4S39A

Ispg in complex with hmbpp
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
401
structure length
400
Chain Sequence
MRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus
total genus 140
structure length 400
sequence length 401
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s39A01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s39A02
3H2OA 3VM0A 3MMBB 1TWSA 4MWAC 2V4JA 2YCKX 3H26A 3H2EA 2Y0FA 4DAIA 2YCLB 3MM7B 3MM9A 4S3FA 3B0HA 2YCJA 1AJ2A 4G9PA 3VKSA 3B0GA 4O1FA 2DQWA 3MM6B 3MM5A 1AJ0A 1ZJ9A 3MCNA 1Q85A 3TR9A 2H9AA 1TWWA 3GEOA 2V4JB 3B0LA 4S38A 3TZFA 3MMAA 4G39A 3MCOA 4MWAD 4DJFC 2YCIX 4HTRA 3MM8A 2VEFA 1AJZA 3BOFA 3TYBA 3VLZA 5AOPA 3OR1A 4C1NB 3MMCA 5JQ9A 1Q7QA 1Q8AA 1Q8JA 2VP8A 3VKTA 2OGYA 4DJED 1EYEA 1AD4A 3H2MA 4S3EA 3TYEA 5GEPA 4DJEA 3B0JA 4AOPA 4D9PA 4CCZA 4PZVA 4S3AA 4DJFD 4S39A 4DB7A 1Q7ZA 2VEGA 3OR1B 4DJDC 3H21A 4NILA 2XSJA 2E7FA 4S23A 1F6YA 3OR2A 4NHVA 2GEPA 3MM9B 1ZJ8A 1TWZA 4MWAA 4GEPA 3V5OA 4MWAE 3MM5B 2Y5JA 3H2CA 3MMBA 3VKRA 3H2NA 2H9AB 3VLYA 4D8AA 3MM7A 2YCLA 1AD1A 3AOPA 3MMAB 2AOPA 3OR2B 4HB7A 4S3CA 1TX2A 4DJDD 3MM8B 4O1EA 3MM6A 3H2FA 2Y5SA 7GEPA 4S3DA 3MMCB 3TYCA 4DJFA 2AKJA 3B0NA 3VM1A 3TYZA 3TZNA 3B0MA 4G38A 3VKQA 2DZAA 3H23A 2BMBA 4DAFA 3VKPA 6GEPA 3VLXA 1Q7MA 3TYUA 3NOYA 4C1NA 4NL1A 2DZBA 4DJEC 3MCMA 3TYDA 3H22A 4NIRA 3H2AA 2XSJB 1AOPA 8GEPA 3H24A 3TYAA 4S3BA 1TX0A 4D8ZA 3K13A 4MWAB 4O0QA 3BOLA 4DJDA
chains in the Genus database with same CATH superfamily
2VJXA 4MNJA 1MRAA 4B90A 3M1ZA 1KTBA 1Y5XA 2V8ZA 5CPSA 5GNYA 4YTQA 1XQKA 3LSCA 3P62A 1WUEA 4S38A 4NASA 3TZFA 1M3UA 2VD9A 3UZWA 2A3HA 3HB9A 2E67A 4G56A 5LA0A 1WO2A 1AD4A 5LIKX 3PNZA 4PCNA 2PP0A 1UMYA 3B03A 4N42A 3SRKA 3QKEA 2VT0A 5I3KA 2Q3OA 4PCFA 1XL9A 3ID7A 3B8WA 2YFNA 1J5SA 3BAYA 4XKMA 1OCJA 2ZBTA 3VMNA 4IGMA 4A8IA 2YBUA 3DHFA 5HPOA 4ZSUA 4AZHA 3QPYA 1GOQA 3PBUA 4XVDA 3U5UA 4XD3A 4BEQA 2HXUA 1RXOB 4U3CA 3EWXA 3Q65A 3A47A 3NSNA 3URBA 3HF3A 4XD4A 6XIAA 3VXGA 3ITTA 4N4PA 5CZTA 1UH3A 3M5XA 4DBWA 3ARYA 3R12A 5DLCA 4HPNA 3THQA 2NUWA 4BR1A 2D23A 3GE7A 4GQBA 4S3BA 2HJPA 1RCQA 3M43A 4JY9A 4DJDA 3MJYA 1LORA 4EX4A 3M0VA 4FAMA 1VBRA 1BQGA 2YKKA 1T96A 1KLZA 2G50A 2IPJA 1ZBWA 2R1KA 3GS6A 4H8UA 4AF0B 1AJ2A 1N82A 3ALFA 4XTIA 3MSGA 3C2VA 4F4RA 5M1TA 3W7QA 3LV5A 2BGSA 1F3WA 3A4WA 1Q66A 3PG8A 2DP3A 3OVGA 4WLCA 4B16A 2C0HA 4M8UA 2JQXA 3S2LA 1J6PA 2OKOA 2Y7DA 1H7WA 3RHGA 3SQSA 5AY7A 1KQZA 1FDJA 1W1TA 3W2LA 4IP4A 3CIVA 3HU7A 2FQIA 3PPHA 2JGYA 3POCA 3M64A 4WEVX 3O0FA 3UZYA 1MNSA 3WQVA 3PTMA 1IHIA 1W5QA 4QLLA 1W1ZA 2ZZ7A 1E0TA 2QPSA 4ZE5A 3LRMA 3MVTA 1MVYA 1NWSA 1YW1A 4WGHA 2DZVA 5A5WA 3SCWA 5ABHA 1BQCA 4JTJA 4UXDA 4FR6A 2DSWA 4Y9AA 1ZSXA 2A3AA 3P5YA 5A2AA 3NOYA 1EZ2A 3AMCA 4K1GA 1W8GA 3VC6A 2J8FA 1EGMA 1CECA 4GI8A 2LLEA 4J7RA 4MY8A 2Z1BA 3WDIA 1VLWA 1WZKA 2A7PA 2PLCA 1ZJAA 3HGOA 1JCXA 1G4EA 1TO3A 2FMNA 1K03A 2YW3A 3WUGA 4DZ5A 3THUA 1BFNA 3RM8A 3T0DA 3MA8A 1Z42A 1UBPC 5K4ZA 3THAA 4PTMA 3TMQA 3VIKA 5G4EA 3BPWA 4KCWA 2FZNA 4WUIA 3PJTA 3GR7A 4XSLA 1XISA 3BSMA 2VDIA 1J2BA 4KT2A 2H6RA 1SO5A 3V1HA 2EKCA 2NQLA 1RBOB 3E12A 1IV8A 4IT1A 2JALA 2PCEA 6ALDA 2VFDA 3AYSA 1V3MA 1E70M 1Q4WA 1IEWA 3VOHA 4ES4A 3VLYA 4FI4A 5BU6A 2J7EA 2E6AA 3DGRA 5A6AA 2JIWA 3ELFA 1DWJM 3OBAA 3MQTA 2PDUA 4GQQA 4JNYA 1D3CA 3GIPA 3U6WA 3WLNA 4Q8QA 1MDLA 3ONBA 1OYCA 4GPNA 5CPLA 2BHUA 2ZKMX 2ZIDA 4X3ZA 3VNLA 3SCQA 4UBPC 3W24A 4GC4A 3BARA 1LQ0A 3P3BA 3PFRA 4TX8A 1G7UA 2BGQA 8CGTA 4NSBA 2WAGA 3SW6A 3LX9A 4C6PA 4A29A 2PZ0A 2OWXA 1FH7A 3GDTA 1OX4B 4GK8A 2HDJA 4KS0A 4E6MA 2B4GA 4NT0A 4HNUA 3UEQA 1V79A 4UCGA 4H8VA 5XIAA 1W9XA 3M46A 1H7PA 4YTTA 3M0JA 3SFKA 1ZTVA 3KHJA 4IPJA 3WMBA 1V6VA 3W75A 4UTFA 1VS1A 4W5UA 1XBVA 4RZ4A 3ZVHA 4H9ZA 2ZADA 1KGXA 4W88A 2WC3A 4D9PA 2BB0A 4DJFD 5KMYA 3VCRA 3FGCB 2PCQA 4JHZA 3NGFA 2G0WA 2Y1HA 3WUBA 1SMAA 1ZJBA 2V30A 3MYPA 4RW3A 3OQ8A 1OFPA 3KCOA 3SM0A 3U4FA 5BXSA 2DT3A 3W1MA 4CQCA 2PDWA 1E55A 3H4XA 1K7XA 1UR3M 1LG1A 3M7WA 4UC5A 3FKRA 3WF2A 3BG9A 4DHGA 3VDBA 2WQDA 1RY8A 3G22A 3APTA 4XG1A 5JVLA 3P81A 4GYPC 4HSOA 3OEXA 2XSJB 4F0SA 1XV8A 4FLQA 2PWVA 2VI0A 1JI2A 2ASHA 4MWAB 2V81A 5AVHA 1E4LA 1BXNA 3RR1A 4Q8UA 2X2GA 3BAJA 2GQ3A 3KS5A 2D3LA 4FR1A 4NZ1A 5A6BD 1YXDA 4S3FA 1K4GA 4D71A 3ICJA 3LU2A 4KCVA 4GX8A 4ZCWA 3PBVA 3B9NA 3NPVA 1TZ7A 3LCWA 1D3GA 4F0RA 2ALRA 5G2HA 4KWVA 4HNOA 3DBNA 1LRQA 1UZDA 2JEPA 4FP1A 4L80A 3IK4A 1R2RA 4H3DA 3ZR4A 1G5AA 3W23A 1ICQA 5AFDA 3IPWA 3NAVA 4PCTA 4Q4SA 3OZMA 3MSRA 2OEJA 2WC7A 2JIEA 4K7YA 3SUSA 3ALGA 2ZX8A 4L61A 4CCZA 1NU5A 3WBAA 3BCDA 4PYSA 1H0IA 3U2EA 4CNNA 7REQB 3GVGA 3P74A 3M4HA 2J9ZA 2QCCA 4V15A 3C2OA 5C8BB 5JU6A 3EX6A 2BP1A 3S1WA 6PTDA 3OG2A 1XBXA 3CQHA 3GM8A 2YA2A 4JKLA 1FRBA 3N6JA 2VCCA 3YPIA 4YJ5A 3D3AA 3V5CA 1H5VA 4IUGA 4M6VA 5DRCA 3H7UA 5DELA 4TUFA 2FJKA 3AC0A 4C6QA 1ISVA 1W0MA 3GVVA 4ASTA 5EBUA 3TYDA 1KFLA 1AH3A 1NDZA 4C6LA 3UXLA 3KRUA 2EJAA 3VUPA 4HT3A 4OECA 1XUZA 1L9WA 1RPKA 5I5RA 4CQ8A 2WC4A 1TV4A 1EO5A 3UZJA 2C6QA 4QJ3B 1WDSA 4CLMA 2Z2UA 3COTA 4RXGA 2XH0A 4ICMA 3CUXA 1TA3A 1WCGA 4V2XA 3VLZA 4Z2LA 1VQTA 5D33A 