 2OU4A 1E9LA 3VO0A 2X1UA 4RUBA 1HIZA 2OYKA 4KGLA 3VGEA 1B3ZA 2V2HA 4F0LA 1EOMA 2PDYA 4R34A 1K4GA 1VFUA 2VEFA 3QBUA 3PZMA 4HPGA 4HTBA 3TNBA 5LIXX 3IRSA 1WA3A 1TG7A 3KL0A 3BG3A 2J8TA 2E3ZA 2AAAA 4QGCA 3KVJA 1NDYA 3ZS4A 3C0LA 1RPKA 3NZRA 2VR2A 4HBKA 1VYPX 2ZZ4A 4XTIA 1NF0A 3PK7A 4H1ZA 4WZHA 3OZMA 3W1LA 3FIGA 2VEMA 1LBLA 1XGEA 1RJQA 2V3GA 3BAIA 4C6NA 1RCOB 2DVXA 1WOAA 5I6SA 4HK6A 3U48A 2DZBA 2W92A 3DAQA 4FXSA 2OO6A 4ZTXA 6GEPA 4G1KA 3T9PA 2AKJA 3WD0A 1SW3A 3OR1A 4DYJA 1SFSA 3DG3A 2C1HA 1VHNA 3BXWA 4PUNA 5I3GA 4FNUA 2OO0A 3TN4A 2VEPA 4X3ZA 1TJPA 5KEZA 3OIHA 2BLEA 3N9KA 3CH9A 1FBAA 1NF7A 1R3TA 2JF6A 4ILSA 4FPSA 1KLYA 3EX4A 4WGXA 3LSBA 5DRCA 1W1VA 3OYZA 1UKPA 4JDBA 2Q09A 4QE5A 1JDEA 1D9EA 1D7KA 1JRCA 4WY0F 5F2LA 4M81A 3STCA 2WHKA 2H90A 1G7VA 1WDPA 3BSMA 1ONXA 5C2XA 5BCAA 2HCVA 3AZTA 3MUCA 4I9MA 4AIBA 2PTZA 3E96A 2GGGA 3KBWA 4EPBC 3L4XA 1O95A 3H2AA 2GPTA 4WXZA 3W7HA 3UJSA 2R1KA 5U4NA 1XFCA 1GQKA 2YDSA 1DWJM 1O5QA 3KCOA 2NSXA 1Z69A 1KXVA 3CUZA 3SUWA 3LM7A 3C8NA 1C9WA 3CEUA 1R8LA 1RK5A 1EB3A 2ZA1A 3DU0A 4W84A 1E56A 1ITUA 3M0LA 1J12A 1FKWA 1E0UA 1W37A 5CAKA 4LUSA 4WVXA 4X2PA 3ZVIA 4Z0SA 5I3JA 3HG2A 2C1IA 2E1DA 5HAOA 4LRSA 3EOEA 1GVRA 1DHPA 3SRKA 3OVGA 1ZCOA 1J6OA 3EB2A 2A7NA 1BXCA 3G1FA 2V9DA 2V4JB 4J4KA 3RMJA 2VXNA 3MPGA 3MMTA 4LCQA 4GBUA 1XIDA 3PWIA 3VPLA 1PKNA 4L4OA 4YS1A 5XIAA 3VM7A 1AJZA 3WNOA 3H2OA 1EX1A 1VYSX 4DQWA 4UTFA 1H09A 4G6CA 2BB0A 2X16A 4QG6A 1I2PA 1VFTA 4CD5A 4AWTA 2HJPA 1TCMA 4C7GA 1UWSA 1RQBA 3T0BA 3H23A 1E5NA 1WX0A 3WO8A 3N12A 3T78A 2KZHA 1VGAA 1CLXA 3LSCA 4JNZA 3WL1A 3EAUA 3R58A 4MZ1A 5I3IA 2WSQA 5DQPA 3FJ6A 1KQZA 2ZX9A 3CGTA 2GOUA 4F0RA 1K7FA 5K4XA 2ZC1A 3CNYA 2VJXA 2WO5A 3GDLA 5DLCA 2NQHA 1R5YA 3P80A 4IQEA 4GRSA 4QAWA 3MM6B 3T1GA 4ADUA 4REQA 2DZTA 4GVGA 3G22A 2WZIA 5ECVA 3N3MA 2PDMA 3STEA 2CWNA 5D8ZA 5JMUA 1MEWA 2C0HA 4AC1X 5D8WA 1GYLA 4IP5A 2WNNA 3FSUA 3R12A 2WCSA 4B90A 5AFDA 4HSOA 2RJHA 1T96A 3A13A 1QBAA 4UCGA 4H2HA 3W53A 2NUYA 2PP3A 4DWSB