4S39A

Ispg in complex with hmbpp
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
401
structure length
400
Chain Sequence
MRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
total genus 140
structure length 400
sequence length 401
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s39A01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s39A02
4NIRA 2XSJA 4MWAC 1ZJ8A 4NL1A 2XSJB 4S3AA 3B0JA 4DAFA 3MMAA 3K13A 2YCKX 3MM8B 3TZNA 3MM6B 3MM7B 2YCLB 3OR1B 1TWZA 3H2CA 3TYUA 4DJFD 3OR2B 4NHVA 3MMCB 4O1FA 1Q7ZA 3H24A 4D8AA 4S3CA 3B0HA 1ZJ9A 3BOFA 1TX0A 3NOYA 2H9AB 2DQWA 4O0QA 1AD1A 3MCMA 3VM0A 4DAIA 3MM6A 3H2AA 3MM7A 5JQ9A 3VLZA 3AOPA 2AKJA 3TZFA 4S3FA 3TYAA 3TYEA 4MWAE 3MM5A 2Y5SA 3H2NA 3H23A 3MMAB 3VLYA 2BMBA 1AJ0A 1F6YA 4HTRA 1Q7MA 2V4JB 3H26A 3MMCA 4O1EA 4C1NA 1TX2A 3MCOA 1AJ2A 3GEOA 4GEPA 8GEPA 1EYEA 4S3BA 4AOPA 3VKSA 3H22A 3H21A 4DJED 3MM9B 4S3DA 4MWAA 4DJDD 3VKTA 3TYBA 2Y5JA 3MM9A 3B0GA 4D8ZA 3MM8A 3VKPA 2VP8A 1AJZA 5GEPA 3VKQA 3BOLA 2YCIX 1AOPA 4PZVA 5AOPA 3MCNA 1TWSA 2VEFA 3VKRA 3B0LA 1AD4A 4DJEC 4DB7A 2OGYA 4CCZA 4DJDC 4MWAB 4HB7A 2DZAA 2Y0FA 3OR1A 3MM5B 3OR2A 1TWWA 2YCLA 3H2OA 3MMBA 4DJDA 4MWAD 4DJEA 4G38A 3VLXA 1Q7QA 1Q8AA 4G9PA 4S23A 2V4JA 4S38A 3TYDA 3V5OA 2YCJA 7GEPA 3B0NA 3MMBB 4C1NB 4S39A 4D9PA 2AOPA 2H9AA 1Q8JA 4DJFA 4DJFC 4S3EA 4G39A 3TR9A 2VEGA 2DZBA 4NILA 3TYCA 2E7FA 2GEPA 3TYZA 3VM1A 6GEPA 3H2FA 1Q85A 3B0MA 3H2EA 3H2MA
chains in the Genus database with same CATH superfamily
4Z42C 4ERIA 4XG1A 3EYPA 3ITVA 5MKGA 4KH2A 3BOFA 4WKFA 3ZYZA 2WMJA 3CJPA 3MI6A 2D3LA 1ZBCA 3ITOA 2IXVA 2AL2A 2CPUA 2IKHA 2VC6A 4IX0A 4GCAA 2PFHA 3OA3A 4GH3A 1XGEA 3BW4A 2BMBA 2Z7GA 1Q2RA 1UWTA 1JCJA 3W1PA 2GYIA 2EAWA 4FNQA 1PTDA 3M44A 1G4EA 1D8WA 5GNXA 2PLJA 1DTNA 1S38A 3E2VA 1RA0A 1VPQA 1KFLA 4O8AA 3SN1A 3GDRA 5LHFA 1FKXA 3O6CA 4RLIA 1JF5A 1QNPA 4NY2A 5F1UA 2P5NA 4IMAA 3LOTA 1S46A 2QT3A 1J01A 3U0HA 3CH0A 5TIMA 4Y9NA 3SY8A 3TH6A 1V6YA 3L23A 2NUYA 4HPXA 4IPNB 2PMQA 3ARYA 3EOOA 4ICMA 2NXIA 1R3TA 1DWHM 5HJYA 2P0OA 3LA4A 4QITA 5IOBA 2PZ0A 1HP4A 2L5HA 3IIOA 3NZQA 3SFWA 2ZRZA 1A3XA 5EY5A 4A4AA 5EB8A 4AZ7A 1OFRA 1XYZA 2V9DA 1SO4A 2C15A 3VE7A 1BVNP 1CX9A 4DF2A 4LF1A 3NQ6A 3NOYA 1AQHA 4NZ3A 1SO3A 3KS5A 4AD4A 1T8XA 5BU6A 3PPCA 3UZWA 2X1RA 1CLKA 1E3ZA 4H9TA 2V81A 3IGXA 3FAXA 3QKEA 4J40A 1XV8A 1IQ8A 1G1YA 3SJ3A 1GKRA 3VCRA 3NQGA 3ELFA 2GOUA 1H60A 4O0KA 3HGJA 1OIMA 3BLOA 1S5WA 2XVNA 4OU1A 4LVFA 1WBHA 4AG0A 4DHGA 5AVNA 4D6CA 4LNCA 1OG0A 4HZMA 2W27A 2BFGA 3KS6A 5HMDA 3B8SA 3T0AA 3EWCA 1N8IA 5DMLA 1SFSA 3K1GA 1UR2A 4HSNA 3I7RA 4XV0A 1FA2A 3PUEA 3HMCA 3WK0A 3PTKA 4ZXLA 1LT7A 4IF2A 4QFUA 2HPMA 1DTUA 1NP0A 3LTSA 3QR1A 4PODA 3IS4A 1YE6A 2JGQA 2VFGA 3B9EA 4XIMA 4JY8A 2DT3A 2XFYA 3CUGA 4RDVA 3MMBA 1FTXA 4FNUA 4J28A 2R1PA 3WDHA 3N34A 3HQ1A 3EMZA 4DBEA 4M3PA 4W93A 1M68A 3IUIA 3H2FA 2ICSA 1XUZA 4UB9A 1EZ2A 4XZIA 3NEHA 3D46A 1OZQA 2QGHA 5CSRA 3MZ2A 4UTWA 4JTIA 3H2CA 4KWVA 2QJIA 4D8AA 4QTGA 3P8IA 3SCWA 2NQLA 1J10A 3LBCA 4Z1BA 2CZEA 3SY1A 1KD0A 4MOZA 3PZTA 1ZPTA 1EF2A 3EZ4A 2HZGA 3TMQA 3JW7A 3UCQA 4H7VA 3GH5A 4H2CA 4CQAA 2GWGA 1TZ7A 4NSBA 4ATWA 2Q8XA 4R85A 3TWAA 2ZTJA 1FCUA 2CLIA 4RE2A 3QMTA 4GQBA 4R34A 4XZWA 2F38A 1R3SA 1XIEA 3Q67A 3BUVA 2G8ZA 3WNNA 3W7NA 3M4HA 4ZQNA 2P1FA 1EH9A 1JL8A 2Y89A 5C9RA 4FMVA 3VFCA 3TQKA 4PTNA 3MA8A 3W7CA 1L0PA 2VZUA 3OB8A 3HMJG 1F6KA 3LTPA 1V77A 4XQ6A 2ZE3A 4G38A 2UV8G 1VB9A 2WBKA 1LG2A 4AY7A 4S39A 3RMJA 1VP5A 4AFYA 1XPYA 2VZSA 3TR9A 1JAKA 4AX6A 4Y9OA 3I4KA 1FRBA 1UKSA 3VCNA 4DYJA 3VNIA 3KCLA 2AKMA 3K30A 5HAOA 4JKMA 4IQDA 4XKYB 5G2IA 1VFHA 2X42A 3TFXA 4XUGA 3N2BA 1JULA 2E1WA 4LYKA 4ADSA 4PRTA 1C92A 3M5YA 1W1YA 1ITCA 3MI3A 1GYLA 3QOKA 1RLCL 3QYSA 1X7FA 3O1NA 5G4WA 2AQOA 4AMAA 3QEZA 4GOAA 3CMJA 4IG2B 3AIUA 1JUKA 4YL2A 1TPC1 5A1AA 3UXAA 1V3HA 1TTPA 2J9XA 2Z6IA 4GY7A 1ELSA 1LLOA 1TR9A 2ZZ2A 1A5AA 3NL3A 5F7UA 2YBTA 3EOUA 3QFEA 2PDCA 4K8GA 1XLMA 1TR1A 1DXEA 2XG9A 1DEDA 1EWEA 4KGLA 4DF0A 1O5RA 3AFBA 2BOEX 3CAVA 3TN4A 3LTYA 4B9YA 4FHAA 2BWGA 3WQOA 4HSHA 4LOCA 4Q8WA 4DI9A 1RP8A 1EJXC 1XH2A 4EVZA 2I7GA 3I68A 3GXFA 3EDEA 1B3WA 1U1JA 3VNZA 3PVFA 4K39A 4GFSA 4KWSA 4C1LA 3IIZA 2O9PA 2WZTA 1KXTA 2Y4SA 4AZIA 5CSUA 2QJGA 4JTTA 3VCCA 4DWDA 3GXTA 1UD2A 1QJWA 3BV7A 1ICPA 3EBVA 2QGYA 1CGXA 3MKKA 4PB4A 1H1NA 1L8PA 3CHFA 1XG3A 3E1F1 4HHMA 4AXNA 3GU9A 1U83A 2WMIB 3S2NA 1NDZA 5JUVA 1P0EA 4WLCA 4DJFD 1WDSA 3TC3A 2NQJA 4TTUA 1B3XA 3OVPA 4LYRA 2QJHA 1M04A 1KTBA 5HANA 3AJ7A 1O95A 1H09A 3GM8A 3E12A 3U48A 4ZSTA 2WQPA 4OOZA 3L0NA 5D02A 5HQMA 2FPTA 1KM4A 4MADA 3SCSA 1H62A 2A7PA 3WH7A 3KP1A 3VKAA 4AMCA 3E74A 3VIMA 4HCHA 3VMPA 4HCDA 5F2MA 4I6VA 1T5AA 2Y7GA 1CBGA 2NXGA 3C3UA 1LF1A 2FZNA 1LLZA 4UCFA 3E6EA 3UEQA 2ABBA 4AQLA 5A95A 2DIKA 5F2IA 2J74A 2PI6A 4CVWA 3OHIA 2V5LA 3LLFA 3M07A 3KBNA 5D09A 4FNTA 1UCWA 5BOOA 3WLIA 1J4EA 4R7JA 2WC3A 1AD4A 3QPYA 4POCA 4FLQA 4QAWA 2HNHA 5D9MA 5CAKA 3NDZA 1HGYA 1VD6A 4DYKA 3VGDA 3ZOAA 3CL8A 3HGRA 5A6BA 4YCOA 2YGYA 4ZOCA 4JNMA 3QTPA 1GOQA 1SW3A 4WGXA 3W7LA 1GEHA 1EDTA 1TA3A 2YCKX 5E6YA 3DBNA 3SCPA 4PMOA 3V3WA 