4MUPA 5T8GA 1AZ1A 3NWRA 3OIHA 2ACUA 3EPMA 4JXCA 3RCNA 3B9EA 4LY8A 1SW7A 4Q7BA 2J7CA 1W2PA 1RR2A 1MXDA 1E6QM 1UR4A 3GSMA 5HJYA 3VMOA 3JRKA 4O52A 3NZRA 3QC0A 2YL9A 2X42A 4EAYA 4N6EA 3PTDA 4LYQA 4GO8A 3WH7A 1NWTA 1HKWA 1IR2A 5HQLA 2QXWA 4U31A 3ARRA 6TIMA 2X7VA 1S2WA 2DFAA 4FX7A 5A6KA 2DH3A 4LC6A 4NU7A 4PTXA 5F2MA 5FACA 3N1AA 3TQPA 5HBFA 2QMJA 4O10A 1GPFA 1OF6A 2OWWA 4WKAA 3W28A 5BYWA 1S3HA 3FEMA 2CLIA 2ZICA 4PB3A 3W86A 2BOFX 2DH2A 4HA0A 1F4AA 1HGYA 1J0KA 3H26A 4CNOA 3RJXA 1U33A 1V3JA 3MM9A 3EDDA 4AH7A 5FF3A 5EMMA 4JS3A 1EUNA 3LGDA 4TTUA 4NXSA 5TNVA 4OBRA 1M41A 1J79A 4GJ1A 1JIBA 4QM1A 3H6OA 4KF1A 2HNHA 1GVEA 4M6QA 2V82A 3CZKA 1FY6A 5DBTA 4K36A 1SQ7A 3PHAA 4LT9A 4M7TA 5F4SA 3A64A 3WN6A 1EH9A 4LEQA 2PDMA 4HMNA 3ABSA 4JIEA 2VQTA 4P7NA 4JCLA 2HXTA 2AL2A 3FDKA 4R53A 2DSZA 3POHA 3FSUA 1RUSA 3F4VA 3FJNA 3NJ3A 1H1ZA 4GQGA 1PJ9A 4B2DD 3AS1A 4JTAA 4BF5A 1W1VA 4PMYA 4UTIA 4Z0SA 3RM9A 2PZNA 2R6OA 3GNXA 1M6JA 4GYJA 4ORIA 1U5HA 1X97A 2FVMA 4XK2A 1C7SA 2VWSA 1JZ3A 4G7EA 3QGKC 3NEVA 2RDUA 3DBPA 2V5LA 1S2AA 3ERPA 4HOWA 2NVAA 4HU3A 1K9FA 1JDAA 5KZMA 3IV3A 4TQTA 2PDXA 4J3SA 3RNDA 1WUFA 4JFSA 1TJ1A 4PUWA 2BY2A 3VI2A 2XISA 5DT5A 1FXQA 1V3IA 4ERGA 1KFEA 4IL0A 3W1AA 3B05A 2A6NA 3VKBA 1J4EA 3QSRA 4UNLA 2P8BA 3MCNA 3N34A 4E2OA 2Z00A 4E2BA 5HWNA 3TV8A 1PX8A 1XYMA 1XLDA 1L2UA 4PL2A 1E5JA 4PUJA 3F4CA 3V7PA 3QQWA 3W1LA 2JGQA 3BMVA 4JBRA 1K3UA 3DC8A 3ZZ1A 2VP8A 3F03K 2F61A 5I02A 3BLEA 3PFMA 1I2QA 3GC4A 3BAWA 3IARA 1ADOA 5LGZA 4QS6A 4J3TA 1DTUA 3ARTA 1FWJC 1WAUA 4E8DA 2HEJA 1GTEA 2E5DA 3MY9A 1I9CB 3M6DA 2J8GA 1ZNNA 4AZBA 3W7HA 1FBAA 1MFUA 3AHYA 2VCBA 1W1PA 4OQVA 3LN3A 1KGWA 1JD7A 4AD2A 1W1IE 2J27A 3EWCA 1CLKA 2OFJA 4XUYA 1DWIM 3Q94A 3BQ5A 4H01A 4EE9A 1KXHA 1SO6A 4JTKA 1EPVA 3DI1A 1V51A 1UD2A 2J66A 4BCEA 3S2MA 1L6GA 4QLKA 1ECEA 2IPFA 1XICA 3M0YA 2QYGA 2OO0A 4Q8MA 3B97A 2RJGA 3W85A 2YYTA 3DG7A 3MMBB 3EEZA 1JR1A 4A05A 1XLKA 3AIEA 2CBJA 3M0IA 3KW3A 1VEMA 3MTWA 1FTXA 1OC5A 1NOWA 4UFKA 3S5NA 4RX0A 5TQLA 1TPVA 4A3QA 3K1DA 1XLGA 3G5EA 4I9AA 2WJDA 2OZ0A 2Y7FA 3PBMA 1AJZA 2VGFA 4X60A 5KZEA 3OBKA 3BUVA 1XGDA 3DU0A 5F7UA 1QCWA 2E1DA 1XLLA 4LRSA 1R7OA 1VHCA 1H4PA 5REQB 1EWEA 1BG9A 5TIMA 4LYPA 3RPTA 2WVTA 1UWIA 3S8HA 2E5CA 5E6YA 3HPFA 5LIWX 3A9BA 5IDZA 3S9YA 1YBQA 3H2CA 1RY0A 3FYYA 4KFNA 2WZEA 4BWLA 1SJDA 1AQFA 4IWWA 4J3UA 4PA8A 2Y4SA 4NZFA 2OELA 3B9AA 3HGJA 3LPOA 4AYGA 3MMCB 4H8HA 2ZE3A 1IWPA 3ZLGA 3E38A 5CZ0A 2Z2BA 3VOCA 2PTXA 2XGIA 3G2GA 5HULA 1RQEA 4IIEA 4Q8WA 3BSGA 1DIDA 3UWUA 4EPBC 2GVJA 3QGVA 3T0AA 3WQWA 4Z1AA 1K8ZA 1EJRC 4M1BA 3R11A 1VBGA 1M53A 2AAAA 2R1MA 2QVHA 3GDKA 1R6WA 2KZHA 3BAXA 4UMCA 3DFSA 2YL6A 3LTPA 5I3DA 4QNWA 3FLUA 1OCQA 4M5PA 3NUKA 4GVFA 3BAIA 2WZMA 3NVDA 1G4SA 3TJ4A 3CJPA 3RMEA 3S3GA 5CGTA 3DECA 4FX8A 2X40A 1KBJA 4S3EA 3IV8A 1ZS2A 4I5UA 2NLIA 1M04A 3K4DA 2CLHA 4ENLA 3EDKA 3QW4B 3EBVA 3GU1A 2BFGA 3AU6A 1TPDA 1XCWA 1Q3NA 4MNKA 1XLFA 4MUZA 4DWSB 3DXIA 1M9HA 2A3LA 3II1A 2ABAA 1P43A 3A6OA 3F5JA 3BMXA 1LWHA 4ZQRA 3WFZA 1QNOA 2VEKA 3WBYA 1LBLA 4ZR8A 4LH8A 1KCKA 2Y24A 3W2JA 1HKJA 1OY0A 1SZNA 4F0MA 1JCNA 6XIMA 4KRTA 2GLKA 4C65A 4JN8A 4LVFA 3UG8A 1XYCA 3ARUA 3KE0A 5CCZA 5ECVA 3CPRA 2VX6A 4PSPA 4H7VA 4KWOA 3R8RA 2QV5A 2GSEA 1R2SA 1DBTA 4Z1CA 1H7OA 1ICPA 1TUXA 1V6WA 1C8QA 1V6UA 2X41A 3TQKA 1YHTA 3S5ZA 5LNRA 3A9IA 3EX2A 4D6GA 4UFHA 3VKSA 1WA3A 1XLAA 4J35A 4X9SA 3LM3A 4O13A 1V4YA 1ADSA 1KTNA 4B5TA 3KBJA 3S1XA 1M7OA 1UWSA 3IAPA 1FWIC 2SFPA 3KRBA 3TYBA 4H8NA 5HMFA 2HTMA 4Y2WA 1VYPX 3VK5A 3PANA 3CYJA 1N8IA 1FWRA 5BOOA 3LQLA 1QK2A 3GXNA 4ZB2A 4O16A 1SSGA 2PGFA 2GDQA 3R6IA 3BG5A 1UWRA 2ZRYA 1FP9A 3NQAA 4KQNA 1PV8A 2OODA 5E70A 1KV8A 1V0LA 6A3HA 4DO7A 1EX1A 1L6WA 2V3FA 4HOZA 3CL7A 5CGMA 3C2RA 5D2VA 3NSMA 3ZR5A 3PM6A 1WBHA 3O05A 3VD4A 3QV9A 1B3VA 4JTTA 3UWYA 2C1HA 1B1YA 3HGRA 4IG2A 4C91A 4NL1A 1J5TA 3RX3A 1H7XA 1UR2A 4X0VA 2XU2A 2P0IA 2XSAA 4J3XA 4US6A 1JCTA 4EACA 3R8GA 2XIMA 1F4HA 5HA7A 4MWAC 3AHXA 3VIFA 1H49A 2DU2A 4N9CA 5LIYX 4J40A 4H4IA 4A4AA 1DWFM 3VM5A 3BGJA 4JD4A 3G24A 3W25A 4HQVA 1DIOA 3L2MA 2B7QA 2CETA 4F9JA 1ZAIA 1A3XA 3BCJA 1S1PA 4B5WA 2Q8LA 3B0LA 1KR1A 2ZX7A 3FDGA 3U57A 1XXXA 4CU6A 4J9JA 5JMUA 3MM8A 1UR0A 2GWGA 1CW2A 4FNRA 4PMOA 2WK2A 2E6DA 3WEMA 3N29A 3UFYA 3OLDA 3A5VA 4GUFA 5HMDA 2BXVA 1DVJA 4H6KA 3SJ3A 2I5GA 3NA8A 1CGYA 2GQ8A 1U1UA 2WMKA 3UR8A 4AIOA 1GCYA 3WBXA 2BXYA 4D72A 3CH9A 3T4WA 5DO8A 1CXHA 4NNAA 4LUYA 3DG6A 1VPXA 1JYVA 1ZENA 2YFOA 4GGHA 4XBKA 1VJSA 1OM0A 4WK9A 4JYDA 2AKJA 3VPLA 2YDRA 4YPJA 4AYSA 1WE5A 4QRNA 2YA1A 1Z6KA 2ZUSA 3MCMA 4G2DA 3KL0A 3HMJG 4C6FA 3QY8A 5C2GA 2VFIA 1JGMA 1EXPA 3N04A 4WDXA 3SSZA 5I0DA 4V27A 5E0FA 1JPDX 1W9BM 2G95A 4WQ6A 2X2YA 2NSOA 2OX4A 4P2VA 3PP7A 4G39A 1JAKA 2AL1A 3W84A 1Q65A 4QTGA 3TH6A 2PDNA 4RKAA 1HKKA 3GD6A 1XX1A 3CV7A 3UVAA 1HUVA 3VINA 2ZRZA 1JRCA 4B3KA 4O4WA 1KR0A 4S39A 3N13A 3RAOA 1FCUA 2R9RA 1TREA 1XINA 1UZ1A 2E7FA 4C6BA 4HHHA 3SJNA 1UUQA 3BOXA 1SJAA 1W8SA 1X8FA 3M44A 1NOFA 2QJNA 3N3TA 5D2TA 3Q2DA 3JZEA 1E0XA 1CGTA 1WKEA 2NUYA 4XZWA 1OFRA 1JXJA 3WCZA 4JFVA 1CDGA 2CZDA 5IM51 1WBJA 4UTHA 5GPRA 4ZL1A 