5A6LA 1TJRA 1MDLA 4QDPA 1CYGA 5FF0A 2VR2A 2D2HA 1Z32X 4P8VA 4FXRA 4V15A 3WD4A 1UP0A 2UY4A 1N8WA 1B9BA 1HL2A 3STCA 4IIEA 3PB0A 3EAUA 4CNNA 4BK9A 4E8DA 2Z26A 3H26A 1K4HA 2QF8A 4YTUA 2XZ7A 2EQDA 5M17A 5FACA 3GFYA 1PKMA 3L2MA 4YPJA 1GJWA 2VGGA 4MZ8A 4N4QA 3H8AA 1OADA 3Q58A 1HKIA 4IM4A 4CU6A 2WLYA 3PZIA 3ANYA 4HK7A 4TMCA 3CAWA 4MB4A 1T7LA 2Y0FA 1Z44A 1N55A 5CBJA 1JD7A 2FJUB 5K9DA 3FS2A 3BK0A 4LTSA 1U2YA 3AMDA 1M7JA 1MEIA 2E6YA 1B30A 3L9CA 1M7XA 2CWXA 3O8AA 1BG4A 4UFIA 3JU2A 3B0MA 3H2EA 1PDZA 4IZGA 3TTSA 1UOZA 3MSDA 4LANA 2A85A 3CU2A 4XD6A 1O7AA 2E28A 4PE8A 4NI8A 1ZJ9A 1WDWA 3L5AA 3ZQ9A 1I4NA 1JZ6A 3DHPA 3L68A 4XZLX 3RJYA 3W74A 4Q4QA 2JKAA 1QNVA 2OODA 3CYVA 3M0ZA 1XDJA 5BROA 1A5SA 4H6EA 3HJZA 3UBPC 1WDQA 4DUWA 4GNVA 4PCSA 4IL0A 2QVHA 2QMKA 1JZ4A 1V0MA 3DYOA 4XUYA 1S2AA 2A3LA 3ES8A 4B4FA 5D2TA 1S3HA 4H01A 2QAPA 3GUGA 1UWIA 1JUEA 3ARVA 4YWSA 3C86A 2TPSA 4PULA 4Q4SA 2G41A 2CKRA 5E6ZA 1QK2A 4M6UA 2GVLA 2BY1A 1FUYA 1TUXA 3LPGA 3EWBX 1UUMA 4L5ZA 3RIKA 4K7VA 1GUVA 2YR1A 1ZBKA 3MKVA 5CQ1A 4HA4A 3H4WA 1GQKA 2GJNA 3S83A 2V68A 1KKRA 2QUTA 1MRAA 3WFZA 3SI9A 2X41A 5I3JA 3F4NA 5LNUA 2CBJA 1HKWA 4W88A 3EX4A 4N6EA 4DBDA 5A6SA 3C0LA 1W37A 2VZVA 3OHMB 4NRRA 3W83A 3H24A 1L6GA 3RJXA 1CTNA 1BSIA 2WYSA 1DBTA 4AWUA 3M64A 1Y0EA 3EMQA 2PDIA 4V1YA 4GA8A 5AHMA 1J0IA 1FXPA 3UG4A 4ML9A 3RHGA 5C9XA 3XISA 4TIMA 3UP8A 1BQGA 3IJ7A 4NKCA 2JFEX 3W7EA 1KXHA 4PMVA 1WPCA 1MXGA 2E6DA 2J8GA 4JTSA 2Y62A 2DZTA 3W7DA 1XBYA 3S5SA 1HJQA 3A64A 2QCDA 4MLJA 4GEPA 1FWSA 4U10A 3TONA 4J3UA 5D38A 1UWAA 2Z1WA 1TTQA 3C2FA 3P5ZA 3DN5A 5B80A 1EQPA 4G2DA 4AD3A 1QOXA 3B3DA 3VX1A 1VLIA 2BY0A 2R1KA 5EYWA 4D1JA 1K4GA 2F6KA 3ARTA 4CGTA 3B9DA 2BODX 4MPQA 3W7PA 1JI1A 4ICNA 5BWAA 1KWGA 2J6XA 1MVYA 1RP9A 1TWWA 2Y5EA 1EL3A 3CASA 4JTRA 3UYIA 1F07A 1BEUA 2GK1B 3B0YA 4AD0A 2GJLA 1WB0A 4FP1A 2H8ZA 3MQTA 2FGZA 4LEQA 1VQTA 5CG7A 3BMVA 3H53A 3LPPA 2P50A 3FXYA 1R2TA 2WC4A 1C7TA 1F8IA 3B8TA 5DMNA 3LRMA 1RLDA 1TV7A 4OKDA 3IJ6A 3VYLA 3G0UA 4PFHA 3M46A 2FVLA 1FHDA 2DH2A 1IXPA 3OR2B 5F2LA 5T91A 1HF6A 4PUNA 1E9LA 1OK4A 4EXBA 1MW1A 1TX0A 3BPWA 5DFAA 4O12A 5EA9A 4LS0A 1XISA 5C2CA 3PF3A 3N25A 4MB3A 2WPGA 3QMRA 4E6MA 3L0KA 4AVNA 4QG8A 2QDEA 3PAJA 4HTRA 1L6YA 1PAMA 4I90A 3WBAA 2OZTA 5IXEA 4QEEA 5A6AA 1ME9A 4F0KA 2BGSA 3GNXA 3LCIA 3RLGA 4DEFA 1V03A 2DW6A 4PRRA 3AS0A 1W1ZA 1KGXA 1J79A 4LUTB 2D20A 3F7JA 3QHOA 2C16A 1SSDA 3DFSA 3GD6A 3WDIA 4GXMA 2CBUA 4C6PA 2VP8A 4CD7A 4A3HA 4FO4A 4M1BA 1N2VA 4ZQMA 1NWRA 4UFJA 2ZZ7A 5DCBA 1MFVA 1KFCA 4Q7BA 2Q8ZA 3QSRA 4TTGA 3LGEA 4B3ZA 1XG4A 2BTMA 3PZ9A 3CO8A 5IHRA 1NWTA 3UR2A 3G5EA 3VDAA 4S2BA 3N2MA 1KFKA 2G5WA 2EG7A 4DYEA 5C7VA 4EAYA 4HK5A 1QRQA 1Z48A 4OFCA 4A3RA 5AZ0A 3EPNA 2R24A 2P76A 4HU8A 1PSCA 3UGRA 2E1DA 3QGAC 1X1NA 1XCFA 1HJXA 3R8HA 3N4FA 4NHVA 5GNZA 4KRZA 4R3UA 4QRNA 1RXOB 4Q8UA 2XUCA 3IVUA 4Q22A 1G67A 3LGGA 1E43A 4HHPA 1JEZA 4H6QA 3SQSA 3GR7A 2F9RA 3UR8A 2WKGA 3H23A 2NXHA 3I10A 4QE1A 4Q4RA 1AH3A 1HO1A 4EE9A 3UG8A 1PDYA 2QYGA 2DSKA 3W1LA 2QJNA 3RO8A 4AXKA 4HJWA 4H9ZA 2VDIA 2ZIDA 1UR4A 3NGJA 2VZTA 2X1TA 4MHBA 3P2VA 4H1ZA 3TSMA 1KRCC 2V8ZA 1BWLA 4KESA 2ZZ6A 3C2YA 1UPPA 3MBFA 1M6JA 4HPGA 3AMLA 2V5BA 1B5TA 7GEPA 1F2JA 3WLHA 3WF2A 3EB2A 2Z27A 3DFHA 4U3CA 4UNIA 2I5IA 1X1ZA 1L6SA 3C4UA 2Z0IA 4WK9A 1IE7C 2XINA 3TXVA 4FB7A 1VENA 2E9LA 3BQ6A 1R9XA 1TPWA 3S47A 4K36A 3VDGA 2Q02A 4HMCA 5CZKA 2WJZA 2A3AA 4AC7C 2VWTA 2PWEA 2GGIA 2VFHA 3NO3A 3CNYA 1EJRC 2VCCA 2VO5A 1ZB5A 4LU0A 4H9UA 2ADAA 4O15A 4RR4A 2D1ZA 3B8WA 3OVGA 3WQ6A 3URNA 4U28A 3NSMA 3W7RA 3FHAA 2XFWA 3VNDA 3T40A 1UA7A 2YA2A 2ZA3A 3CV6A 4PCNA 3E49A 5DBTA 2ZA1A 4ZBCA 5C6MA 1PIIA 4GCXA 4L4PA 3ZT5A 3R8GA 4GI4A 1FXQA 1P0KA 2XVKA 3EKGA 3WH9A 1XIMA 3OLGA 4OECA 1UMYA 4XAFA 4PMYA 4FS9A 4W84A 4QX4A 4AIEA 4LEFA 1VEMA 1V3LA 5AYIA 4ADTA 3ITLA 2BXYA 2ABAA 1BTMA 2V3GA 1M7PA 5I0DA 4OBRA 3OR1A 2RKXA 4AIOA 4S2CA 3N11A 5LGXA 1UQYA 1XFBA 3RXZA 1E40A 4AB4A 4QDWA 1J96A 3VMNA 3PSVA 5FJIA 1BXCA 1UD4A 3S2LA 2FIQA 1M7OA 1ZALA 5BXPA 3GIQA 1EF3A 3W3OA 1US2A 3N9RA 3NSNA 4AHPA 2C91A 3A9IA 2E77A 1YW1A 5LIXX 3B0JA 5DELA 5AY7A 2OEJA 2WJFA 4UQ9A 3T05A 2NZLA 1W5QA 1NH6A 2OQLA 3N6JA 2Q01A 1VBHA 4PMNA 3TOYA 3TIMA 1KXVA 2HISA 2DJLA 9XIMA 3TEVA 4A05A 1BVWA 3TLLA 2QDDA 4PA8A 2ISSA 1SU5A 3U3HA 1L9WA 1ZUAX 1LOQA 4HU4A 3TUUA 4EF8A 4U2ZA 4JTQA 4H7CA 3NCOA 3CB8A 3CUXA 3QV6A 1LORA 4DPPA 1XKJA 3HU7A 4JN8A 1HFBA 2E5BA 2FHFA 3VD3A 3GTHA 1U5HA 2E25A 1VHNA 1LOLA 2ZXAA 1ZJBA 2ZXQA 3NO5A 1W54A 4LQ1A 3SIMA 1L6FA 1MQRA 4NJGA 3U57A 3GVWA 2FPYA 3G1FA 3ZM8A 4HB7A 3PS7A 3WLSA 1UQZA 2AKZA 4NT0A 1VYPX 1S3TC 1OT1A 3O6DA 4K1GA 3LMYA 3MO7A 1C8YA 4JQ1A 3W73A 1GHRA 2GGGA 1I2QA 3EWZA 3WO8A 1JAEA 3G18A 1ZS2A 4HNCA 4B5XA 1Z69A 3IVSA 4MZ1A 3TC7A 3R10A 4HPNA 2QS8A 4DXVA 1ZAJA 4XK2A 2V82A 3UXLA 4XZHA 2EXOA 2QDGA 5LA1A 4L4OA 1I1XA 2RUSA 3FDGA 1XH1A 3WKZA 1DPMA 1D7KA 4B91A 3DH7A 4QM1A 3GIPA 2WMHA 3S1UA 3APTA 1H1YA 3N14A 4CD6A 2IW0A 3NG3A 5KZ6A 3L4ZA 2VI0A 5XIAA 1LUCB 4WSHA 3W2JA 4MTVA 5I00A 1EX5A 2J7GA 1R0MA 1BXNA 1I0DA 4X22A 3W02A 3CWNA 4XISA 1PIFA 5D2YA 2VGIA 4Z2GA 1DJYA 2P10A 2A3EA 3UZJA 2PP1A 1VIZA 1NSJA 3WF0A 3UWVA 1FWDC 5H8MA 4KCUA 2WCSA 3S3GA 1DXIA 3MPGA 3O7UA 2OYMA 4ES4A 3VA8A 3BAXA 3PJTA 3W7JA 3O3RA 5FEZA 3GC2A 5C5YA 2QCCA 1EIXA 1DJXA 1K9DA 3TCEA 2AAAA 7ENLA 2PGFA 1G6CA 3FCPA 1I2NA 2ZC1A 2C0HA 3A3WA 4JTFA 3SRFA 2XSBA 1J0ZA 3B0VC 3W81A 1UZHA 1EA0A 3F03K 3M41A 3PANA 1GOIA 1OT2A 5JU6A 2Q6ZA 3W23A 3W85A 2WJDA 3WF3A 2FFIA 4NI3A 3EKLA 1QW7A 3KHJA 1NF7A 3WF4A 4F48A 1YYAA 3OBKA 2VC9A 4X60A 3MB9A 3PZNA 2Y8VA 3QZAA 3JR2A 4GD0A 3AOFA 5DBUA 3QY6A 1ZLPA 3PPFA 5KTLA 3UG5A 3M6DA 1IWPA 1TREA 4EOUA 1K9TA 3PBGA 3VKTA 1AW1A 1F61A 3M7SA 3QM3A 2ZUUA 3AYRA 4GIRA 2NX3A 3A4WA 3SFKA 3NQAA 2WZEA 3RPMA 4GI6A 4NVTA 5T26A 3LLDA 4JYFA 4DBSA 2PF0A 4Y8FA 5HR6A 3BMXA 2JF6A 2QW5A 4PMXA 5EMYA 3T09A 3BV4A 1FWBC 3SR7A 3LXBA 1ONWA 4BI7A 4E2DA 2XGIA 1HGWA 1THFD 3HG3A 1QHZA 1XP3A 4UMCA 3JRKA 1YEYA 3R8RA 1HVQA 4F9DA 2WKJA 5KSWA 3LCXA 3WQ5A 3PUDA 1BYCA 1I0BA 4KCWA 4N9DA 2QEZA 1LBLA 3CUHA 3W7KA 3MM8B 1Q6RA 3OU8A 1B31A 1HJUA 1E6SM 2QUVA 4WDTA 4C5ZA 5BXRA 3NR0A 4GJIA 4PEKA 1ZFJA 4O0QA 3R12A 4CU7A 1BQCA 3HG4A 1E4NA 3IJLA 1K8YA 1E4LA 1VH7A 3Q37A 5CC6A 5G1YA 3PBMA 4IH3A 5HXMA 4PSRA 3CZEA 4JTKA 4CUCA 3EA1A 1BYBA 1Z9AA 3HTWA 1UC4A 3ID7A 5HULA 1TZZA 1KFEA 1PV8A 1EYEA 3DGBA 2JEPA 3KWSA 4UCGA 5H8PA 5CBBA 5JVLA 4GIAA 4RE4A 1W3HA 3SRDA 1QFEA 2ZXDA 1V6WA 4WX2A 1S5MA 1H7RA 4C6KA 2C13A 1OCBA 1GQJA 2YCIX 2NWRA 4GH1A 2NVDA 1A4LA 3PTDA 3KRZA 5A69A 1V0LA 4IP7A 4ACZB 5HUPA 2OXNA 1R3YA 2E6AA 5EU9A 4AWSA 1UIOA 4DI8A 4HMNA 1H2JA 4Z0SA 3H6OA 5JBDA 3SCTA 1Q7QA 3P5YA 2B31A 3FVDA 3TMLA 3HG5A 4PCFA 2FVKA 4KEMA 1TELA 1X8FA 4BJHA 2OSYA 1TV2A 3LHZA 3WDQA 4MYXA 3VOHA 3SCOA 2OU4A 1MZHA 3QTGA 2AMGA 1GNXA 1Q6OA 2MANA 2OFJA 2QCLA 3PK7A 4O1FA 3H4XA 5I3HA 1GOKA 1W9UA 1DE5A 2AL1A 1G5AA 3BMWA 2X0SA 1E6PA 3GDTA 4RXGA 1WNOA 2W91A 1UZ4A 2G95A 4KIEA 1QPQA 4JIRA 3MM7A 5CJNA 2NV9A 3CL6A 1M1BA 1PTGA 1XLCA 2A3BA 3I6RA 3CAKA 2I17A 4G56A 1C93A 3M9YA 3NEVA 1XI3A 3LM7A 2ZRXA 1JF6A 1U5JA 2FZ8A 1Q6FA 1W1TA 2ZUWA 4D6HA 4D6JA 2UY2A 4GABA 1PBGA 4MWAA 3VKDA 2WMFA 2J7CA 2Y5JA 4HD5A 3UPMA 2PE4A 1FCVA 3FJ4A 3SBFA 3NXLA 5GQBA 3ARPA 4AEFA 3MV01 4C6EA 3RCNA 2XH0A 4ZXOA 1RQHA 1K9FA 3LBOA 4CCZA 4WJEA 5JIPA 5FJJA 1AW5A 3WX7A 5DXYA 1Q4NX 5CSSA 3M5XA 3V16A 4CLMA 4HNUA 1XRFA 3ARQA 4LVDA 5A2AA 5T8GA 4XTIA 2EKGA 3P67A 4MM1A 4AD5A 1A53A 2CBIA 5I79A 4OVXA 5ECUA 2DDXA 1UKPA 5HR7A 4UBPC 3SRKA 1QATA 3QVQA 4JQ2A 1K8ZA 3H7RA 5AC8A 1DVJA 2NUWA 3C0SA 3LM3A 3VGGA 1KFJA 3NQVA 4JQ3A 2W4XA 2E40A 3VDCA 2RH9A 4Z1AA 3WSUA 2H8XA 5CGMA 3G1HA 4AZBA 4B92A 5D9NA 3Q2DA 1D7FA 2O92A 5K4XA 4NXSA 2J8FA 4MNKA 4U31A 3K4AA 4AEOA 3N3MA 3V7PA 1RK6A 2BZNA 4FLSA 4NU7A 2R82A 4WEVX 5D32A 1HG3A 2EPHA 1E56A 2P8BA 3UXKA 2PC8A 3IPWA 2D24A 1WAUA 1FQ0A 6TAAA 1W8GA 1BGGA 3NURA 1TIWA 3II1A 2DJXA 4JS3A 3FJLA 4A3YA 2E0PA 2EHHA 2VJXA 1M65A 3AALA 4HPHA 3CQKA 4MUPA 4NJIA 1RUSA 2ZQ0A 3AJXA 1FWTA 2EPMX 4YYCA 1QNOA 4WVXA 4CKQA 1LQAA 4G1NA 2CERA 4DJDA 4CD8A 4Q4MA 3SEPA 4GRSA 4S23A 1SFTA 1FHVA 2JQXA 4D9PA 3E2QA 1Z3NA 4OE7A 1IHIA 4KWUA 3TJLA 4V27A 4V1XA 3SGGA 4C6FA 3UNTA 2GQAA 1E6NA 2VL4A 3QKZA 4LBRA 1GOWA 2QCHA 2GK1A 2JGYA 4WQ6A 1JZ2A 1S5NA 4W5UA 2QV4A 2YZ5A 3T6CA 2HMCA 3QLDA 1JG9A 3V4BA 1JPHA 3L21A 4IGSA 4B5TA 4G7EA 3VGHA 2W61A 2HBVA 2IKIA 5E5CA 3U4FA 4A35A 2EEXA 1R9YA 4M8UA 2PWUA 2XN0A 3RN6A 4HP5A 1E6ZA 3I3BA 4UZUA 4P8WA 4ZQRA 2FFCA 2W5FA 3DYMA 3T0CA 4IMDA 1AQMA 4DJDD 4CD5A 1E0VA 4GC4A 4QR6A 2KAUC 1E72M 1V02E 3BGGA 3AXMA 3K8KA 4AVFA 3QN3A 3WQFA 2I5QA 2VUYA 3FW6A 3GHUA 3D5HA 3BW2A 3GLCA 2Z1XA 2PURA 1EIBA 2DVXA 1O5QA 3ME3A 3AS3A 4UMAA 4DLMA 3AIVA 3TQPA 2V4JA 2WBGA 3W1UA 4CNSA 1UD6A 1H51A 2Z25A 1ECQA 1JQXA 2OSWA 3W2NA 3CLWA 2QCEA 1AG1O 4L4MA 3T44A 3S1XA 3RAOA 2VHLA 3CMFA 5BXTA 4IG2A 1BGAA 1PL9A 4GG9A 3KL0A 3ZZ1A 3VM7A 1CGWA 3WJXA 2EGZA 4I7VA 3BAWA 4EX4A 3L7RA 1KRBC 4KERA 1MQPA 3OLDA 3VD4A 4WJXA 3P80A 2JE8A 1M41A 1H50A 3LHUA 3AHYA 4Y9MA 4O16A 1G9HA 2JIEA 3TWBA 3LSBA 3SDOA 3N6HA 4I9TA 1NFPA 7TIMA 4AZHA 1KR0A 1O12A 2E67A 3KZPA 1ZCOA 1ICQA 2HVMA 4RZ4A 3OVQA 3W00A 1W5MA 3Q4DA 2J7HA 1GVIA 1DJNA 4R9OA 2XH7A 4OQVA 1H49A 3FSTA 5CZ0A 4PMRA 2XZ9A 4O17A 4GMEA 3FYOA 2A6LA 5HK4A 4C1KA 3AQUA 3P82A 4XWUA 4HSOA 4Q7NA 3WD3A 1ME7A 1I6NA 1SZNA 2BP1A 1VFMA 2A3HA 2DW7A 3MM5B 2D73A 3NZRA 3CHEA 3PFMA 5G5IA 4MWAD 2ZUVA 1V93A 3EB4A 3CUJA 4XBSA 4GZIA 5GJNA 4OZOA 1CW2A 2YW3A 4I7WA 2ALDA 2W63A 5LIKX 5AC6A 1WKDA 3LU2A 1V6UA 3EDJA 4FZIA 4RNJA 3W1AA 1ISXA 1Q6EA 4JIPA 1PX3A 2E5DA 2R94A 2Z1BA 1OEPA 2Y1HA 3CUIA 4ZEPA 1NP2A 3NDOA 2INZA 1DJGA 2W0UA 4DWSB 2A7RA 4B5UA 3SN4A 4PTVA 4I5XA 3MCMA 1EGZA 5KETA 2YB4A 3KHDA 4DO5A 3AUJA 1TV4A 1XSIA 4DRSA 5CGQA 2YL9A 4KIRA 3T4CA 3NZPA 3OZMA 1KV8A 2F6UA 4QG9A 5BW6A 3B0UX 2ZX9A 5EMLA 1WZKA 1I2RA 1F5ZA 5HWJA 1HKKA 4C6IA 3BICA 2ZC8A 3KL3A 2A4AA 2FH6A 2OX4A 2DGAA 2HRWA 1Y7VA 2J27A 3GZ3A 2QDHA 3WQDA 2WSKA 4C6CA 1XIFA 1J2WA 4CQ9A 3GB6A 3ZT7A 2VRQA 4KETA 4ZE4A 1P5BA 3A21A 4JX4A 4Q4PA 4B5SA 5IFTA 3B8DA 3I6EA 1TVPA 4ACZA 4RV8A 4AC1X 1NARA 1VLWA 2RGMA 2ZDSA 4D6GA 4O1AA 4JHOA 5AHIA 2HEJA 4G9PA 1IZJA 1TQJA 3K5XA 4NNCA 4O54A 3HPXA 3LI0A 1JIBA 4G39A 3MP3A 