4LCSA 1JZ4A 3WK2A 4QE4A 1ISZA 1XS2A 1T40A 2DEPA 1D3HA 1RP8A 2WJFA 1GQKA 4WJXA 3NL5A 4TX6A 5HOSA 4I8YA 1T8QA 1OIMA 4AIUA 2BS9A 2FPYA 4FA3A 2Z1WA 1HO4A 4IOTA 2R91A 1SFJA 2XHYA 1PKMA 5BMXA 4ZQOA 5LNWA 4XBSA 3VD9A 4HHLA 1XLBA 4TR9A 3KRZA 4U2ZA 3IVSA 1QBBA 4MFEA 2ZC1A 3H4GA 3CQJA 1C3FA 2FZBA 3RU6A 4P7OA 4IJRA 2O55A 4F66A 5XIMA 2XFFA 1TWIA 2E68A 4ZGYA 3BE7A 2XWEA 4HZMA 1H7RA 3MP4A 2PD5A 2A85A 3G6MA 4O17A 4B3LA 3H4WA 4GKLA 4GINA 1R3YA 2FZMA 3BLIA 1XBZA 2GUBA 3V18A 3VCCA 2AQOA 2ACRA 1XLCA 5DXYA 4ERAA 3IUIA 2VFFA 1DIEA 3IEBA 3LPPA 4MSSA 3B9DA 1G69A 1OEPA 3I68A 4W9TA 2QIIA 3CMJA 1YNQA 3WH9A 3QEZA 1R30A 4MDOA 1HJQA 2EEXA 5EFDA 1RBLA 5BWAA 3U4AA 4CD7A 4KWUA 4BJHA 4E4FA 1UD6A 5I24A 4FB7A 2W9MA 3EXRA 5CAKA 4NZ4A 3JU2A 4UIOA 4AX6A 3SN1A 4EPDC 2ZXAA 4L4OA 3UJRA 2ZWYA 4LAUA 3MB9A 1UA3A 3LMYA 5H8MA 2CLOA 2P3EA 1KFJA 4REQA 3LA4A 1WDDA 1W1A1 1AJ0A 3AJXA 2CEQA 1HVQA 4AZ6A 1RSCA 2J78A 4TMCA 1ME8A 3IVTA 5HWMA 1BRLA 1QI3A 4PRRA 3BOFA 2WNQA 4JTGA 2D69A 5AOPA 4HJFA 4RZ6A 4PFHA 4PULA 3W2MA 1O5XA 1K77A 3NL2A 4L1WA 4OOUA 2W66A 3D6NA 3H8AA 3NQMA 1RD6A 4X61A 3T81A 3GHSA 4G7FA 1V7YA 4NHVA 2J6XA 1R0MA 3E49A 1EDTA 3AMLA 2KAUC 3AFBA 4L1GA 1PTGA 2YSWA 2YCLA 3GG8A 1WKDA 1K7FA 2R1NA 1S38A 3CIXA 1LOSA 3QLDA 4M3PA 4HZ8A 1VYSX 2ZA2A 3B0VC 4CNTA 3TYZA 5K9XA 3CYVA 2PDCA 1EJSC 3SB0A 1OFDA 2HSAA 5I3IA 2PDKA 4AG0A 4NIRA 4MKVA 1B3XA 4V1XA 1ZB5A 1KBIA 4KPLA 2NX3A 3CPUA 5E0KA 3VM0A 3FA5A 3T42A 2W4XA 4ZODA 3O3RA 5XINA 4N2YA 7TAAA 1F9CA 3HN3A 3WDHA 3PJUA 3UU0A 1BWLA 1W3IA 1TWWA 1TPH1 2PBOA 4GCAA 4GZJA 4PMDA 4NY2A 3CUGA 2FTPA 4LF2A 3TN5A 2GJNA 3S4TA 2ADAA 1O5RA 3QQ0A 5PTDA 2V2DA 4N9BA 4HNNA 3HM7A 4PRTA 3UNDA 5CG7A 1Q2SA 3AUOA 2ZA1A 1BEUA 4LCRA 3KXQA 1LBFA 3MP3A 3HZ3A 4WD0A 1F3XA 3ARXA 4FLOA 1GUVA 3QMSA 1TRIA 3KVJA 2OLAA 4GCXA 5CSSA 2FHBA 3W9ZA 4C60A 1HKMA 1RK6A 2YL5A 3P8JA 3WLKX 2GOUA 1IZCA 3CZLA 1R3SA 4EAMA 3DAQA 3FN9A 3JW7A 1AG1O 2V38A 4O1CA 1EX5A 1EJ7L 4ZO7A 2Q3RA 3IUHA 4RDWA 4HHPA 1E71M 3FIGA 1QXLA 2BHYA 2W63A 4QAWA 1PIFA 1R5YA 4K2SA 3PJXA 2B7OA 3FAXA 4UFIA 2INZA 4NYUA 4MKNA 5FJPA 2V5DA 1KRCC 4OWGA 5FF0A 1EBHA 4Q7IA 3GY1A 2REQA 1NOUA 1AW2A 4L4PA 4DZIA 4G1KA 5GNZA 1GGOA 1JDCA 3WD3A 8A3HA 2I17A 3LRKA 3Q37A 3T8QA 1DJIA 4RDZA 3F2DA 3PJWA 3KCJA 3NQVA 3LCHA 5D03A 1R85A 2AOSA 3PAOA 3NDOA 3MMAA 3UXDA 1HQTA 4CD6A 3VGBA 1MW3A 7PTDA 3UNTA 2IW0A 2VZOA 3ZSSA 4YU1A 5D4YA 2Y7GA 1J96A 4IQEA 5EFFA 3SCPA 1HP4A 1TCMA 3C0SA 4OJYA 5A6LA 4R9XA 1A3HA 3WQ4A 3TN6A 3MO4A 5FF2A 4GVHA 4E2VA 1ZFJA 3AYVA 4DWSC 1T0OA 4POCA 3GXPA 1AD1A 2XIJA 4S2BA 3W53A 1WPCA 4FNUA 1JGIA 3VZXA 4GUHA 2BNJA 1TFVA 1GOXA 1E6RA 2WM0A 3E2SA 4BI7A 2GL5A 4DJFA 2ATMA 3F1QA 4UTTA 1EKOA 4NX5A 3ZVHB 1YXCA 4JTSA 4PB4A 4A2RA 4YS1A 3SECA 2PDFA 1QI4A 3VNDA 3GC2A 1JDEA 4IP5A 4DELA 1DTNA 2PDYA 4IPNB 4U5KA 3DYPA 3C2FA 4F3HA 3CHDA 2Y89A 3WJYA 3QFEA 4CN1A 1YDVA 4LS2A 1F2JA 4HVXA 4QNEA 3P93A 1MXGA 3QGAC 1QU4A 4K1WA 4AISA 4AD0A 4JAWA 4U4MA 4ZQPA 5CAHA 4GI6A 5A6SA 1ZHAA 3BGGA 4A8NA 3DZ1A 2C1IA 1US0A 1K8CA 4M0XA 1OHLA 5A6BA 3PB0A 2J24A 3H7VA 4DJEA 2O9TA 4QEEA 4AWTA 2EPNA 1HXJA 4W7UA 1HNYA 1PDYA 1XWYA 3IWPA 3WF0A 5B80A 2O9PA 3GLCA 4ML9A 3LZ3A 5EA9A 1C9WA 4OIFA 1G9HA 1I2OA 1B3YA 2ZUWA 4HTYA 4IM4A 1LL4A 4J4KA 1PAMA 7ENLA 5FJTA 1OBAA 3I7SA 2EPHA 3JR2A 4QJ1A 3WBEA 5U4NA 2EBNA 1B57A 5M17A 4RK8A 5D09A 1PKYA 1A49A 2VGIA 4GIEA 1UR8A 3TZNA 1JQXA 2EKGA 3GO2A 1G0CA 4HPXA 2PLKA 2DZTA 2V63A 3MC5A 5CLTA 1QPKA 2FGZA 1A5NC 3MJMA 4U33A 3IANA 4PCPA 3TTEA 4O14A 3ARSA 3ES7A 4HD5A 4CCDA 5K3VA 5EL1A 1XYZA 5GJNA 3QR0A 4RXFA 3UWZA 4HCLA 2FPVA 4IXHA 4XD6A 4GY1A 4PSRA 5AHFA 1JYWA 1JUKA 1KKRA 1OCBA 4IGHA 3L66A 1U5JA 1JQVA 2QCDA 2VUNA 2XVNA 2PMQA 1BF2A 1OK6A 3UCDA 4CGTA 1LLWA 4J2PA 3WF3A 2QUMA 5A2CA 3I4EA 4DBDA 2OGYA 2XTKA 4JQ1A 2RGMA 3CUJA 1UJQA 3QZEA 3VOJA 3AYTA 2IKIA 1MZRA 4DB7A 3OTRA 1ONEA 2J8TA 3SY5A 5BW6A 1EIBA 3FV9A 2VFHA 3E0IA 1W32A 3SRDA 5DEZA 2W92A 2Z1VA 1EJXC 3CO8A 3IS4A 2IS7A 2ZXBA 1TA3B 3GC5A 3N4FA 4AY1A 5ABEA 3IVUA 4QFUA 1WNOA 1SZGA 2YZRA 4JQ2A 1W3NA 3T08A 1J11A 4W8BA 1WOAA 2BZNA 3MZ2A 2R82A 1OX5A 1RBAA 1XIJA 3TONA 3SSJA 3LHYA 3LEPA 1XP3A 3QFWA 4L9ZA 2GDUA 2XZ9A 3FJ4A 1MXSA 2TPSA 4JDYA 3MYOA 2D3NA 4MY1A 1AK5A 2ONEA 3CO4A 3N4AA 4S3GA 3LSBA 1O60A 1DJGA 1CNVA 1XRVA 3IK2A 4Q4OA 2DZPA 4YVXA 4XZIA 1TB3A 3HQOA 4E5TA 4GXPA 2PBGA 3N19B 4ZOCA 4BEUA 4N0RA 4LYKA 3TR9A 3KVLA 3GIYA 2WOQA 3G8EA 1VCFA 3RO6A 3VILA 3KOYA 3PR2A 2C79A 4XX6A 1KFKA 1JJKA 1VKFA 3UR7A 1IEIA 3WLIA 3TW9A 3RK8A 4EIVA 3H54A 4UNKA 1O12A 4QCEA 5DQPA 1H41A 4F79A 4C6IA 4Y8FA 3MM9B 4MF4A 3ANVA 3IJ9A 4XVEA 1Q6OA 4JTRA 4X2PA 2JKAA 3BAKA 5F1UA 2OX1A 1NFPA 3RR4A 3A3HA 1D8CA 3EDFA 3AIQA 1ME7A 3QR1A 5BXRA 3W81A 4C6MA 3IJ6A 2F9RA 4H9YA 5IBXC 5A8OA 3WYZA 4HBKA 3AIVA 1TV3A 2P88A 1MW2A 3VLXA 1MEIA 3JUGA 4FLRA 1OYAA 2AL2B 1R9ZA 4B2DA 2E25A 3GUWA 4G1NA 1LROA 4LVAA 1B4EA 3CAVA 2Y88A 1R47A 1GYLA 3BWWA 3KFTA 4PTNA 1EZWA 2QW5A 2HWGA 3B9OA 5AC5A 2DQWA 3TSBA 1ZLPA 2O92A 3GEOA 4W85A 2Q71A 3ITCA 3WLMA 2ON3A 5G2WA 2CKRA 2PS2A 3OW1A 4NZ3A 2TMDA 4G7EB 1UROA 3LXAA 3VZYA 3T2OA 4ZO8A 1E1EA 2FHFA 1WXYA 1AODA 