3W4RA 1XSJA 2NT1A 1QO5A 5E1QA 2CXEA 2VGFA 2F61A 3WH8A 3BCJA 1RJQA 4A3UA 5FEWA 4J2MA 1KGUA 3WMCA 1OWQA 3HV8A 4LUJA 1GZGA 3ES7A 3PN8A 1F9CA 2P8CA 4LYPA 4PBFA 3PAOA 4C7GA 1I8JA 4ZOEA 4BF9A 2FTPA 3WIJA 4GPNA 3EX3A 2GPTA 1A5LC 4M29A 4M51A 4ZA0A 4C6QA 1QBBA 2GJXB 3H2NA 4PMJA 2ZE0A 2WB5A 4AU0A 3Q65A 1REQB 5M5DA 3GTNA 4O50A 1Q6DA 3T07A 4ZO9A 4C65A 1US0A 4F3HA 1MUWA 3UPBA 1CLXA 1OM0A 3MM9B 4KFNA 5A94A 3TYBA 8XIAA 4Z1YA 1TWDA 3YPIA 3W88A 4JIEA 1GJUA 1LLWA 1TE1A 2X0YA 1MUCA 2PDYA 5I07A 3TX9A 1HJSA 2ZX6A 3V0UA 4UTTC 3IK4A 1EC7A 1RQEA 3GY1A 1GTHA 3MWCA 1TPFA 1EB3A 2FZBA 1ZZMA 1E0TA 2YA1A 2HDJA 3R7MA 4FR1A 2VDHA 4GYPC 2VVSA 4NILA 1UP3A 3ARWA 1LWJA 1SMDA 3G1XA 4TU1A 4IIBA 4DUXA 4JD4A 3NFUA 2CWNA 3MDWA 3EOSA 1M5WA 5GPRA 5I3GA 3KOXA 1KR1A 1TG7A 2BBFA 3FLUA 1XLFA 4NRSA 2DQWA 3SQLA 4LSBA 1IT0A 4JQ4A 1U5VA 2PP3A 4H9XA 2YL5A 2HBXA 3EMCA 3T0TA 2BSLA 3GK0A 3K46A 4MJZA 5EMUA 5HUOA 4C6DA 1VFOA 2XIIA 3FV9A 4WXZA 3VZXA 4Z1DA 3MHFA 2X16A 2YDSA 3GYEA 1OINA 3G3DA 4J9JA 4IIHA 2HXUA 1K70A 1W3JA 2NV1A 1BKSA 4UC5A 3STEA 3WH6A 4JHZA 4Q8PA 4WIWA 1SM9A 2ZXBA 2O9RA 1S1PA 3HN3A 5C9UA 2FZMA 3FEQA 3QY7A 3MO4A 4GI9A 2D2GA 3AXKA 3TW7A 5DX7A 3FN9A 2OGYA 3S6OA 4GO8A 3T78A 3P8JA 4PEEA 1DJIA 1W1PA 3A22A 1HJWA 1OF8A 5BMXA 3TU9A 3T4WA 4UTMA 4TX8A 1BAGA 4X0NA 4GKLA 4AYGA 1AK5A 4JFTA 5T9CE 7A3HA 2J47A 2A1YA 4L65A 4DO7A 3GNDA 4H9MA 3UVIA 3CIVA 1A5UA 2YXXA 2C14A 5A5WA 4YNGA 1PZ3A 3REQB 3UJ2A 3CIWA 3WBYA 5F4SA 2A7NA 3CMGA 1E1FA 5LXXA 3NQ8A 1E71M 4FR6A 1YDOA 3B03A 4KRTA 2PODA 3LN3A 5ABFB 5LNRA 4E0CA 1VBGA 5RUBA 3AHZA 5HNRA 1P48A 3RPTA 1XD0A 1QVBA 5AHNA 3W53A 4Q6JA 3LV6A 4GIYA 1OVDA 1VYRA 1OGGA 1OFOA 1UWUA 5LSMA 3N15A 1YBQB 3BZGA 1LRTA 4GVFA 3IAQA 3EA2A 4B90A 1PB0A 1R7AA 5IBXC 1UH3A 3UCCA 1E9YB 3ZMRA 3CGTA 1Z89A 2XIOA 3RFAA 2DVTA 2XSAA 2D3NA 4FXJA 1IT7A 1PWMA 4HHLA 1YBQA 3TE9A 2XJ7A 3GVGA 3E0IA 4ZB0A 1PKYA 4AWTA 1GQLA 1KBBA 4IX2A 2X30A 1I2OA 4GUJA 3T42A 4M56A 4P8UA 1NOUA 4F0SA 3T81A 4JL1A 3URAA 1UR1A 1CXHA 1XYLA 2Q3OA 1CEOA 4LAMA 1YX1A 4J4KA 1OFQA 2AAMA 1ZU8A 2XVGA 3SUTA 2HVOA 1LL7A 4WY0B 1HUVA 2GL5A 1UR3M 1GQIA 3UJFA 4GYKA 1HJVA 4FA3A 1QU4A 4AX7A 4EWJA 4HZ8A 1RCQA 4P7RA 4CEXC 4O19A 2XWEA 2XVPA 1LG1A 1EPVA 3A4AA 1GOOA 2OZ3A 3NTYA 5DY2A 1PE1A 1TA3B 1EQCA 2IPWA 1XLAA 2PTZA 1VBRA 3SADA 4TR9A 4UFHA 1MNSA 1Z7AA 1OGBA 3U7BA 1YNYA 4W86A 4K3ZA 1FCQA 2GQ9A 1KTCA 2WSYA 2GUYA 1KCKA 1WZLA 2VDGA 1XIJA 3FY1A 2YKKA 4PB5A 4DZAA 5I2UA 1RH9A 1PUDA 3QQ1A 1UB3A 5D33A 4MY9A 4KPLA 3LLXA 4UFLA 3OIHA 1EJVC 1UBSA 3TV8A 1OK6A 2W9MA 1XYCA 1B0IA 3UY8A 4PUMA 4HNNA 3EPMA 1MNZA 3E9AA 4DUOA 1JFXA 4O53A 4QG6A 1XC4A 5AC5A 2WW5A 4RDZA 4OBSA 5C9WA 4Y96A 5FJUA 2B4GA 4HMEA 1K7EA 1PZ2A 1PWLA 1SUXA 1C8QA 1XGDA 1CXFA 4MB1A 1JDDA 3WK2A 4GUFA 3NWRA 3KVMA 3LNMA 2Y7EA 4C60A 2QUMA 4MYAA 4X2RA 2ZZ5A 4FNSA 4BCEA 1QK0A 3BLDA 4HTBA 3NQFA 2FB3A 3B97A 4I9JA 1XIDA 2BXZA 4KFPA 4AYSA 2B7PA 4IPLA 3QGKC 2WWCA 2VQUA 1U33A 4Z2LA 5FF3A 3DI0A 2VT0A 4GX8A 1BYDA 1C8XA 2C18A 3THCA 1C8VA 4H6KA 1ISWA 4IXXA 4LBSA 1W9VA 5KITA 1JYVA 1X7IA 3VGBA 4XIAA 1KO0A 4OHQA 2CU0A 4MVAA 3N73A 4QS6A 1IEVA 1JI2A 2Z24A 1J5SA 3LG3A 1UMLA 3C2OA 1UW9A 1LOSA 2OCZA 5BZAA 3ZIZA 5CBIA 1KRAC 4RXFA 4P7OA 3LZ5A 1RA5A 3REQA 4QJ3B 3SO7A 4MDPA 3WQGA 3UWZA 2H9AB 1S2UA 3L2LA 3OLEA 2YYUA 3AHXA 2XFFA 4OT7A 1K02A 4NZJA 4G5DA 1WKYA 5LIUX 3C61A 4CCEA 1B3VA 3FYPA 2VFEA 3GS6A 2Q8LA 1KM6A 3QC3A 2Y24A 3M6YA 4HYRA 2FZDA 3BSHA 4DELA 3V18A 4IMGA 1ZBWA 3B40A 4HKPA 3BG5A 1EEPA 1TUFA 2OJPA 3N2CA 2ON3A 2ZCGA 2ZZ3A 4O1DA 4UTIA 3SCQA 2Z4GA 3NM3A 1TPVA 1TYGA 1IIHA 2P3ZA 4LGXA 2CYGA 1W56A 2HK0A 2IQ0A 2YL6A 3UR7A 3RF9A 2IPFA 1TWSA 4NZ4A 3B0LA 1RHCA 2DT2A 3BLPX 1KBKA 4PTDA 1K8CA 1JPKA 4KRUA 4QNWA 1W91A 4IICA 3TA6A 1T0OA 3CB3A 2PCEA 3KW3A 1JDCA 4XTDA 5BCAA 1B9ZA 4AZ6A 5AHEA 4B15A 4C1NB 1SZRA 3POHA 3PJUA 1JXJA 4J3WA 3GG7A 3USBA 2VRKA 3THQA 4ACYA 3K8MA 1EP3A 2JALA 2UBPC 4MJ2A 1V02A 1NOWA 1G01A 4E4PA 4DAFA 4O18A 3GKFA 1QXLA 6ALDA 2DEPA 2CZVA 3O15A 1YPFA 1WP6A 3IGUA 2VEMA 4Q3MA 5FCZA 3IWPA 3FNDA 2V5DA 5I77A 1S2VA 4N7QA 4DVOA 5I3FA 4E3VA 1A5CA 2H6RA 1VC4A 4MNLA 1Q6QA 3CZLA 1HKMA 1JVNA 4FX7A 4HYVA 1X6NA 3TLQA 5TBOA 3HURA 3VINA 3WELA 3ZWTA 2PBGA 2QPSA 5C7HA 4NAFB 1NQ6A 1F3EA 4PBGA 1PCWA 1QOQA 5HNNA 2VCBA 5J5DA 3PM6A 5LKYA 3UYCA 3DXIA 3VI2A 1AJZA 3LX9A 7ODCA 3UWYA 1RPKA 3UW6A 2ZRWA 2ZVIA 1IYXA 4LH8A 1RSCA 2OLSA 1YHTA 3G1AA 4D1IA 1AUSL 5FJTA 1LWHA 1VBUA 1LRNA 3N19B 3HA1A 4JDYA 1E55A 4K8EA 3GHSA 5DXXA 1KCLA 1WOAA 1DQXA 2R1LA 4IUGA 3ARUA 2CLMA 4QXIA 3VOGA 1GKPA 1XBXA 4PB3A 1GW1A 4HCLA 1NF0A 3CPRA 3M1ZA 4BI5A 3OZPA 2AL2B 3VIHA 4A2SA 1V7AA 2ISWA 4IWWA 3L12A 5D05A 3F2BA 1JFHA 1NDVA 4Z2JA 1OFEA 5SWUA 6ENLA 2Y2WA 2BS9A 3G0SA 1OCQA 3W86A 4NASA 1S39A 1YNQA 4Y90A 2DIJA 1E4MM 5ENLA 3N29A 3KCJA 1OFDA 4KEVA 1KBJA 3V5FA 5J5RA 2PDWA 2WMKA 4LAZA 2YIHA 1WYIA 1RK5A 3ZO9A 4QIUA 4PCPA 1AJ2A 4IMEA 4LCQA 4N42A 3TC6A 2PGWA 9XIAA 4GQQA 1QUMA 1DWAM 2HS6A 4LAOA 2YFOA 3MM9A 5I3KA 5A8PA 1EYWA 4LUYA 3ZR4A 2IMRA 3WQWA 2PA6A 3WQCA 1TSIA 1R46A 4K6AA 2X8RA 4D6DA 4MFDA 4K8HA 3GDKA 4TVCA 2XWDA 4S1FA 5FOOA 3W1TA 7REQB 