4XTDA 1MEHA 3CL6A 1LG2A 3QPEA 3VKTA 3K4WA 4GJIA 1JYXA 1Q4NX 3W1QA 3TWAA 4X0NA 4K8HA 2ALDA 1GOKA 3HURA 5JIPA 4AX7A 3TQVA 5LKYA 3GXIA 5F4WA 4CN6A 1UIPA 3PULA 3WL0A 1VZWA 2HS8A 3GWQA 1FA2A 3F5KA 4YL2A 4RL3A 2A5HA 4AU0A 1RVGA 2NT1A 3APYA 2G97A 1H7NA 3EB4A 2EO7A 3HFTA 1YIXA 3UG5A 3E5PA 1LOQA 3GG0A 3MANA 4CQDA 2PF0A 3KOZA 4EPKA 5BOEA 3AAMA 1CB2A 1X8CA 5IXEA 1K9DA 2PC4A 1PS9A 2UV8G 4W87A 4YWSA 3SY8A 4DIAA 3B8VA 3TWBA 2WPGA 4LY4A 5D2XA 3EDJA 1A47A 3VTRA 2ABBA 1OC7A 3KVMA 3IAQA 1L6YA 1T7LA 3ITYA 2VURA 4TXEA 3TCSA 3D5HA 2YJQA 4PCSA 3S2CA 1OFBA 1BYCA 3CU2A 4JOMA 4AZ5A 5CC6A 1EB3A 4DUXA 2WWCA 2VOMA 3LBCA 1PBGA 3U0HA 1EJVC 4IMEA 5EBAA 3ZSTA 2ATSA 5AB3A 4IIFA 2ISDA 2V5BA 5F2LA 3IJQA 3E5BA 2QGYA 5I06A 2FTWA 4JICA 3NQ7A 4AZCA 1YKWA 3MUAA 4LVDA 3KBNA 2WHKA 3VD3A 5SWUA 4TVDA 3ITVA 4P8WA 3PPFA 3T05A 4AOPA 3MP5A 4LYRA 2OYLA 3M47A 3HJEA 3WNMA 4DJDC 3CHEA 1I0BA 2G3FA 5E9XA 4M24A 3SFWA 4A3HA 4CNUA 1VR6A 1XC4A 4ACZA 2DT1A 1RZMA 4B4HA 1EJTC 1KO0A 2Y5JA 4IH3A 4M82A 1Q45A 4C6JA 3AS0A 3UZXA 5BCAA 5D9PA 2OTDA 4UWMA 3C5QA 5T91A 3FSTA 2Y5SA 3MW7A 1WDRA 3QC3A 4IPLA 1XH0A 3EWUA 4R7JA 2TRSA 1FX6A 1Z89A 3AIUA 1JDFA 2V3EA 4DAFA 4DYJA 1ZQ5A 1V6TA 5FJJA 3W74A 5I00A 1K8YA 2VFEA 2BSLA 1EP1A 2Y85A 3LDVA 3DDMA 4JFTA 4OT7A 4GUGA 2O7QA 2OPJA 3S42A 3TIMA 5GQBA 1YBQB 4RDYA 1P6CA 1W9VA 3VABA 4EKJA 1CXKA 4CQ9A 5CXPA 4UR8A 3S9IA 2VMFA 4M80A 3W7PA 4PMVA 1HL2A 4MNLA 4H1ZA 4JQAA 4H00A 1EIXA 2XVPA 3INPA 5A8QA 4L9XA 3ZJ8A 3WEOA 3QM3A 4INFA 4AZ7A 2AGTA 5I07A 1A5MC 3WKZA 3ISIX 3WLRA 3GHTA 3NEHA 4FNQA 1EQPA 3CQ0A 3BO9A 1JNDA 3KDOA 4MY9A 3HJZA 1TRDA 2BLEA 3NQFA 3LCLA 2OQHA 3G3DA 3PZOA 2IKGA 3LLFA 5LNSA 3N2MA 5MKGA 3NO3A 2INFA 1YTKA 1BXCA 2FHCA 3EWBX 4W4QA 3N11A 5I23A 1TR9A 4LW7A 1SO4A 4PMXA 3W1RA 3SEPA 4KEVA 2Z1XA 3ATYA 4PODA 2BX7A 2YDQA 1LF1A 3CAWA 3GTIA 1RHCA 1UD8A 3U7VA 1CENA 2Y62A 5D38A 2DORA 3WQFA 2JFEX 1T99A 3H2OA 2BHZA 5FSDC 5HUOA 1FHDA 2CZVA 4BK9A 3QKZA 4R3UA 2V0TA 4AZIA 5ENLA 4D1IA 3WJXA 5LYRA 3W76A 3FX4A 3HPXA 3TJIA 2H9AA 2GJXB 1RCOB 2BY0A 4LWWA 3UR2A 4U3AA 3CH0A 3QY7A 3NQ2A 2NWRA 1J0HA 3QF0A 1E72M 1DYSA 4NNBA 5JQ9A 1Q8AA 1V0NA 3DFNA 7TIMA 3WH5A 4AIEA 4AW7A 2IQ0A 1DEDA 1JZ5A 1B0IA 4S3AA 1EJUC 3W83A 1TKKA 4Q7NA 2I9UA 4MM1A 4R33A 1DJYA 3GXFA 5AHLA 3WD4A 3ABXA 4LALA 4J3WA 2YLAA 4WZHA 3AS2A 3UVIA 3VD5A 2HK0A 3PZNA 3VMPA 3L4TA 1KC7A 4QGCA 3VKRA 3MKVA 3KZSA 2I1OA 3L0KA 1WXJA 5FAJA 3S1GA 5F2IA 3LHZA 3GH4A 3BW4A 4NJHA 3MM6A 3BANA 5DX7A 3W72A 1CYGA 3V75A 2C14A 3ABOA 4LVGA 4PMJA 3P2VA 1YLVA 1EO7A 3BJSA 1UKQA 1MUWA 2NXIA 2DZUA 2Z7KA 2YYUA 5BRPA 4TVUA 4AFYA 4C1KA 4O1AA 3AZRA 5HJXA 1O95A 2VOTA 1VF8A 4RZ5A 1ML1A 1QI2A 2GZXA 4AWSA 1S3TC 1ZZMA 2Y8UA 1FUYA 3W1XA 3R13A 3K2GA 2QUVA 4ADTA 2PURA 1TPB1 3LHVA 3QSTA 3LGEA 1KW1A 3NFUA 3H12A 1IWAA 4RCXA 4Z0JA 3FYOA 1D7KA 4A6GA 2ZTJA 2BOEX 1Y0EA 1AL7A 1DHPA 2OLHA 3DHPA 3W7KA 3LQGA 4QE1A 1FDYA 5AKQA 3KBSA 3LTSA 4BS0A 4XAGA 2CXEA 1AA1B 4HOXA 4EXBA 4IICA 3BC9A 5CEWA 1UC4A 3BLDA 1SW0A 4O57A 5D9OA 4IPPA 2HVOA 3W27A 3B06A 4ORMA 1LRNA 1YNPA 1KRAC 4JHOA 1K8XA 5M3WA 3EXSA 5AYZA 4B92A 5DF0A 1CXLA 5BXPA 3NM3A 4RDVA 1PX3A 5LA1A 2PFHA 2QCEA 5BWFA 4IMFA 1DE5A 1YPIA 2FDSA 3AHTA 1KKOA 2A4AA 1W3LA 2WVSA 3MM8B 1H62A 1WV2A 3E3HA 4DI8A 3S5YA 1OFAA 1JD9A 3NQDA 3S83A 1LP6A 1LM1A 1GEQA 2P53A 2YB4A 3B40A 2YGYA 3QHNA 1NDWA 2BMBA 3GKAA 3TYUA 3V3WA 5TAOA 2X1TA 3QV6A 4UTMA 3ME3A 5HJLA 3H2AA 3BMWA 1TTQA 3RU8X 1ISWA 3W07A 4GVIA 4R5EA 2W3ZA 1S2CA 4ECLA 1RLDA 3VIPA 3QV8A 4PEEA 3BG3A 3VNYA 4K39A 5JUVA 4PUEA 1UKOA 5EY5A 4IZGA 3UZZA 1EHAA 4TMBA 3PPGA 4DY1A 4AVNA 4IGNA 1KRBC 3LI1A 4AD3A 1EF2A 3LHUA 3UP8A 3IIVA 1FWCC 3VIIA 5C9UA 5LXXA 2FJUB 1MQQA 1VGAA 3VKCA 5H1WA 3PBGA 4JQ3A 3GFYA 1KQYA 4WY0A 9RUBA 1KWGA 3KOFA 1JPHA 5HNNA 1OIFA 4UZSA 5LXEA 1FWSA 4FXRA 2A3BA 1P7TB 4O8AA 3SGZA 2OR2A 5I09A 1CWYA 4PGLA 1IIHA 5LA2A 3TXZA 2C19A 4MOZA 1M7JA 5FL0A 4AB4A 4XBJA 1QK0A 5A6JA 3GH7A 4KRUA 3SN0A 1H61A 1BTMA 4ZTXA 4HA4A 5AC8A 3MUCA 3N6QA 1Y8BA 4Y9NA 2J9YA 4JTLA 2OSYA 4KWSA 2P50A 3EA1A 2QDEA 3WLQA 3FY1A 4S1FA 2VC6A 1Y65A 4GQRA 4BF9A 1ECQA 3NXFA 1M65A 2OWCA 3UWWA 3KS6A 4FIRA 3WLHA 2CFFA 1A80A 3PWIA 2Y8KA 2VL4A 3RRXA 2PWDA 3HGSA 4XZNX 2Z6JA 3W1UA 2HVNA 1VH7A 1W37A 1UASA 2PTZA 3NPXA 4MB3A 1QNQA 4QG8A 1PEZA 1HN1A 1XJBA 3OHIA 4GYFA 3R58A 4LBUA 4TV5A 1XBYA 1GWJA 2ICSA 5A6TC 1PWLA 2PA6A 1GZJA 5FI8A 2AQVA 2DIEA 3NQ8A 4JGDA 4QDMA 1IXQA 2OEKA 1CI1A 2DGAA 2WHMA 3ZVIA 4AVOA 3R7MA 1A53A 3WFLA 3A13A 1FWNA 5AC6A 2JE8A 1OZMA 1RAKA 3UY8A 4XD5A 3CV6A 1IEXA 1FCVA 2FIQA 4MJZA 5DCDA 1QPOA 3TW6A 4UR7A 5LHEA 2ISWA 2WCAA 1S2UA 5ECUA 5D9MA 3AIRA 1DKWA 3KOWA 3A4XA 3PF3A 4O15A 4XB3A 3TFXA 3TKFA 4H7CA 3KM8A 2DZAA 3AJ7A 2WCGA 1O1HA 3M0LA 1H60A 2YW4A 4DUWA 4Q32A 4ZFMA 4JX6A 1MUMA 1IGSA 1UUMA 3WQPA 4ZENA 1BXBA 4BZYA 3BOLA 1CLXA 3S47A 1UKSA 3N14A 4LXFA 2NQZA 3N3MA 1OX4A 1NP2A 4BQ4A 2Y2WA 3W70A 3B04A 1UCWA 4QEHA 2GGEA 3AXMA 1VFUA 1DL3A 1ONXA 1FWHC 4ZSTA 3EKGA 3PZQA 1BYAA 2VR4A 3NVTA 2GPTA 2V67A 4Z2KA 3SR7A 3P67A 3W4RA 4PN2A 1SFLA 1JCMP 5EU9A 3T1GA 3GVQA 1X96A 2UZ9A 4GY0A 1EYEA 4IISA 1V77A 2DIJA 2R14A 3GDRA 3W26A 4RNHA 2DUZA 4LRTA 2EF9A 4D2JA 3N2BA 4REQB 5M03A 1QT1A 3GQYA 3CEPA 1E1CA 3NXLA 4XAZA 2AOPA 4OUEA 3AZTA 3OR2B 4S3CA 4TTGA 4XIAA 1HP5A 5M2FX 1UQYA 1NWUA 3N2CA 4G6CA 3MUY1 3QHOA 2DDXA 3T55A 2CNCA 4PL1A 2XIBA 1AFSA 3K8LA 3C3NA 2D2JA 3TMLA 2RDTA 1BG4A 3N12A 2IPWA 4XIMA 4L4LA 3SIZA 4UZUA 5G4WA 2UWFA 2YCLB 3KDNA 1DJNA 1WDWA 4EK7A 2HRWA 1VCGA 4XWUA 3CUHA 1A5OC 3BSHA 1JEZA 1YADA 3W7IA 3G1HA 3OVRA 4YXGA 4XKYB 1ITCA 1E73M 3G1DA 3I7QA 1VBUA 2OG9A 3CNYA 2NSXA 3I4KA 3KCLA 1WKFA 3GH5A 2ZC8A 3A4JA 4EANA 2CZEA 1UD4A 2FH8A 3OODA 5FCZA 1AZ2A 3MI2A 2QMKA 1JZ8A 1EEXA 3H21A 3TUUA 3JZUA 1UA7A 3CIWA 6REQA 3QVQA 5J8LA 4Q8PA 5D2YA 1Z8AA 4GD0A 5BU9A 1N8FA 2ZYFA 4YN5A 1F61A 1G1YA 2GWNA 4WHBA 3QYSA 4MB5A 5H8UA 1UZHA 1XR2A 3I6EA 1BVWA 4CEXC 3DKLA 3WBWA 3SRFA 2ZFAA 5FA5A 1US2A 2WBKA 5C2XA 1TSIA 3A3XA 2PRLA 1XSJA 4HJWA 1N2VA 1ONWA 3UXIA 1B4KA 5IHSA 1C8VA 3RLGA 2ZDRA 4KIRA 4PTDA 1HF6A 5FSEC 1LRTA 1A0CA 1TE1A 2V3DA 4XO6A 3IGHX 3GZ3A 2XZ7A 4C6OA 2WMFA 3RG6A 4BWLC 4NI8A 2G3NA 3S2JA 1PZ2A 4GUJA 4JDBA 3LXCA 3M9YA 2J9XA 3QW3A 1QOXA 2P1FA 3T6CA 5BOFA 3F2CA 2PC8A 2XFRA 4GHRA 3TTSA 2BGNE 4UQBA 4ZBCA 1IEVA 5AYIA 2WNNA 2FVLA 2OZ8A 4X9YA 1JUEA 1VRXA 2UBPC 1GG1A 3TYEA 8XIAA 4R34A 4AMCA 4ZVJA 2REQB 1I6NA 2NQ9A 3R8HA 3NZQA 1KFBA 1R2TA 4AHQA 1E9IA 4ICCX 4Q4PA 1GQJA 3SDOA 3VIOA 4J2MA 1WP6A 3L0GA 3T07A 2VRQA 2ISSA 3W2NA 1NQ6A 3PAJA 1SFSA 3BLFA 3WQ6A 3WQ8A 3MMAB 2Z1KA 2ISFA 5CBIA 7ODCA 1NDVA 1XG3A 4FXSA 1FP8A 3HTWA 2GYIA 1P0EA 2VC7A 5A8NA 4Y90A 5E9AA 1C8YA 4PTWA 1E9LA 5AECA 3DYOA 1SR9A 3MHGA 4DF1A 1R46A 2FGBA 4GIRA 2CCRA 2WMHA 4DBSA 3P8IA 2PWUA 3MMDA 4UOZA 1J12A 4RR4A 4L56A 1KM2A 2NW0A 4MMWA 3RUBL 4LB4A 3L12A 3W7MA 4ZOAA 4KGJA 2EG6A 1XD0A 1IGWA 2R8WA 4GG9A 5D05A 1EDQA 3MPGA 4Y8EA 1FCQA 3ZT6A 3L5LA 4CCEA 1PL9A 2V4JB 3UY7A 2VUYA 3AXHA 3HG5A 2FB3A 5ABFA 3MUIA 1OB0A 2VEFA 2OQLA 3MV11 3GAKA 4JL2A 1GNXA 1EHNA 2CXGA 3XINA 1G67A 3U3HA 4UTJA 4Y9MA 5U7SA 3M0XA 3WLLA 3GBEA 1WKYA 2WKJA 4QS5A 3TN4A 3KZPA 3KHDA 2QDGA 3LRLA 5C9WA 3NNTA 4B5UA 2YDSA 2J79A 3OZOA 1EC9A 4UFJA 1DOSA 3N2OA 4D8LA 3AMKA 4I5XA 2DIKA 4YHEA 4P8UA 4DO6A 2ZRWA 3B8IA 3EAUA 2CBIA 3U2CA 1ESWA 2Z2AA 5FJIA 1A5CA 1UR1A 5LIXX 4LTSA 3WLSA 3M5ZA 4K8GA 3MKKA 4C1NA 3QYQA 1W5MA 1YRRA 4KWWA 5CBJA 1BVNP 3AWOA 3DG3A 3TC7A 3SO7A 5H2ZA 1KRMA 4RE4A 1IZJA 4LS0A 4IXXA 1AMYA 3GNRA 4UQAA 1NP0A 1QDSA 2WHLA 4XO7A 1I2PA 5EKYA 2PDGA 4DPQA 3QQ1A 3G0UA 4DPPA 1LJYA 3QLLA 4P7RA 3LBOA 1ZAHA 2VTFA 4CD8A 3ZM8A 3E0VA 1WQ5A 2Y6ZA 3CLWA 4FNPA 3A12A 2EHHA 2YXXA 1RQHA 4DXKA 4HU8A 3WDJA 5HAOA 5EMLA 5HATA 1CZ1A 5C6MA 5CLWA 2EXOA 3PTKA 4GIYA 3OR1B 3TX9A 2P0OA 1V0KA 5EMJA 2C7FA 4Q33A 4QDPA 2XINA 1Z7AA 3WEZA 1H63A 4IX0A 1WXZA 3MM7A 4OV4A 3DHUA 3KBVA 1HJSA 3VM7A 3H53A 3MI3A 3C6CA 3EX1A 2F8QA 2PP3A 3LPFA 4HPJA 4S3DA 4B5SA 5ABGA 2I5IA 5DMYA 3ANYA 3AU2A 4MJ4A 4B15A 3B0NA 9XIAA 4LVBA 5I03A 1MQRA 3VNIA 1VENA 3T0TA 3CGTA 4JN7A 3OBEA 1UWUA 4GI4A 1ONRA 4CVUA 3R43A 3M5YA 1OSEA 3LXBA 3KBMA 3N25A 3DENA 3JVAA 4JTEA 5I2UA 3ABZA 4GISA 5KZDA 3PZUA 1GW1A 2C15A 2HQAA 1QAPA 2OVLA 1EA9C 1VPYA 1H51A 2XGBA 1R8LA 2PU1A 2PTDA 3N17A 4C6EA 4IMCA 5DFAA 4CEUC 3WELA 1XRFA 3GXTA 1VHNA 1GKQA 1XI3A 1LT8A 2ZUTA 1XD1A 1RP9A 4A35A 5I77A 4XZ9A 3P82A 2C91A 2VM8A 2BXZA 1W5OA 5GVJA 3O6DA 2PGWA 1JFXA 2PDBA 4DXVA 2Z7GA 4PBGA 2PLJA 4LNYA 3GZAA 1Q6GA 1YX1A 1BLIA 2BY1A 1GVOA 1EWDA 5JH2A 3RX2A 3QOMA 1SJBA 4A21A 1B54A 1SZEA 4ZMGA 2GGGA 4NAEA 4K6AA 1E6NA 1L2QA 1U1HA 1FDZA 3SADA 2JF7A 1HJVA 4JTCA 2V5CA 2FB2A 2UY3A 5B7YA 1OGBA 3AS3A 5E6ZA 3LCIA 8RUCA 2XG9A 1QNSA 3RN6A 3TYAA 4DNMA 4D8ZA 3MSYA 4HN4A 3GIQA 1KNWA 1XIDA 1HFBA 2WXDM 1E3ZA 4QSFA 3I6TA 5H91A 1F76A 4ONVA 3D46A 5JH1A 1WX0A 1GOMA 4O1FA 4HHMA 4GLEA 1FHLA 4HU4A 4WIWA 4DYKA 4LBRA 1R3VA 3ECQA 2PGEA 1TPEA 3UR5A 1QNRA 2AGKA 2DUXA 3L4UA 4EF8A 4HCDA 2MUCA 4WKHA 4QXIA 5DMLA 4NJJA 4UQEA 4M6UA 3TXVA 2NQJA 1LWJA 4W7VA 5KTLA 4UQCA 2NXHA 4Z17A 3R25A 4DXXA 5D37A 3T9PA 1JDDA 4NRRA 1XIGA 4CD5A 1E0VA 4MAVA 2QV4A 3BZGA 3M07A 3FAWA 2BVDA 1OVDA 5C71A 1ZBCA 1J0YA 1QHPA 1D7FA 1TR1A 4IMDA 4E0CA 3HQ1A 1EBGA 1REQA 2OZTA 3E0WA 4AEEA 1YXYA 1SU5A 1XRTA 2ZUNA 3OVQA 4IPIA 1MSSA 1S2VA 3QBUA 2RGLA 3EOSA 4LV4A 3ZYZA 2F6UA 5EYWA 2I7GA 4PE8A 2FFIA 1CEOA 1JL8A 3DX5A 4NJIA 1X98A 1LWIA 5G1YA 1BF6A 4MYAA 1FHUA 3F7JA 3ZJKA 1E0UA 4GZEA 1OG0A 4HIBA 1JCJA 2HROA 3PY2A 1VFTA 1HW6A 3CHFA 1DJXA 3VE9A 4Q4QA 4H41A 3DHDA 3QPZA 4WDTA 1T6MA 5FL1A 2HMCA 1JULA 4XAYA 2ZX9A 5FF4A 4C5YA 4F48A 3HBLA 3UCCA 1UG6A 3VDCA 4B9YA 4URIA 2D20A 2D2OA 1W3KA 1B3WA 3RO8A 5AYXA 4OUIA 3AMDA 3EKLA 4LX4A 3URAA 4GO9A 1ME9A 4X2RA 4WJEA 1C91A 1Q2RA 1CGVA 1JI1A 1I1XA 2BDQA 2QF7A 4WSKA 2VR2A 1Z32X 2NX9A 1LLOA 3L67A 5HR7A 2CWNA 3B0YA 3ITXA 2WPBA 3NZGA 2ZRXA 3MWCA 8TIMA 3RLHA 2OXNA 1E56A 3CMFA 4Q3MA 3D0CA 5C7HA 1ODZA 4AZCB 3AHVA 2GGHA 5M5DA 2DJLA 1ZJIA 1ZCOA 3RMJA 1IE7C 3FS2A 1V7AA 3VNKA 2FTYA 4KFOA 1B31A 2CESA 2DV0A 4QISA 2JEQA 2PWEA 1LYXA 2QF8A 3FJ6A 2HISA 3AHZA 1M01A 3I3DA 4NRSA 2J62A 4XZHA 3APGA 2J7FA 2VZSA 4RE3A 3SGUA 2CZFA 2PDJA 1DXFA 3EWDA 5KINA 1VPQA 4US5D 3OHMB 1H1YA 3ONCA 3NQBA 5DN1A 1OK4A 4AD5A 2DJXA 4RZBA 