1QAPA 3OO2A 3R6IA 3T9PA 2DZBA 3ZT6A 1D3HA 3SGUA 3L4UA 1PXGA 3WLJA 3V5OA 1YNPA 3VPLA 5CAHA 1ZL1A 1GJPA 2QPXA 3C5QA 3FDKA 3VTRA 3HQPA 4S3AA 4XVDA 3RR1A 3JS3A 3RM9A 3TYUA 2D0GA 1OFPA 5BOEA 5TAOA 3ABXA 5M03A 3KTCA 4MAZA 4H8VA 3QSTA 3R58A 3MW7A 3JZEA 3FX4A 5REQB 4M81A 1XIGA 1SFJA 3VFLA 4Q6XA 2PWHA 1VHCA 3EXSA 4MWAE 3WUFA 3LCLA 1D2KA 3W7IA 2BDQA 3EWYA 1LWIA 3MBDA 4F79A 4AZCA 2ODOA 4A22A 2GUUA 3IANA 2W3ZA 5K9CA 1J0JA 1D9EA 1XF0A 2PLCA 2A5HA 3MVTA 5CZSA 2G3FA 4MKVA 2A6NA 3G22A 2YDAA 2G3MA 4ZQOA 2J24A 1VFFA 1E6RA 1G4TA 3R11A 4C6OA 1B57A 1MXDA 3M0YA 4OUIA 3GSMA 3HV9A 3GBEA 2PDXA 3OYXA 1OIFA 1Q6CA 4JTUA 4NYYA 2FB2A 1VCFA 1ISYA 3AUOA 4ATDA 3IIPA 4NYUA 4YLWA 1YQ2A 2X05A 3VUSA 3B0NA 2WVTA 1LYXA 1VGAA 4HOWA 1ECEA 4HK6A 3WUBA 3GNPA 3V0SA 1IZKA 5A8NA 3GW3A 5AOUA 3B4YA 5C54A 4BZYA 3W1XA 1TPDA 2OEKA 1XC6A 3ABOA 2GUBA 2TODA 5H2ZA 3S46A 4GNKB 1TJ2A 4TXEA 3WMLA 1Q6LA 3OBEA 2XHYA 4AHQA 1DOSA 2X09A 2FQIA 3CEPA 5F2GA 2JF7A 2P88A 3WY1A 2XPKA 3CTLA 3KVJA 2PTXA 2PP0A 4OOUA 1JQVA 4GE8A 1CGTA 3R0DA 4CQCA 1MEHA 3L0GA 3GTFA 1YXYA 1K8XA 3BLIA 4INFA 3LPFA 3DC8A 3C52A 3FGCA 3MM5A 4W7WA 4PGLA 1KFBA 1YXCA 4H9YA 1BG9A 1IGWA 3EXRA 3G1YA 1BWVA 3COTA 2ZX7A 3TW6A 2CFFA 3G0XA 8GEPA 1Q6GA 1TPH1 2V67A 4NF7A 3AWNA 5FEXA 1SZGA 4A21A 2WCGA 1QTWA 5FF4A 4O57A 2UY3A 3QRHA 1GHSA 3WBWA 5B7YA 2NLYA 2QCMA 2R1NA 4ZQPA 1KBLA 4HYWA 2I57A 3T0BA 1X8CA 3FA5A 3BZJA 5T9BG 2ISVA 2NSXA 1UJQA 2QKFA 1XL9A 3GDBA 1AODA 3VILA 3VD5A 1GVYA 4V28A 4F8XA 4XZ9A 4MUZA 5HWNA 3VUPA 3BAYA 1NELA 5I03A 4LS1A 5HPOA 4GISA 3A12A 1TKKA 5HQEA 3GAYA 2X40A 1BYAA 1WZAA 2V69A 2D22A 4ZB5A 2ANUA 3DECA 3SCUA 1NDYA 5AYYA 2QUUA 2DORA 3N6QA 1R3RA 3FOKA 2TAAA 2WZIA 4M7TA 1E6QM 1Y8BA 3BVJA 3CK5A 4G7FA 4EPDC 3VM0A 3HGSA 4LPCA 3KCOA 4JYDA 4XD3A 4ZOBA 3DC0A 1O6IA 5CEWA 3LY0A 4W7VA 2RDTA 2DT1A 3N2XA 2PD5A 4O1EA 1BWKA 2OWCA 1XLGA 4BA0A 1FWFC 2A2IA 1Y5WA 3OTRA 4AEEA 3G1RA 2PDQA 3BLKA 4OV9A 1SGJA 2NQZA 1GYMA 4GUHA 5AZ1A 3VC5A 3UXDA 5GEPA 1VRXA 4IFRA 5E0CA 3THDA 3MTWA 3VAVA 2HROA 4LT9A 3S8HA 4Q33A 3L2IA 1P1MA 3VIPA 2VWSA 1RBOB 2C71A 2GQ8A 4CEUC 3MMDA 4ZGYA 3KTXA 3ENLA 4OUEA 1EKOA 1AL8A 1XDLA 1W2PA 3N4EA 2DZXA 1ME8A 1ZQ5A 3QV7A 1H5YA 3UGVA 1UASA 3POCA 4YTTA 2E7FA 1SZFA 3MY9A 3BSGA 1TMQA 2C3ZA 1Q85A 2J88A 2WVVA 4JQAA 1DIOA 1XYBA 4MAVA 3W24A 2OG9A 4GXWA 3T0DA 3HPAA 1EGVA 2B7OA 4F40A 2C1GA 1EXPA 1V5XA 3TJIA 4LS2A 4C6MA 4YXGA 3M0IA 5JH1A 1FOBA 3WLKX 2C8NA 3ABSA 1LZOA 1GORA 1IXQA 1UOKA 2ZRVA 4RE3A 4IPPA 4H9VA 5EMMA 3W75A 1SPQA 3ITGA 5AFDA 2GVEA 2XGBA 1BHGA 1AZ2A 2PDJA 3ZLHA 2QF7A 5DQPA 3KFTA 2DVUA 4DM1A 4AIUA 1K3UA 4RPQA 1EHAA 3B8IA 4H3DA 4HBKA 1C90A 4US5D 4O13A 2HNEA 5CPOA 3T8QA 1YDVA 1P6BA 2HVNA 4QBXA 3RX2A 3NVTA 3BL3A 4A6GA 3NPVA 3QYQA 2QCNA 1TCMA 4M19A 1JZ3A 2D2JA 4H41A 3L4VA 1R3VA 4F4RA 4ZO7A 4B2DD 3ITTA 5C0QA 4KMQA 2AMXA 1W6TA 4HU0A 1Q8JA 3DG6A 3LUTA 4OV4A 4X3ZA 1MW0A 3DG3A 1F4HA 2DIEA 4JIQA 1R38A 3WK1A 2DH3A 1IF2A 3WFAA 1LL4A 2BHZA 4N0RA 1XRVA 2RJHA 3TAOA 3OEXA 1ZAIA 3MWAA 5JMUA 4UUIA 3VZZA 3ERPA 3UA4A 3DFOA 1TCDA 5HMEA 3GNOA 2J7DA 4JTEA 3QLLA 4GJ1A 4L4LA 1R85A 3C6CA 5D4YA 2DZUA 4DZ5A 3E5PA 3SAZA 3KVLA 5D04C 2Q3RA 1C29A 3MVIA 4KKXA 3W29A 3W6YA 2PWGA 2V38A 4TOQA 4D72A 1CNVA 3VOFA 3WLRA 4E3TA 3M0XA 5A6MA 1CLVA 4FNRA 2YLLA 4RDWA 2LLEA 1IEXA 4R7WA 4GGHA 4B9ZA 4QAIA 2NX1A 4G1KA 4L61A 1S1RA 2X7WA 2WC7A 3QZEA 1DXFA 2VURA 7PTDA 3S0CA 1TMLA 4ECLA 3STGA 4ZL1A 4WCJA 3IJ8A 4RE0A 5M3WA 4KF1A 3WEZA 3LB0A 1I75A 3W7OA 1W1VA 1XWYA 3ALFA 3RYSA 1OBAA 1CCWB 3EWDA 2FDMA 2ZZ1A 3MUCA 4IGMA 3L5MA 1VR6A 1XSKA 3HO8A 3STPA 3E0WA 2VR4A 3QQ0A 1SMAA 3HGOA 4FLRA 5G1TA 4XD5A 2XIQA 2W6RA 1JD9A 2HQAA 4IJRA 3D6NA 3EDKA 4OGZA 4GQ0A 2WVVB 1CXKA 3BJFA 3CZKA 3WD2A 3MM6B 3PR2A 3ZLFA 4MJMA 3WF1A 3PULA 1MSSA 2J7FA 1H41A 1NU5A 1T41A 2FTWA 1QI4A 4HA0A 4F2TA 3BDKA 2UZ9A 4J5NA 4CNOA 3PB2A 1M3UA 1KB3A 2DZVA 3U2ZA 3H12A 3E96A 3B9OA 4MB5A 4QHRA 1ADSA 2WM0A 3EOEA 4UTKA 5BWFA 3E3HA 5GJMA 3MMWA 3WLPA 3GG8A 2Z00A 2XGZA 5AB3A 1EUAA 4LUSB 4L64A 4WUIA 3P62A 4CU8A 4Q8MA 4UIOA 2X1IA 5FF7A 4JEJA 3S6TA 4GJJA 4DJED 3EXTA 2H90A 3FEMA 2FKPA 5FJOA 1PVNA 2BASA 3UG3A 3A9BA 3ZR6A 4MDOA 4N9CA 5K2ZA 1M03A 1Q45A 3GFXA 4XKMA 1G4PA 1IWBA 1Q8AA 2ESCA 3TYDA 3RO6A 5FF2A 3TK7A 3MMBB 3KE0A 3GXDA 5D03A 4MIMA 2WXDM 2ZZ4A 5HINA 1IV8A 2NT0A 3E38A 5IFPA 3NQBA 3LK6A 3VNKA 5HOSA 1VJZA 4NAEB 2WHKA 1WE5A 4HNVA 4IPIA 1YPXA 2A3CA 3WDRA 2HS8A 4U2YA 1U1HA 1GCYA 2DSZA 2IQDA 4TUFA 4M6VA 2NQHA 2PBOA 1U30A 2RDXA 4MZYA 3IRSA 4UQEA 5EFDA 4ZVJA 3L4YA 3LSCA 2FDSA 1TJ1A 1I45A 4PYSA 1SJCA 1WX0A 1N7KA 2OO6A 1KM5A 1AJ0A 3V1PA 2QCDB 3O16A 1BD0A 1TQXA 4ATLA 2PDPA 2VD9A 2FH8A 1CGUA 1OX4A 2QPUA 2PDMA 3KOZA 4S3BA 1OC5A 1K7XA 3SUWA 5EBUA 2VX6A 2GGJA 4GY0A 2J7BA 3FKKA 1MO0A 4UOZA 1E73M 4Z17A 1TV8A 2FLIA 5ABFA 4YCPA 4D6IA 2DP3A 1WV2A 3OODA 4BEUA 1F76A 2DSVA 3BW3A 4TX6A 2DU2A 2Q71A 3O0FA 1EC9A 4O28A 1TV5A 1RV8A 4JCMA 1E15A 4ICCX 2Z1VA 1AW2A 3GR4A 3LI1A 3IEBA 2O9OA 4NP7A 4UQDA 1DJZA 5DEZA 4EPKA 4Q32A 3WLTA 1W3KA 1YPIA 4HTYA 4HNTA 2WQDA 3HFTA 2XSJB 4JTGA 2R91A 4CNPA 3AISA 2NQ9A 4LF2A 1V3MA 2HWGA 3IIVA 3NYZA 4XO7A 1QO2A 