5HQEA 4DI9A 1TELA 1XCXA 5JBFA 3UJFA 3DUGA 3S9ZA 3N9SA 4ZXOA 2GVLA 1JZ2A 3TVAA 3GFXA 3H7RA 2O0TA 5C2CA 1KM5A 2CERA 5AZ1A 1F3EA 4HPHA 3P5ZA 1JXKA 2YX0A 3VKAA 3SAZA 4JCMA 3PVFA 1DIKA 1QO5A 4GJJA 3W6LA 5C9XA 1YDNA 4WXZA 1XIBA 2VQUA 4L6OA 2HS6A 1HO1A 1TPC1 2X1UA 4D6EA 1J18A 3BVJA 1FKXA 3XIMA 2XN1A 5A1AA 1U83A 4O11A 3WIJA 4GKTA 2ZWZA 3HFYA 1ZP4A 4I3GA 3MUXA 2VC5A 2O4QA 3WF4A 3WSUA 4QX4A 3CHVA 1TYGA 2JKPA 3LCXA 3CWNA 9XIMA 3WNPA 5D8WA 3UYCA 3IIPA 4TOQA 3WX7A 2DW6A 5FESA 1QPRA 4K37A 1E51A 2P5NA 5I3HA 1QATA 3CPGA 3NTYA 2QKFA 2J7BA 2ZE0A 3LUTA 4HSNA 4ADSA 3SCOA 3TNOA 2J75A 1YNYA 4IP7A 2IKHA 2QR6A 2ZXQA 2QQ6A 4FSAA 2POTA 2XIQA 3IACA 1UZ4A 1AVAA 4CQAA 1RD5A 4WX2A 3WQGA 1PXGA 3WK1A 1N55A 4Q8TA 1FFRA 3WO8A 1NF7A 3EGJA 3R89A 3WK3A 1HJUA 3A4AA 3GRIA 1O68A 3VO0A 4ATDA 4IJBA 2Z29A 3DYMA 4ZOEA 3V5FA 1IXPA 4CQBA 1IT7A 1NEYA 4MB4A 5DY3A 4LUSA 3K30A 4L65A 1SW3A 3IIXA 1DXEA 5EGRA 3CQIA 2YPIA 1NFGA 3AOFA 3L5AA 1W5NA 4LSBA 1PIIA 4XUGA 5IBXA 4AZGA 3AALA 3L4WA 1GPWA 2H9AB 2Q09A 3F2BA 3WD0A 3OPSA 4KMQA 1AL8A 4J3ZA 4QCFA 1QPQA 2IXVA 3C8FA 2CLEA 3JS3A 1IXOA 5I3GA 4AEFA 1JRBA 4RNFA 5CKSA 1QW9A 3SCUA 5D04C 1ZCCA 1UWAA 4ZQNA 2RDWA 4MB1A 4G5DA 3OJGA 3NCOA 3W02A 4O19A 1GQNA 3CC1A 1AQHA 1CLVA 4DLMA 3M0HA 5C7VA 4BA0A 3DKJA 3PUOA 3MZNA 3T0CA 3MMWA 1K9EA 2VRJA 4Q8OA 5IFPA 4CUCA 2XH2A 3WL1A 2KX9A 5CBBA 4P61A 3MM6B 1JCLA 2BVYA 1FWEC 2DZSA 1UOKA 2VXNA 5HNTA 3ZXWA 2C16A 1QWGA 1OGGA 4ROQA 4DJFC 1XFBA 4MFDA 2QDDA 1NTHA 1V02E 3HG3A 2ESCA 3ZLFA 1MYRA 2C1GA 1VC4A 3T2PA 3W1PA 1RALA 2E4TA 1RPXA 4J1OA 1G6CA 5HQMA 4LOCA 3C3UA 3CT2A 1P1MA 2XIIA 1PPIA 4IIBA 2CBUA 4UOJA 1L6FA 3OZPA 2PP1A 3LI0A 2QULA 3DFTA 1YYAA 2X1SA 5AVNA 1KM1A 2JK2A 1G4TA 4QQUA 4A2SA 2QCMA 2CU0A 2J7DA 4OOZA 4A3RA 3NGJA 3HOJA 1DQWA 4H9MA 3S6OA 2ZCGA 1K6WA 2E8ZA 1E6XM 1WB0A 4IFKB 3U48A 4YIWA 1DE6A 1ZP3A 1POJA 4AD1A 4QDWA 1JUBA 1KWKA 1XKJA 2E3ZA 4UOQA 4AY7A 5D8ZA 3AZSA 4DJEC 4I7UA 3KWSA 1DQXA 4QP0A 2X1IA 1TV8A 2X30A 1BD0A 1GQIA 4DUVA 4GNVA 2ZXDA 3U8GA 2WZTA 1GYMA 1XM3A 1UIOA 1XGEA 3T8LA 1M5WA 2VDHA 2G3JA 3W7EA 3AROA 2TAAA 3DEQA 4IMGA 1Q63A 4JNZA 4QQ3A 1ADDA 3P80A 1YMYA 4GI9A 2POZA 3MHUA 2B81A 4PTVA 1VBHA 3ARWA 1F73A 2Z25A 4H7ZA 1PUDA 2XN0A 2ZVRA 2DVUA 1DHKA 1KXVA 2PUZA 3NYDA 2ACQA 3ZO9A 1EFZA 3EOUA 3W1NA 1GVFA 2RH9A 3BH4A 1YDYA 3W71A 1KM4A 3ARQA 3C2YA 4NILA 3GU2A 1RJRA 3KLLA 2XSBA 3LHTA 2W91A 1PTAA 3TTQA 3Q67A 4Z42C 3L4VA 2WMIB 3VKDA 5HDRA 1XSIA 2DVXA 4YHGA 5HANA 1OT1A 4HNTA 3MSDA 1FCBA 3FA4A 5E0CA 1CIUA 3W01A 1TTJA 5KEZA 4JR5A 3E9AA 1F8MA 1UC5A 3MWAA 4CCCA 3DH7A 4LCQA 3T7VA 1EJWC 4UFLA 2D0FA 4LANA 2WSKA 1RLCL 4WY0B 4HYWA 2GUUA 4C6KA 5CJ5A 1X39A 4L6DA 2FKPA 4J27A 4O0QA 2HBXA 2QEZA 3FW6A 3MVIA 1HKVA 4U2YA 3FJLA 2D1ZA 3WLOA 1UPPA 1FOBA 3ZJ7A 3T40A 4ZXLA 3UESA 1A5BA 1OCNA 4UQDA 4ZQMA 4G9PA 3CL8A 3H55A 4AVFA 4Z08A 3EA3A 3RRAA 1YPXA 1YTDA 1E4IA 3RM4A 2A0NA 1XC6A 2E9BA 2E1WA 5FJOA 1EPXA 1RQBA 1D2KA 3B8UA 4JQ4A 2CLKA 3ZT7A 3GKFA 1US3A 4MADA 1TMHA 4GE8A 1Q5MA 5E5CA 1AMKA 4OHQA 4OE7A 3NQGA 1SFTA 1BKHA 3WJZA 4CU7A 3O6CA 3CXOA 1SPQA 2R1PA 1WZMA 3CLMA 4X22A 3MO7A 1XIFA 1Q6RA 3IJDA 1EP2A 1XCFA 3M5VA 2WQPA 3L4ZA 3OIXA 3W37A 1H11A 4K7VA 1X1OA 1KLYA 1TPFA 1IT0A 2PRMA 2ZVIA 3CMGA 5DANA 1T41A 3PUEA 3P84A 3WFAA 1Y7VA 5FEXA 1V8EA 5K2ZA 4HK6A 1W9UA 2A1YA 4UR9A 5CPTA 4AY8A 2VVNA 4D6HA 3VA8A 4QAIA 2OGJA 1OT2A 1X38A 5LNUA 4UNIA 4ZA0A 1IYXA 3MBDA 4GIAA 2FMOA 1GZ1A 1A0DA 3PTQA 4JTIA 3GK0A 3E1F1 2EGZA 1F3TA 1O5QA 3MI6A 2I56A 1LZOA 4BI5A 4NAFB 1JCYA 1ZGDA 3OGSA 2QNEA 3B0XA 4FPSA 1K4HA 4PUMA 3CT7A 3ZS4A 6CGTA 1HIZA 3GHRA 3VGGA 4JL1A 1WZLA 3EXTA 3H70A 1PZ3A 4O53A 3LV6A 3NPUA 3P60A 3PWGA 2ZRUA 3ENLA 3DGBA 1TMLA 1B2YA 3G1RA 4TO8A 2IXUA 2CLPA 3FFSA 3W7CA 1TJ2A 3K8KA 1BKSA 3PBWA 2VKZG 4GH3A 3HIJA 1R3TA 2OOFA 3G1AA 1PTDA 3MBFA 3WH6A 4LV9A 3TAKA 3LZ5A 4B5XA 7CGTA 3PZIA 4Q6JA 1UB3A 3B0PA 3OYZA 4O54A 3W7JA 1W3JA 1XLHA 3PK7A 5G2IA 3R0UA 4U10A 1TX2A 1TVLA 4O1EA 1ICSA 3ZOAA 5CQ1A 1VYRA 3QJAA 1PCKA 1C93A 1TTPA 2QPXA 1KV5A 1JZ7A 3THDA 5TD4A 4DEFA 3TW7A 4AQLA 4JTUA 3VGHA 2EPOA 1UP2A 6GEPA 5GNXA 2OZ3A 2AMGA 3FXGA 2QCGA 3RILA 3PBYA 4L6HA 3UW6A 4ADUA 4WCJA 3RCYA 2V69A 5EMUA 4YTSA 3M16A 3W7LA 1Q6EA 1E1CB 1XIHA 4WGXA 1A3WA 3CV2A 4H6QA 4LJ3A 1A50A 1PE1A 1Z41A 1RA5A 5A8PA 4EF9A 3WENA 1EDGA 2XIOA 4MPKA 1DJHA 3EDEA 3TDFA 4F40A 4MWAD 3LYEA 3TROA 1NQKA 4MIMA 2PD9A 4HYRA 5HINA 4WSHA 2FZ9A 4GXWA 3E02A 3SRHA 4HK5A 2WW5A 1FVPA 3QY6A 4DJED 1N8WA 5G1MA 4W8LA 3UGRA 1EOMA 3NQEA 2OLSA 4PMUA 1OABA 3VCNA 1KB3A 4HP5A 1KBBA 1ZJ8A 5L6UA 1HKIA 4V1YA 5IHRA 1XYBA 3KRSA 5J04A 4O50A 2EJ1A 2YIHA 1QPNA 2BODX 3SBFA 1OZQA 2X0YA 2J13A 3IIZA 2WNZA 4Z1BA 4UMBA 4JX5A 3A5FA 1IT8A 2TYSA 3LM7A 5A94A 1ZBVA 2QJJA 3T2QA 3W00A 3VC5A 5DRIA 4BFAA 4FIQA 1PO9A 3DCPA 2J77A 5AYYA 1JFHA 1LBMA 1PKLA 3QV7A 4DZHA 3NURA 6REQB 4IQLA 4E4UA 4FO4A 1Z48A 4RE0A 1CTNA 3ITOA 4XISA 1HVXA 1QNVA 2J7HA 3DFOA 3GDBA 3NIYA 3G3MA 1ZU8A 3B8TA 3NR0A 2BVWA 2QDHA 1XG4A 3M0MA 3O16A 5DBUA 2A3EA 1I2RA 2V68A 1F8IA 4ZO6A 3ZFHA 4PMRA 3S0CA 2H3DA 2DSKA 2ZX5A 4IL2A 3FHAA 3FOKA 1IF2A 4M19A 1W2VA 2NV2A 4WF7A 3IRDA 