4F9JA 3G2GA 2X2GA 2RDWA 3P0XA 3NQ7A 4G8TA 3V1HA 4CD4A 2FMOA 1UD5A 2VYOA 3CWOX 1DP0A 3VX0A 2GDUA 3WBXA 4Q4KA 2HCVA 3GXNA 2V4JB 2KZHA 1OG6A 1X38A 4O11A 1J18A 2F6XA 2GDQA 4HMDA 4J3TA 3AWOA 2Z7KA 4D2JA 2E6FA 4ZTYA 3AZTA 3TKFA 3EOLA 1WO2A 4JN7A 2O9TA 1XLEA 4XVEA 3OZYA 1EJSC 1H1ZA 3F2DA 3WQ4A 3BANA 3GQYA 4BY3A 2E68A 3BAIA 1Q2SA 5ABEA 4PUEA 1A0CA 2VMFA 4DJEA 3PHAA 1B2YA 1JGMA 5GNYA 1RJRA 1QCWA 2XH4A 2B81A 1ZAHA 2NLIA 3ZJ6A 3GUWA 1O5KA 2CLPA 5DT5A 1G7VA 5LZLA 3A5VA 3MT1A 4O4WA 4DBUA 2Y85A 5E93A 1VF8A 1YLVA 3GVRA 3C3NA 3SB0A 5EMJA 4KEZA 4BKNA 1H3GA 1ONXA 4PR4A 1W32A 4FXSA 5IBXA 4HA3A 3DGRA 4MKNA 1CIUA 2NV2A 1C7SA 4YTSA 4O0ZA 1UIPA 3ZFHA 5CCZA 1T99A 1V7YA 2BHUA 1MZRA 1VCVA 3WQPA 1RVKA 3VD7A 4PL2A 2AOSA 2DT0A 3R5EA 1NAL1 4UNLA 4REQA 1KXQA 3THAA 1VYSX 6REQB 1VS1A 4QDMA 3M5VA 4R9XA 4CCCA 1F7BA 3E0VA 8XIMA 1F3WA 3PTMA 3W7GA 2Z2UA 2REQA 5FI8A 2PRLA 4I8DA 4L1XA 3MP5A 1JCLA 1ONEA 4JIIX 1QHPA 4MG4A 1EEXA 1NM9A 3VLXA 2EPOA 1IZCA 4E2BA 3L66A 3FHQA 4LAKA 2Z1KA 1UZDA 1CT5A 3CAQA 1IXOA 4H04A 4BEQA 4IISA 1R7OA 5C70A 2WMGA 2PGEA 4M1RA 3SCVA 1O5XA 4JOMA 2WMIA 4GIEA 3GDMA 1UA3A 4FXFA 3NPWA 2E3ZA 3MMCB 2WHJA 3GU2A 3LHTA 4YWIA 1DL3A 4UTUA 1C9WA 3URQA 4L80A 4ZO8A 4KQNA 1TZ9A 2RHGA 1GQNA 3BJSA 1TRDA 1BTCA 2JBMA 4UOQA 3WH5A 1MYRA 3W28A 2EBNA 2XU2A 1DE6A 3DFNA 3PWGA 3CV1A 1NVMA 5MKGB 2F8QA 3IV8A 4X61A 3MUAA 2GSEA 3N1AA 3B06A 3WL1A 5FA5A 1FX6A 2GSJA 1JDEA 3T8LA 1W9XA 4LV4A 4RZ6A 2BHYA 1EZWA 1UKOA 2F2HA 4O10A 2XYLA 1H0GA 3FGCB 4JHMA 4URIA 1YXDA 4HNOA 1MFUA 1VJIA 9CGTA 4RX0A 1NWSA 4J3XA 5ECVA 3VKQA 2V0TA 4QEHA 2PU0A 2XISA 3MUXA 3PY2A 2ISFA 4LC8A 1YDNA 3CQJA 5KZDA 3L4WA 4OTKA 4ILSA 3ZVHA 3MMUA 4E38A 1ENUA 3RRAA 3S2JA 1EP1A 5CLWA 4QQ3A 1F3XA 5CSYA 3VC6A 2J9ZA 2C1IA 4GK8A 4UNKA 5CZJA 1CXEA 3MC5A 3TCSA 3WCZA 4UTLA 4L6DA 3CS2A 3TFCA 1Y65A 1QPRA 2GVYA 1VFLA 3A13A 5CC7A 1V8EA 1TVNA 1XCWA 3E02A 4JY9A 3W70A 1QT1A 4W4QA 2WSPA 2ZRYA 4A2RA 1J2BA 2HJPA 1F05A 3QF0A 3IK2A 5DT7A 3IVTA 1A5MC 2QHAA 1XX1A 3I3EA 4YHGA 3FKRA 1OYBA 1DWIM 3CT7A 3RILA 2QJJA 1GT8A 4GO9A 5CPNA 4A8RA 1BSLA 5DMMA 1Q7MA 1OX4B 2WOQA 1MW2A 3W72A 1POKA 2J25A 5AC4A 5H91A 5L6UA 2OQYA 4TX9A 4Y7EA 2H3DA 3H21A 1GEQA 2PB1A 2V63A 3OG3A 3NPXA 3EGJA 1XLIA 1OFAA 1EA9C 2ZX5A 3LCGA 5EL1A 1KNWA 4CNTA 4HHHA 4RUBA 3O6YX 1VRDA 3IARA 5BRBA 1TFVA 4Q8NA 2E8ZA 3P7YA 4XAPA 4KEUA 3KOFA 2QUNA 4P5UA 1JPDX 2OYKA 4WF7A 1XRTA 5AYZA 1ZHAA 4LCRA 3HG2A 3MJYA 4FSAA 3GAKA 1OHLA 4L56A 1ZJAA 1A5BA 4WD0A 3WNLA 2ZFAA 3ARRA 3IGHX 2XDFA 2VEIA 1PJ9A 4IPJA 2POTA 1E1CA 3B9AA 2WCAA 1MWOA 3B8VA 2P0IA 4Y9AA 2IKGA 3N3TA 2WO5A 3B9NA 1YE4A 4H4IA 3BARA 2Y8UA 3R89A 3VIJA 2E9MA 3WENA 3TROA 3HPFA 4NQ1A 3ORWA 4KCVA 3MU7A 5I23A 4YYFA 3SIZA 1E5JA 3F5JA 1UC5A 2G0WA 1XBVA 1XR2A 5I24A 3KUMA 3GTXA 4DO4A 3GBDA 4N9EA 1YTDA 1IXNA 1HL8A 4S3DA 4UMBA 1SJDA 4ZMGA 2R8WA 1F73A 2J6VA 1AA1B 3SUSA 2I9UA 1XQLA 1E9IA 1FH9A 1NDWA 3KWXA 1OJXA 3VNMA 3DESA 1E3XA 1A0DA 5E9AA 1ZJHA 2V5JA 1FWJC 3UJRA 4IJCA 4ZB2A 1S2WA 3ZJ7A 3LCWA 3W07A 4FAMA 3WLMA 1JDAA 4PUDA 3HF3A 1OGSA 3W2LA 8RUCA 1TRIA 2HPIA 4H8HA 3VNLA 2YX0A 4JFUA 5HMFA 4Q8OA 4G6CA 3N2OA 4J27A 1SO6A 4V33A 3TDFA 1DORA 1W8SA 3VZYA 3B04A 3WBEA 1P4CA 5EMKA 5DN1A 2DY3A 6GEPA 3C2RA 3MUY1 3ATZA 3OBAA 3F4WA 3ZVHB 3QFWA 1SQ7A 3I7SA 4J3VA 5HQLA 2CKSA 4MY8A 5D2XA 1I60A 2PTYA 4E5TA 4Q7IA 1UWQA 3KTSA 3BCFA 4YVXA 3IJIA 4EP8C 3T1GA 3T2OA 4KFOA 1UUOA 1CXLA 4DAIA 3UETA 1FBAA 2BGQA 2BY2A 3CO4A 2PCQA 2X0HA 3PG8A 4QJ1A 3V75A 2VX7A 4U5KA 3QXBA 1KFWA 1FP8A 3TQ0A 3R1ZA 3GG0A 4ZOAA 4JYEA 2RAGA 1PHWA 2WLZA 4JTAA 4YTQA 3AS2A 3H22A 4TO8A 4BFAA 1XBZA 1EFZA 3AS1A 1XHGA 4B16A 1S2TA 1OD0A 3LPOA 3B0GA 1RALA 2VEKA 2J78A 3DHFA 5LNWA 1GYNA 2GVGA 5AN7A 1FH7A 5AHLA 3HIJA 1VBJA 3UU0A 4ROPA 3MCNA 4WY0A 3AMCA 4NZ1A 3PSWA 3VGEA 5H8UA 3CLMA 5LGZA 7TAAA 3W6MA 3MUZ1 3K4WA 3IGSA 1LCOA 4JFVA 3UR5A 2PC4A 2ZVRA 2VFFA 3JUGA 4A29A 4GUIA 1GG0A 1YMYA 4B4HA 1K9EA 3L4TA 3LXAA 2E8YA 1Q65A 5CC5A 3O6AA 5A8OA 2G37A 2B7NA 4GY1A 4PUJA 5C8BB 4OWGA 4XAGA 4FK9A 4US6A 5A8MA 3O9NA 2YZRA 1PZ1A 2PZNA 1JYNA 2UWFA 3AMGA 3FYYA 4DZHA 2E5CA 3GC4A 5ABGA 4H7ZA 1EJTC 5FIPA 3VKBA 1WBJA 4GZJA 5HJLA 3UWEA 1QASA 4X9YA 2AKJA 3A47A 4QSFA 2J77A 2VC5A 3E2SA 4JR5A 3AZSA 3RK8A 4S3KA 4W5ZA 5G4HC 4U3AA 2WWDA 1OC7A 3VLYA 1EDGA 2VRJA 3BC9A 1GZJA 5IDIA 3PFRA 2WSQA 3KXQA 4FIRA 1QDSA 5BYWA 3I65A 4MF4A 1E0UA 3LQGA 3AU6A 2EO7A 1BRLB 3GNNA 4ZZ9A 4DXKA 3AYVA 1GPFA 3BLFA 1V6TA 4L9ZA 1SFLA 1P6CA 1KM3A 1HL9A 2NW0A 2OKOA 2YCEA 3ZJKA 2CXGA 2ACQA 4QJ5B 5J8LA 3PNUA 2A79A 3VMOA 3UF9A 3D0CA 3VIGA 2BVWA 4P7NA 3SJNA 3B0XA 3IJDA 2YBVA 4B2DA 1VAHA 1GVOA 1TO3A 3R13A 4MPKA 3SW6A 1OCNA 2AOPA 1WKEA 1IR2A 3OPSA 4I7UA 4Z0JA 4RNHA 1GGOA 4TV6A 4XSMA 3PZMA 4GXPA 2IUZA 2V3EA 4DX3A 5MHBA 4CQBA 1IWAA 4I3GA 4C7DA 2WPBA 1MDRA 3RNDA 3A24A 4YVPA 2OZ8A 1VFUA 2AQVA 2FYMA 3N18A 5G1MA 4PMQA 4WHBA 3E0LA 3ARZA 5I3DA 3KDOA 4EXAA 1GWJA 1AMYA 1NWUA 1AL7A 4R27A 4O4VA 1S5VA 3W9ZA 4E2OA 3I4EA 2CESA 3NQCA 2PEVA 1ESWA 1O68A 2PLMA 4IHCA 3LCFA 4D6EA 1OD8A 3CHCA 2C79A 4RZ5A 1A50A 2EF9A 3NO1A 4K7YA 5BXSA 4KCTA 3HFYA 1J8VA 1TE6A 3S42A 1KA9F 3WDPP 4KGJA 4C6JA 4P8XA 3TOPA 4CN6A 3VKPA 3QV9A 3QPZA 3D3FA 3OA5A 5MF5A 5KMYA 3GH7A 3M0VA 2OEMA 4DJEC 3OIXA 3LS9A 1K77A 3RR4A 2PGRA 4DY1A 3SN0A 5AKQA 1C3FA 3WFLA 2ZUNA 5XIMA 1ODUA 3VXGA 2DUZA 5HATA 3L67A 4JX6A 1X6LA 3RLUA 2C6QA 1L2UA 3EA3A 4PUWA 1EGMA 1UKTA 3HPSA 1JNDA 4NUWA 1QW9A 3DKLA 1KTNA 3Q94A 1YTEA 4NJHA 4FI4A 1V3KA 1ZNNA 3BLLA 1PEZA 4FOKA 1O1ZA 3UZXA 1H4PA 5A6BD 3AIRA 4HJFA 3S6DA 3I3DA 3UZZA 4NG3A 4M7SA 3GXIA 2DUAA 2OO0A 2CLOA 5FJPA 1OX5A 4ZR8A 2QZRA 1EX1A 3NL2A 1ADOA 4DNMA 3NZGA 4N9BA 5I02A 1V51A 2J4GA 3ITYA 1E9ZB 2IQTA 3QMSA 1XKYA 1CI1A 1C9DA 1ICSA 3IACA 4O14A 2PDBA 3LDVA 1PX4A 2CHNA 3VKSA 2A21A 3GHTA 2O4QA 3DHDA 3AZRA 3TJXA 6REQA 1V0KA 4DQWA 1UH4A 3BXWA 3LCHA 3IJ9A 5M1TA 1XLLA 4IXHA 4F2BA 1H7WA 1RCOB 2FGBA 4DPQA 4I9MA 2GGEA 2EPKX 3N17A 1U22A 1I1WA 3R94A 3TXZA 1BRLA 5EGRA 4GYFA 3BLEA 4AF0A 4C6BA 1HO4A 1XJBA 3ZWSA 2EJAA 2YCJA 3LHWA 5FD0A 3TVAA 4DJFA 4MSSA 3PZUA 3GZAA 4YN5A 1JNEA 2EKCA 1KW1A 3TYZA 4ZO6A 4IFOA 3H2MA 4GNJA 1ZJ8A 1SYTA 2Y7DA 2DZWA 3DIPA 3UZYA 2W79A 1QWKA 1TTIA 1XLBA 4ZTXA 1V08A 3TR2A 3CBWA 4JBRA 2YCLB 1H5VA 4GBDA 1UR8A 2CZ5A 3CZGA 4FX6M 1XUUA 3F5LA 3FSUA 3P0WA 4W87A 5CJMA 2PTWA 3CV2A 3RM8A 2WV8A 2EPNA 4GACA 4AVOA 1J11A 3OW1A 1FY6A 5J04A 3CTTA 2KX9A 4EF9A 1TPUA 5CLTA 4LV9A 5FJRA 1GOMA 6A3HA 1PO9A 1OFBA 5BU9A 1LUCA 2AQWA 3MMCA 4WJ8A 1TX2A 1OABA 2ZUMA 3BSMA 5CGTA 2G4JA 2Y61A 1GVRA 5M2FX 2QXWA 2RDUA 4FALA 1F6PA 3SSZA 2MNRA 4J7RA 2MUCA 3PTQA 4AAJA 4F0MA 3S2MA 4XAZA 4AD1A 4WOZA 3DAQA 5CJ5A 1VPXA 1VCGA 2YDRA 2E09A 1AOPA 1KM2A 2W92A 1Q5MA 3RITA 4E8GA 4UQBA 3FFSA 4AZ5A 3AROA 1VZWA 3W2KA 2VUNA 4WRHA 2JK2A 2R14A 4L6OA 3UJEA 3TN5A 4YTRA 4LUTA 4QNEA 5ABHA 4W8BA 3NL6A 4WKHA 4DN1A 4XO6A 3TJ4A 1MI3A 3W2MA 2EG6A 2XSJA 2WJEA 4Z2HA 5DANA 4JKLA 4ERGA 2C1HA 3W1QA 4RNIA 1ZY9A 5FESA 3EWUA 2EG8A 1GKQA 5D30A 3NZ1A 3USZA 3VIIA 1P43A 3V5CA 1EC8A 3P61A 4RJEA 4Y9PA 3VLZA 3ZS4A 4UR7A 1PPIA 2XM1A 1VKFA 1ML1A 4JFSA 1JRBA 2FJKA 4BS0A 3WQEA 1P0BA 5FKYA 4AISA 3QR0A 2HXTA 3F1QA 2INEA 4NJKA 3GFZA 4IQLA 3CV7A 1PS9A 1WA3A 2QNEA 2ZA2A 4GINA 2D0FA 3RM4A 3G1VA 3P3BA 4LX4A 1W5NA 3S4TA 4FF5A 2R6OA 4KT2A 1ADDA 2O7QA 4MGGA 3DFYA 1N8FA 1A47A 1LL6A 1B4EA 4HOXA 1J6OA 1JR1A 5REQA 3TSDA 3VD9A 1QOPA 3PZOA 2V3DA 2WK2A 1E0XA 1WCGA 4D8LA 2Z28A 4ZE5A 4LRSA 1SSGA 1P1XA 3QY8A 3W7HA 1A0EA 4IMCA 1QPNA 2RJGA 3SCNA 5HJXA 1SVDA 3NQEA 3QQWA 1Q66A 1WXZA 1PTAA 3OR1B 3ZR5A 2BVYA 1W5PA 3B0HA 3FAWA 3AMKA 3NJ3A 1F4AA 4LAUA 4XB3A 1ZBVA 5A8QA 2NUXA 4N6FA 4AUBA 1JCMP 3MSYA 2J75A 3MZNA 4IIDA 1ODZA 3KBJA 4XBJA 1DWGM 3O05A 3PBUA 2PTDA 4TQTA 4M82A 3B05A 2I1OA 3VO0A 1WAWA 4NX0A 3AC0A 1V3IA 2OSXA 1YKWA 3NAVA 5E9XA 4B3LA 5K3VA 3ABQA 3VU2A 5KZMA 1ZP3A 3VIOA 3E5BA 4L9YA 1NEYA 1W1B1 3EDDA 1CXIA 1WKFA 3C2EA 4JL2A 4DBWA 2OZ0A 1G94A 2HE5A 2CLHA 3GC5A 3MANA 1L2QA 5DMYA 3VOJA 3AHVA 3R0UA 1YIXA 1ITXA 4HZ7A 4E2VA 4ONVA 1DKWA 3P93A 3W0KA 2ZBTA 4MLRA 3BG9A 1XH0A 2YLAA 3ANVA 3G77A 3QHNA 4U33A 4DM2A 4C91A 1HX0A 3J7HA 1PCKA 1LQ2A 1MRQA 3H70A 4U4MA 1K03A 1PYFA 4EXQA 4A8IA 4NXKA 4WDXA 4YU1A 1A5KC 2G3IA 1X97A 3FJNA 3ARSA 3OZOA 3LNPA 3OLIA 3TZNA 1LJYA 1UWRA 2GOKA 1QI0A 5I7GA 1KQYA 3KRSA 4GVHA 3DBPA 4JDBA 4B5WA 3M0HA 4N2YA 5KZEA 1IEIA 5D8ZA 4X63A 6TIMA 3TW9A 4DNHA 3TSBA 2WNWA 4JTDA 1EHNA 3DDMA 4UR8A 4D6FA 4HNLA 3DX5A 1XINA 3KBMA 2GJXA 3SGZA 1M01A 4Q8VA 3M7WA 3U6WA 2ZOXA 2JKEA 4TVUA 4C6NA 1A3WA 4PRWA 1C91A 3QPEA 1Z6KA 3NQ2A 2J66A 3O2LA 5CPLA 4E4FA 9RUBA 4AHOA 3GEOA 3QW3A 2VENA 5LNSA 2ZUTA 5C2GA 2I56A 2ZYFA 2PF8A 3DEQA 2GLKA 3KRBA 3QHMA 5EPDA 3U8GA 3MM8A 2FPVA 1B4KA 3CZ8A 4BF5A 3N12A 2VCAA 3CPUA 1JCTA 1BXBA 3S1VA 1P0DA 3UD6A 1FFQA 3MI2A 3MMTA 4EAMA 3S2CA 4FOJA 3HZ3A 1OZMA 3OR2A 2BVTA 4P2VA 4Z2IA 1HIZA 1HTIA 3BH4A 4QLLA 7CGTA 2H9AA 1FFRA 2HSAA 2VEGA 3TTQA 4IIGA 4UWMA 2NVAA 1CDGA 1MW3A 1W17A 1VIWA 2PD9A 3K13A 3BGAA 3W27A 4F0LA 1RQBA 1R86A 1XLHA 1JUBA 1X98A 4B3KA 4JX5A 3W22A 2VX4A 2VQTA 3OGSA 1JDFA 4IGNA 1QI5A 2YXOA 1XW8A 4J1OA 3LENA 1YADA 4HN8A 2GQ3A 1GVEA 2CW6A 5G2WA 2O56A 4X9SA 2PDHA 5HNTA 2NWSA 5F1VA 2XIMA 2UY5A 3CHDA 2O4MA 2ASHA 2NX9A 4AY1A 3GH4A 3C2VA 4EACA 2G97A 2GJPA 4YJ5A 3WL0A 2OR2A 2P3EA 1QPKA 3MCOA 1CB7B 4N4PA 5E09A 3G6LA 4AF0B 3PBVA 5IDZA 4WZHA 1EJ7L 1IEQA 2OYLA 4JXCA 2F2KA 2CLKA 3RU6A 1FHUA 3GNRA 4XKYA 3LMZA 2PRMA 1TTJA 4PUKA 4PBEA 1UHVA 2R9RA 3NGFA 3VE9A 3B8UA 1VPYA 1EOMA 1E1EA 1UR0A 2V3FA 5C71A 1ZCCA 4S38A 5A3HA 4WGHA 4M80A 1TJPA 4RW5A 2WNQA 1N82A 4LC6A 1CWYA 4QQUA 4MY1A 5CPMA 3PJWA 4JN6A 2PWVA 2TYSA 4Z2KA 2JKPA 3GRIA 1P6WA 4BF7A 1JYXA 3C0QA 3MS8A 4HT3A 2OB3A 3G6MA 4C5YA 1SR9A 2BNJA 2ZWYA 4O52A 4B5NA 1X39A 1DQUA 1F74A 3DENA 4LRTA 4A8NA 1DJHA 3UQNA 4WOQA 4PC8A 1Z42A 3DFPA 3C0JA 2XM2A 3MUIA 3PWIA 1D3GA 4RDYA 4PCTA 1SW0A 4AWEA 4XSLA 3RCYA 3CQIA 4A8LA 5FSEC 3LV5A 3S1WA 3A3HA 1RJPA 2YFNA 1IIGA 3MYOA 2DUXA 3W76A 1ZGDA 1EP2A 4ZCWA 3QV8A 5EKYA 3ECQA 2GWNA 2OGJA 1EWDA 4GFIA 3W87A 3QGVA 5GJPA 1JXKA 4M0XA 3NDYA 3GG1A 3ANUA 3AXXA 3BWWA 2R1MA 4KBXA 1EDQA 2C7FA 3SRHA 3S5ZA 1D3CA 3V36A 2V30A 1B3ZA 1BFNA 4JNZA 4R53A 4IQJA 2BXVA 3AYTA 1NY1A 3KOWA 4HIBA 1VFTA 2IPGA 3CWHA 4UTHA 4LB4A 1J0YA 3Q45A 