5AOUA 1MUCA 2QHAA 3A23A 4AWUA 4PFMA 3TA9A 3R2GA 4HCHA 1XIMA 3D47A 2OSXA 3L68A 3VOFA 3S1UA 1AW1A 1Q7ZA 2W0UA 5HPCA 3S2NA 4XSMA 1F6YA 4UTUA 4AXKA 2XM2A 2VC9A 4LPCA 3UYIA 5IFTA 6TAAA 2R24A 1OINA 2P3ZA 1NDYA 1KD0A 2WZHA 5RUBA 2G3IA 2XYLA 3SY1A 3K8MA 3OB8A 3V0UA 1LUCA 5G5IA 5FJUA 2NZLA 3BW2A 2JF6A 2XH4A 2AKZA 2W62A 3M0ZA 5I3JA 2D2HA 2OT1A 1FWAC 2XPKA 3CWHA 2QJHA 1UHVA 5FIPA 1FFQA 2XSXA 1Q6FA 3CTTA 3FVMA 4FNTA 3L4YA 2G4JA 1F5ZA 3TU9A 3WUFA 1ITXA 4W86A 3SCNA 3MU7A 3ZMRA 2E6YA 1P0NA 5I6SA 5FD0A 1EC8A 2XFYA 4FALA 4U5IA 4D1JA 3B3DA 3HA1A 2QUUA 4H9VA 2QPUA 3SCTA 4N02A 1ZRQA 1QHZA 4O0ZA 4P5UA 1PCWA 3DERA 1WDQA 3O15A 2J7GA 5F1VA 3TSMA 4MHBA 2VZUA 1TPUA 2CIPA 2VNCA 4L9YA 4FXJA 3SUUA 3UWEA 2WZIA 1BWVA 1QMLA 4UTWA 5G4HC 3W7DA 1Z9AA 4PMNA 3W7RA 1CX9A 3VDAA 4EXAA 4JHMA 3OG3A 3UT0A 4UB9A 2PE4A 2BBFA 2FZDA 2DPEA 5ABFB 3C0QA 3T78A 3CZ8A 1W3TA 3SUVA 2WWDA 3V1PA 3VX1A 4DRSA 3L9CA 3VU2A 2VCAA 3S46A 1GONA 3R0KA 3L5MA 3E2VA 3RCMA 3DN5A 4HPGA 2J74A 8GEPA 3H24A 1TX0A 4HMDA 1QI5A 1NJJA 2VEPA 5AHEA 3LY0A 1F7BA 4ATWA 4NF7A 4J3VA 3WG6A 5DCEA 1EP3A 3C61A 1GVYA 1C92A 3D3FA 2CWXA 2GOKA 1W54A 3UZ5A 2PDHA 3KLKA 2WKLA 2J4GA 2GVGA 3THCA 3SGGA 2PRHA 5CC3A 1G7VA 2F6KA 2X16A 2RKXA 4ERIA 3U2ZA 2WNWA 5JXQA 4C1NB 3O06A 2HV5A 3RGTA 4AUBA 3GNOA 5D2WA 3LLDA 4QLJA 4QSHA 3UWVA 3KBWA 2YBTA 3HPAA 2W5FA 5BRBA 3FK4A 3G1FA 1MEWA 4O1BA 4RNIA 3AICA 1XIIA 3OLEA 4HGXA 3RX4A 2CPUA 3KUMA 1RJPA 3STFA 4DWDA 3HV8A 3HPZA 4LBSA 3BXWA 2WV8A 3PZ9A 1DV7A 1FXPA 3EB2A 2EPKX 2NWSA 4MAZA 1MW1A 2ZQ0A 1P0DA 2XVLA 1C7TA 4BY3A 4DLFA 1TMQA 2VHLA 2O9RA 2WJZA 4AXNA 3DFPA 3GTXA 4M7SA 3H22A 3NZPA 1W9DM 2F6XA 1F6KA 3I65A 1QWKA 1J2WA 5I79A 3W7NA 3MM7B 1ENUA 4BQ3A 4HZ7A 3E74A 2QUTA 3B0HA 3GTFA 1AQ0A 3NM1A 5D9NA 4MTVA 2OOGA 3V0SA 1QASA 4GYKA 2RDXA 2E09A 2W67A 3VE7A 3VIMA 4PRWA 3P0WA 2AQWA 3MDWA 4WDWA 4NZJA 3N18A 1JPIA 1FQ0A 5A3HA 1EEPA 5KETA 1OG6A 2OYMA 5I7GA 3SCRA 2Y8VA 1TE6A 4Y6GA 2ODOA 2Z1SA 5GEPA 2WVVA 2GJRA 1OC6A 3TTOA 3TCEA 3KTXA 2DZXA 2C0AA 3CEUA 2B7NA 4TU1A 1MWOA 1KFCA 3SN4A 2WVUA 3N73A 1LCOA 5DT7A 3V5OA 4KBXA 1QFEA 2CLMA 1M1BA 1EF3A 1HJWA 3OO2A 3GB6A 3AOPA 4BKNA 1XFCA 3CQKA 2DT2A 2MANA 4BI6A 3VNMA 1VEOA 3WQEA 4PMQA 4H2CA 4O28A 3HQNA 3QXBA 1EC7A 4JIPA 4A22A 4E4PA 3TFCA 2QIWA 3NZ1A 4M6PA 4NJKA 4MJMA 4RPQA 5GJPA 3CM4A 4O4VA 4Y7EA 1P48A 2VYOA 4P7QA 3REQA 3BJTA 1TJRA 3L2IA 3HPSA 4Z2GA 4NVTA 2Z6IA 3ZR6A 1A5LC 4X63A 1J0JA 1NAL1 2OCZA 3CUZA 3UETA 2RFGA 5CJNA 4KETA 1VIWA 3L23A 4NAEB 4Y96A 3F4DA 1QJWA 1S39A 1IZKA 2Q8ZA 3TC6A 3S5SA 2YL8A 1X1ZA 3MCOA 2ZA3A 1RH9A 4I7WA 1A5KC 4B91A 4Z2IA 4B9ZA 4YTUA 5AHMA 1MNZA 4JTDA 4E2DA 3DFQA 3PUDA 1U30A 3TOYA 1FHVA 1TJ0A 2AMXA 3W2KA 2GEPA 3CZGA 3EEGA 2ZDSA 1I2NA 1GEHA 4O18A 3WJSA 2E5BA 2VO5A 3CUFA 1LTDA 1VJZA 4DM1A 1V08A 4C7GA 1Q6CA 5HNRA 4QHRA 3S1VA 4NJGA 5H6HA 1W56A 3GTHA 5LSMA 1XLIA 4NXKA 2YXGA 2XM1A 5CPOA 4C6NA 4JFWA 2D24A 1Q13A 4CN4A 2GGIA 4ZTYA 2ZRVA 3AMGA 2OSWA 3O9NA 4DWSD 4NX0A 3WQOA 3RITA 1QOQA 3QTGA 1RA0A 1NF0A 2XVGA 3WMLA 4HZ6A 5HUPA 2DSUA 2GJXA 5AN7A 2VR5A 1BYBA 2CBVA 1F05A 1E3XA 3QZAA 1REQB 3MUZ1 1LT7A 3CK5A 3VFCA 4GY7A 2NVDA 3C52A 4CNPA 1TQJA 1XLEA 2V6AA 3EOOA 4N9DA 1BGAA 1RJQA 2O9OA 3BGAA 2Z26A 4MVAA 3VIGA 1ZALA 3CASA 5D32A 1Q8JA 1R38A 3UQNA 2Z28A 3MS8A 1VEPA 4GNKB 4J28A 1EQCA 4WOZA 4I6VA 3J7HA 4GYPA 1PSCA 4AC1X 3LG3A 2BV9A 1O1ZA 1KXTA 3A24A 1ZPTA 4W93A 4D6CA 1POKA 3ZLHA 5D02A 4D6IA 4ZE4A 4U28A 1BTCA 1R7AA 1S46A 4JIQA 4JTHA 1YDOA 3L65A 1Z44A 4OVXA 1SZFA 3FA3A 1K70A 5CPNA 3RPDA 5K9CA 3AISA 1X6UA 5FF7A 4IGSA 3B0MA 4GBUA 4ATLA 3R10A 3VKQA 3KL5A 3G0XA 3LERA 4KCTA 1VFOA 1VFSA 3UBPC 1ZL1A 4LUTA 3STPA 2X1RA 1GHSA 4HYVA 3G1SA 4H9XA 1A5SA 4TV6A 4R85A 3K13A 1A5UA 1J10A 1K02A 4QG9A 4IFRA 5KSWA 3EOEA 2C3ZA 1SYTA 2AKMA 1V6XA 3GG1A 2IUZA 4NQ1A 3MM5A 2Y70A 4C6CA 1QW7A 4B4FA 1GJUA 2C18A 5CZSA 5CZJA 4ALDA 2WJEA 3IRSA 1X6NA 1L0PA 1KM3A 2V2HA 3PS7A 2I14A 1BWKA 3NDYA 4NI3A 3W6YA 4F0KA 2G3MA 5T26A 4US5A 2OQYA 3VFLA 1XKYA 1NY1A 5L9FA 1SVDA 2I57A 3PSWA 3IGUA 4GZIA 4KEMA 2X7WA 1SSDA 1MZHA 2IQTA 2TODA 2OMAA 4FOJA 3BLLA 3MHFA 3RF9A 3BLOA 4F9DA 5CJMA 5AC7A 1UH4A 2FH6A 1X7FA 3H2NA 4KCUA 1MW0A 3BLKA 2VWTA 1XYLA 3B4YA 4HB7A 5CSUA 1Q6QA 4QBXA 1GVQA 3QZ6A 4HMEA 1S1RA 1I4NA 1UMLA 3T44A 4EXQA 2GSHA 3DC0A 1E9ZB 5IDIA 3WLTA 3UF9A 3UJEA 1EGZA 1EXBA 1GW9A 1QR7A 1DWGM 4L64A 4RW5A 4MPQA 4AHOA 3WDQA 3PNUA 4JKKA 3L2LA 2HZGA 1ZUAX 1IQ8A 3N15A 1O7AA 4JYFA 2VEMA 1H5YA 2OT0A 2XGZA 3S6DA 1GJWA 2A21A 4QJ5B 5A8MA 2HPIA 1WAWA 2W6RA 3EX4A 5KITA 4FXFA 3OP2A 3EMZA 4GZ7A 4GMEA 4CKQA 3G8RA 1G4PA 2YCIX 2QUNA 4C5ZA 5MHBA 4GACA 2D22A 1L8NA 2GDVA 3K46A 3W7GA 5AHIA 3UPWA 5K7JA 1TJPA 1IXNA 4DBUA 5FAGA 1P7TA 5DCBA 5B7ZA 2D2GA 2E8YA 5BROA 1X7IA 2BVTA 2E6FA 2Y5EA 1TWZA 2DQXA 4KRZA 4LNCA 1XPYA 4FLSA 3W29A 2XN2A 3C4UA 1KBLA 1VIZA 4GABA 1I1WA 3IJ8A 4AWEA 3EWZA 1M7PA 2Y61A 3UXKA 3LNPA 3I10A 1NIUA 4AHPA 4JN6A 5C5YA 4ICNA 3I6RA 1M68A 4LUSB 1OWQA 2DZBA 2UY5A 5G1TA 1GKPA 1LQAA 1K6AA 4YVPA 5FKYA 1R9XA 4DUOA 2V5KA 3UJ2A 3KP1A 1XHGA 1DWHM 1SM9A 4LS1A 4K8EA 7A3HA 4RUBA 1F07A 1ZAJA 2QJGA 4GRSA 5CPQA 5CZKA 4XZMX 2GK1A 