4AD2A 4DF1A 1RR2A 1GVFA 2YCLA 4F2UA 5H6HA 3EX1A 3LYEA 1JRCA 1UD8A 5LYRA 3N13A 4CCDA 3KBWA 1P7TB 5D8WA 4X0VA 3LHYA 3CQ0A 1AMKA 3TN3A 1WDDA 1O94A 3LQLA 4MNMA 3WK3A 2YA0A 1GK8A 4Q8TA 1DIDA 1A49A 4TMBA 2PSNA 3L65A 3CT2A 3IAPA 1FDZA 3TN6A 1FDJA 3VK5A 1ZP4A 5G2HA 1T8QA 1FWGC 1EO7A 5HPCA 3PZVA 1JJKA 2PWDA 2VELA 3CC1A 3W2UA 1WXJA 3WLLA 3HQNA 3WG6A 1PX8A 4CQ8A 4HQVA 5JBEA 4PSPA 1JCYA 1G7UA 4J3SA 4HN4A 2D23A 2I14A 5GVJA 1KLYA 4F0HA 3WQVA 3P81A 4R5EA 3OJGA 4PTXA 2YW4A 4LXFA 5G4EA 3VDBA 2ATSA 5DCEA 2QCFA 4L1WA 1R30A 3P60A 4IIFA 4K38A 3KM8A 1XM3A 3L4XA 3FK4A 2CBVA 2BGNE 2BOGX 1QNRA 4WR3A 3W1NA 3DG7A 1RVGA 3AHTA 3W26A 7XIMA 3SQMA 3AXIA 3M0MA 2BB0A 1RY0A 3PP7A 3MV11 5HMSA 3RPDA 3SURA 3SY5A 1WDPA 3GKAA 3DYPA 3UERA 1W9PA 4QJ4B 5K7JA 4FEZA 1X1OA 3MHGA 4EPEC 1H7XA 3MDUA 5AYBA 4QROA 1L6WA 2FHCA 4EPBC 1JPIA 2GEPA 4ROQA 5FAJA 4L1GA 4ZODA 1ITQA 2AGTA 3OP2A 2OKTA 2V2HA 5IM51 4CN4A 3N4AA 4IFKA 4PN2A 3MHUA 4DWSA 3U9IA 4PMDA 3DCPA 3CH9A 1EO5A 1AD1A 5HNUA 3KLLA 3BOXA 1ZTVA 4IGHA 5DO8A 3T2QA 3TYAA 3TYEA 3BAJA 2XTKA 2VZOA 4OJYA 2WZMA 2ATMA 3MMAB 4XZMX 2QIWA 1US3A 1B1YA 1J6PA 3EDFA 3SCRA 1TWIA 3XIMA 1WXYA 2WHMA 4ASTA 1XIIA 3M43A 1QNSA 3FVMA 4W8LA 4UZSA 5U4NA 3HB9A 4C90A 2WNZA 4S3GA 3TNOA 2J7EA 1KM1A 4HVXA 1UWSA 3EWWA 2ACRA 1QNQA 3CIXA 3ONBA 4PZVA 4DWSC 2QJMA 2CLFA 5A2CA 1QBAA 1PHQA 5I06A 4EK7A 1UUQA 4QCFA 3QH2A 4RCXA 1MMFA 3BURA 3HJEA 1J5TA 3PZGA 4HZ6A 5C2XA 4HPJA 5FL1A 1GOXA 2CEQA 4ZENA 4WXYA 2VC7A 1QPOA 3UWWA 1UJPA 2TRSA 2JIWA 1XICA 3R0KA 2Z1SA 4ALDA 3H7UA 4FNPA 5I3IA 4M5PA 3SUVA 1CENA 3U2CA 5I5RA 2VKZG 3PPHA 5KEZA 1GZ1A 1GVQA 3KAOA 4ML4A 3BG3A 2G4FA 4RL3A 2YSWA 5LIYX 3SZ8A 4AIBA 1PYMA 1Z41A 3DUGA 2NQ5A 1DHKA 3QR3A 5JBFA 3MM6A 2BVDA 3AOPA 1LDCA 2EJ1A 4L6HA 3LBMA 2OWWA 1WUFA 4S3FA 4P7QA 2ZDRA 3W84A 2OELA 4C6LA 3U2EA 1E51A 2YL8A 1DIKA 3SSJA 3LZ3A 2D2OA 3MSGA 2YBUA 1JYWA 3W37A 1REQA 3UWUA 3M0JA 3VM5A 3NQDA 5LA0A 2D0HA 4HGXA 1QHOA 2GDVA 2WNNA 3TTYA 1SW7A 3UWQA 1G0CA 4H2HA 1R6WA 3NQMA 3NXFA 2CLEA 3P14A 4QISA 1EPXA 3BTNA 2XN2A 4YMZA 3T7VA 1R3WA 3UESA 1SR0A 1H61A 3OQEA 4LCSA 3FIGA 5AHFA 1HQTA 1KBIA 3VGFA 3VM1A 1XIBA 3VKCA 1V4YA 3U4AA 1H63A 6XIAA 1XYFA 4F66A 1XS2A 3O06A 4XD4A 1T40A 3WMSA 2WZHA 1OY0A 3PC0A 4WDWA 1IT8A 1ZENA 1BLIA 3NA8A 3GDLA 2NSOA 4BQ2A 1E1CB 5HBFA 3H2AA 2I16A 3DFTA 1Y5XA 3UJSA 1MQQA 1DV7A 1EBGA 2CITA 1TV3A 2PUZA 3KBSA 3CHVA 3WNOA 1H7NA 1QI2A 4GWEA 4YS1A 3LGDA 3AIQA 3K8LA 1FWEC 2PLKA 4AOPA 2XSXA 3A4XA 2GSHA 2VGBA 4WSKA 2YB1A 4ZQCA 3QBUA 3RG6A 4GVGA 1L8NA 2FMNA 3KL5A 3U7VA 4KWOA 4XAYA 3ABZA 4JAWA 4WY0F 5H1WA 3WLOA 3DHUA 5PTDA 4RW3A 1XQKA 4RK8A 2B0MA 3PZQA 4M24A 3WEOA 5A6KA 3W38A 1V6XA 2I5GA 4GLEA 1U1UA 3LEPA 3QW4B 1HP5A 2ZTKA 3W01A 3M0KA 1RZMA 3OGVA 5DRCA 5FSDC 4CVUA 5CPSA 4M6PA 3APYA 4JTJA 2W67A 1Y5VA 1B90A 1KLZA 1Q7ZA 3D47A 2G96A 3BE7A 3A5FA 1ITUA 5B7ZA 1EXBA 2V5CA 4UFKA 3VKKA 4XBKA 5JH2A 2VOMA 4CQDA 3PJXA 1Q13A 4GKTA 3UY7A 3ONCA 1NTHA 3K1DA 3B0PA 1JCNA 3ALGA 3KEHA 3UZ5A 4MNJA 4JPGA 3OYZA 3TA9A 2QQ6A 3FJ6A 5AC7A 5CG0A 8TIMA 3LERA 3U2OA 3W6LA 2WKLA 1J0KA 1PZ0A 3RX3A 2PDLA 5K9XA 1A5OC 1O4UA 5D37A 3UPWA 2PRHA 3WEMA 3AIBA 4QGCA 4GGBA 1PIGA 2Y6ZA 5A8GA 4TVDA 1ZJIA 3A3XA 3IV3A 4JZ5A 3D3AA 2CHOA 2RFGA 5LIWX 2Q09A 4I8YA 3DZ1A 3KOYA 3MSRA 5AYXA 2VOTA 1EOKA 2CZFA 4J3ZA 3PG9A 4CNUA 1AVAA 2ACUA 3T55A 3EB3A 3VNYA 1W31A 5CPTA 1OX6A 4PMUA 4KS0A 4LVAA 4LVGA 3S9YA 4W9TA 1SJBA 3RDKA 4QS5A 1DHPA 1GONA 4GQGA 3WLQA 1I9CB 1XLJA 3OQ8A 1PKNA 4IMFA 1UR9A 4FIQA 1HT6A 2I9EA 1KC7A 3R2GA 1LRQA 2QV5A 5DRIA 1AFSA 2ZICA 1W3LA 4LUIA 4LYQA 4AY8A 4Q8QA 3WJWA 4EIVA 1BPLB 3WUEA 1VEPA 3ARXA 1H7OA 1JPMA 1V3JA 2O7SA 3IUDA 5I09A 1IGSA 2OX1A 5LHEA 1TMHA 1ONRA 2YDQA 1T6MA 3GYCA 5I6SA 3GE7A 5F4XA 1KCZA 4EKJA 3S1GA 4IT1A 3WQ8A 2VVNA 2J9YA 4JEQA 3KLKA 4AW7A 3DKJA 1W3TA 1V0NA 1JCXA 3KZSA 4NZCA 2HV5A 3K4DA 1EJWC 4D8ZA 2TSYA 4QCEA 1H7PA 2OT1A 3ZXWA 3BOLA 4MFEA 4ADUA 4DIAA 1X96A 3NUKA 2PAJA 4GQRA 3MKCA 4DB7A 3IRDA 1H0IA 1KM0A 2REQB 3S9ZA 5CPQA 3ZSSA 4O1BA 1OC6A 3UXIA 1O66A 4QSHA 3V35A 2POZA 1E70M 4S3EA 1XRSA 1OB0A 3LD5A 5HDRA 3NM1A 4GX9A 4FPSA 3JVAA 2Z6JA 4REQB 3GO2A 3WDJA 1W1A1 2YPIA 3WYZA 4GC3A 1Q3NA 3APGA 1OQFA 5TNVA 4NL1A 3FA4A 2O0TA 3BCDA 1XD1A 1D8CA 3MMAA 2VNCA 3G8EA 1HXJA 2WHLA 3AICA 3GTIA 3KRUA 4MJ4A 4YHEA 4V2XA 3N04A 4X2PA 3NL5A 1QMLA 3UNDA 2D69A 5JXQA 2CHRA 3UA3A 6PTDA 5JQ9A 4K2SA 3WUGA 2G50A 1R87A 1JZ8A 3GVQA 4ERAA 3EEZA 2QIIA 4UFMA 3E0FA 4DUVA 1CPUA 3WNPA 1HW6A 2DV0A 3PUOA 4WKAA 3IUHA 2DSUA 1FKWA 4DLFA 3EEGA 1TIMA 4QE5A 3CM4A 3VIKA 4K37A 3A23A 1DJQA 1UG6A 1ZSXA 4LNYA 1BF2A 1T96A 3OVRA 1M53A 1LBFA 3ABRA 1GW9A 3S5YA 2Z2BA 1KKOA 2B7QA 1KWKA 1GPWA 3HBLA 2ZUSA 2WVUA 3P84A 1A5NC 3ICJA 4RKAA 4UTWC 2VEPA 2CLLA 3RLHA 2X2YA 3F5KA 1H11A 2BOFX 3AU2A 4UQCA 1BF6A 2V2DA 1XIHA 3N9SA 2ONEA 1ISZA 3TP4A 1UROA 3EX6A 3NPUA 2BLEA 4AZCB 2G3NA 1KRMA 1R5YA 3AO0A 1E4IA 3MJMA 4S3CA 3ATYA 1F3TA 1FWCC 5D2VA 5XINA 1K7FA 6CGTA 1MXSA 3TAKA 4IP4A 3U5UA 2Y7FA 1J9YA 3BQ5A 1WOBA 4JIHA 1VEOA 2VXNA 3BGJA 4IJBA 2BX7A 4C7FA 1B3OA 5D9OA 4RZBA 2VFIA 3M5ZA 3K2GA 2OLAA 5I78A 5TD4A 2WAGA 1IR1A 1WQ5A 3W1MA