3VKKA 4H19A 3WUEA 1JZ6A 1B9ZA 1E5NA 2IPGA 4A8RA 2QVNA 3MV01 2FGLA 4LU0A 3WDRA 1HZYA 4IJCA 2G5WA 3VZZA 3KWXA 1A4LA 3ES8A 3E96A 3Q45A 3SQMA 3B8SA 2RAGA 4S3JA 1ISYA 4JEQA 2DVTA 3UA4A 3Q4DA 2HCVA 2VEGA 4HA1A 1O94A 4MG4A 1TTIA 2HE8A 4LC8A 3GXMA 3R94A 1UQZA 3A3WA 4K3ZA 4GEPA 1XH2A 2A79A 1PVNA 1JVNA 1DJQA 1S5NA 3V0TA 3AO0A 3PZTA 3WLJA 1BPLB 4Q6XA 3WF1A 3KEHA 3TQ0A 4XV0A 3H2FA 4QG6A 4I90A 4P8VA 3VOGA 3TYCA 1J6OA 2WB5A 3W73A 1FKWA 2Z4GA 3OQEA 1WDPA 2YXOA 1OFEA 3NSXA 1OFQA 1XYFA 3PUGA 5F2GA 4R7OA 2WSQA 2WM1A 1TIMA 2YDAA 4IIDA 1NFBA 1YE4A 3KVKA 4W89A 5EMYA 4C7DA 1S5MA 3PB2A 1W5PA 3PSVA 4PB5A 2Y7EA 3LTYA 4IG2B 3RDKA 3STEA 3ZQ9A 1FWWA 3CB8A 1BAGA 4I9TA 4AAJA 1QNPA 2Y63A 1DP0A 2WCSA 3OA5A 2PLMA 4JFUA 3WMCA 1MFVA 3OOQA 4H9TA 1SO3A 2GJPA 3B0UX 5BNKA 2A2IA 2VFGA 1OJXA 1CGUA 5A95A 4Q4KA 1U2YA 1UD5A 1MMFA 2IKJA 2I16A 2EPMX 5DY2A 1U22A 1EL3A 5JBDA 3O07A 1KTCA 1UW9A 4YWIA 3PG9A 3OR2A 4RLIA 2ZZ3A 4HTBA 3BV7A 4YCOA 3EX3A 3HG2A 4WDUA 4P8XA 3RJYA 3CBWA 4D8AA 4MGGA 2F2HA 3EWWA 4AF0A 4GOAA 4FMVA 4GFSA 4DJDD 4LAOA 4EP8C 1TV5A 3UGVA 4KIEA 4TVCA 2X8RA 2HBVA 4OU1A 4O0KA 4IMAA 2V9DA 2G41A 2VGGA 2OJPA 4J5NA 3AXIA 2GQ9A 2CKSA 5IOBA 3IUDA 5FOOA 3IIOA 4D6FA 4JTQA 5A2BA 4PUDA 4I6KA 2NLYA 3G77A 3M0KA 3TR2A 3L7RA 3TNBA 2A3CA 4LEFA 4WSJA 2Q6ZA 2QCNA 4XKYA 3ZWSA 1VCVA 1UWTA 2PU0A 3EPOA 4FOKA 4GH1A 2FPTA 1HL9A 3DI0A 3B0GA 4FZIA 2VDGA 4YYCA 2V3GA 3QTPA 5LNVA 4LQ1A 3VVGA 1UBSA 1E6ZA 3O63A 2PTYA 4ZB0A 1Q7QA 2XFWA 3M7SA 4HNLA 1S5WA 3GNPA 4MZ8A 3EKZA 1GOWA 2GJLA 3W88A 3I3BA 3P14A 3RLVA 3VDHA 1PKNA 5HR6A 4KH2A 3WDPP 3NDZA 1UH2A 3VAVA 1UYQA 2B0MA 1YPFA 3GNDA 2F7FA 3R0DA 1OGSA 2C8NA 2L5HA 4M29A 4IQDA 1CT5A 3Q58A 1I8JA 7GEPA 3E6EA 4E3VA 3UPMA 3NQ6A 2YR1A 4MJ2A 1H2JA 4XZBA 1G94A 3TLLA 3C0LA 1NVMA 2QS8A 4I5RA 4FEZA 2Z0IA 3KTCA 8XIMA 1VFMA 1T5AA 3URNA 2W27A 1QTWA 2D73A 1FH9A 1BYDA 3GXDA 5E09A 1GJPA 1THFD 3H2EA 1NELA 3DFHA 4DAIA 5C55A 3GVRA 4M56A 2NV1A 3BDKA 2WHJA 4F8XA 1PHQA 4XQ6A 5CGQA 3O0KA 3U9IA 1XIEA 3N9KA 1TCDA 4IIGA 3NQCA 1VBJA 2NV9A 3T09A 3UERA 1HX0A 3IJLA 4ILSA 1E6PA 3G0SA 3L0NA 4CNSA 4D6DA 4G8TA 3TEVA 4GXMA 3LCGA 5HMSA 3AXXA 2R94A 3SUTA 4L1XA 3STCA 1VJIA 2RJHA 1OX6A 3LPGA 1MDRA 3IJIA 4A8LA 2BY3A 3TK7A 1LQ2A 3RXZA 3RPMA 3WNNA 1AW5A 1XDLA 1V0MA 2YA0A 4PC8A 2CW6A 2FYMA 1O4UA 4MZ1A 3SCVA 1JPMA 4GNJA 1V6YA 3AIBA 3HQPA 1ISXA 4NZCA 4KGLA 3U5YA 3AUJA 4UCFA 3USZA 1W6TA 4N9EA 1RCXB 3EMCA 1GOOA 9CGTA 5AYBA 5C9ZA 3VM1A 3GVWA 3L4XA 1YTEA 1TZ9A 4MLJA 4GUIA 1Q7MA 3C86A 3UJSA 3GFZA 1X1NA 3UG4A 5TF0A 4H6EA 1A0EA 3DOPA 4DYEA 3EOLA 3BV4A 3W82A 2MNRA 4JPGA 3WD2A 3NL3A 1N7KA 4XAPA 5IRPA 2V4JA 4JYEA 3FGCA 2GFTA 1UD3A 4W84A 3BJFA 2GUYA 1UKPA 3PC0A 4R7WA 1J01A 1OD0A 2NXGA 1ZJ9A 4Q8NA 2FDMA 4GA8A 2WSRA 3TAOA 4L4MA 4N4QA 2PODA 4QR6A 4ZOBA 2X0SA 4Z1YA 1S2TA 4Q8VA 4K38A 3VIJA 4RV8A 5EMKA 2FZ8A 4JY8A 2O4MA 2WMGA 4UUIA 1TVPA 1LDCA 4UFMA 2ZTKA 4AC7C 2R1LA 4BQ5A 4F0HA 3GNNA 1Z69A 3ZIZA 2H3BA 1BRLB 4E8CA 1R3RA 4GGBA 4KESA 2G96A 1TUFA 4OV9A 3LMZA 2XSJA 3BK0A 4MWAA 4E3TA 4H83A 1CGXA 2EQDA 4IHCA 2DZWA 3LHWA 1XH1A 5I3FA 2BOGX 3WD1A 3G6LA 3USBA 4R88A 4OFCA 3GUGA 5LZLA 4PUNA 1GKRA 1MRQA 2PWGA 5I78A 4JTFA 3OLIA 4D6JA 1NM9A 3U2OA 1GORA 4YCPA 4PBFA 1MQPA 3KAOA 1AH4A 2NUXA 4RV3A 2G4FA 4B5VA 4DVOA 5AZ0A 1EGVA 1PZ0A 4I9JA 1R9YA 1QHOA 3WQCA 4ZB5A 5HWJA 3KTSA 4FOUA 2VVSA 1UP0A 4C1LA 1LOLA 1X6LA 2ZZ5A 5FJRA 3C0JA 4NG3A 3VNZA 1B90A 2XWDA 1PX4A 3GAYA 7REQA 1B3OA 3NPWA 1E4NA 2JKEA 2WBGA 1Q6LA 1GK8A 5LIUX 2QLYA 3RFAA 4WJ8A 2CZ5A 4UQ9A 1UPMB 3P61A 3G1VA 3STGA 1C8XA 3C8NA 4DF0A 4ROPA 1P5BA 2BWGA 4PMZA 4B3ZA 3OR1A 4W7WA 2ZX6A 3AQUA 4BQ2A 1D8WA 5AHNA 1KXQA 3E0FA 5DMNA 4O1DA 3UWQA 3QOKA 1PB0A 2VZVA 1W31A 2A7RA 2F2KA 4PBEA 4GBDA 3OGVA 1HGWA 1UKTA 4Z2HA 2J6VA 1IR1A 3K4AA 2PAJA 4HKPA 2JBMA 3FXYA 1GG0A 2VEIA 1J93A 5FEZA 3FCPA 3QMTA 4LAKA 3SCSA 4OZOA 1VFFA 2WO5A 4H04A 3WNKA 2G37A 4LFYA 1RVKA 4OBSA 6ENLA 1HJXA 3TOPA 4ZEPA 1GT8A 2F84A 2WLYA 3CWOX 4FX6M 3PZGA 3QMRA 4CU8A 2FLIA 2PDQA 4Z2JA 4V33A 3OZYA 3B4UA 3WNLA 3LOTA 4WVXA 1PHWA 1ZY9A 1YEYA 1KA9F 3EYPA 4XAFA 5BMWA 1TWSA 1CBGA 1DPMA 2CC0A 2NVCA 2YCKX 2ZUVA 2OKTA 3DIPA 4PEKA 2Z27A 2DT0A 4DBEA 2P8CA 1JAEA 2HPMA 1ODUA 5FEPA 2YOCA 3TA6A 1XLJA 4JIHA 2C71A 1Q85A 3LK6A 1UP3A 3RYSA 1ELSA 3NOEA 1LUCB 3UA3A 3ABRA 4N6FA 3P6LA 3UCQA 1SGJA 5J5DA 2F38A 4GFIA 3VKJA 3O6YX 3S5OA 3EMQA 2X0HA 1NH6A 2VX7A 2FFCA 1WOBA 1CXIA 3EA2A 4JX4A 1C29A 2FVKA 2OB3A 1QO2A 1SZRA 4NKCA 1KGUA 3V4BA 3U7BA 3WH8A 3TLQA 3FNDA 3N2XA 4EVZA 1KFWA 1B5TA 2BASA 3BCFA 3WZ0E 1AQMA 5JBEA 2J25A 4Y9OA 5C70A 1L6SA 3BICA 2DUAA 3ITGA 2CHNA 1A4MA 2GGJA 1ALDA 4FF7A 1GVIA 4WY0F 5F4XA 3V35A 3TC3A 1SMDA 4JEJA 3MKCA 2GSJA 3ANUA 1XF0A 1RV8A 1OADA 3TTYA 4M51A 3H23A 4IFOA 1GVSA 5HMEA 2E40A 1PYMA 3NO1A 3OYXA 1ZBKA 4KEZA 3CAQA 3G18A 2PI6A 1M7XA 4A3UA 1H09A 2Y0FA 3KOXA 2D0GA 3CZJA 5KZ6A 3ITLA 3I7RA 4E38A 2VX4A 1XRSA 1JNEA 1V5XA 2J88A 3ARVA 2ZUMA 3O6AA 4Y9PA 5BZAA 3GR4A 4V28A 2WLZA 4LUJA 5CG0A 1UJPA 1FWGC 2QZRA 3VDGA 3BTNA 1HT6A 1WYIA 4EWJA 1P4CA 1UUOA 4ML4A 3ORWA 2NT0A 3SZ8A 4RPPA 1QUMA 1DJZA 4S23A 3W1TA 1GZGA 1FH8A 1TG7A 1U1JA