4S3CA

Ispg in complex with epoxide intermediate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
402
structure length
401
Chain Sequence
b'GMRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Oxidoreductase
total genus 138
structure length 401
sequence length 402
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s3cA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s3cA02
1AOPA 1AJ0A 4DJFA 2AOPA 3VLXA 3H22A 1Q7ZA 4MWAA 3H2FA 3MCMA 4AOPA 3MM7A 4MWAE 3V5OA 3MM6A 4S3DA 3OR1A 4O0QA 4DJEC 3VKPA 3AOPA 3MCNA 3OR2A 4GEPA 3H2AA 3TYUA 3MMAB 4D9PA 1TX0A 3MM9B 3H2EA 4S3CA 2DZAA 3MMBB 2XSJA 4G39A 3VKSA 4S38A 4DJDD 1Q7QA 3B0MA 3MMCA 2V4JB 1AJZA 3H26A 3H21A 5AOPA 2YCLB 4S3AA 4DJDA 4C1NA 2E7FA 3BOLA 1AD1A 4S39A 4S3BA 4DJED 4DJFC 4S3EA 2H9AB 1ZJ8A 4D8ZA 3BOFA 1EYEA 4DJEA 4HTRA 2YCKX 3MM8B 2XSJB 2DQWA 3B0JA 2VEGA 4HB7A 5JQ9A 3TYZA 4CCZA 4NILA 4D8AA 4DB7A 3MM5B 3H23A 2Y5SA 5GEPA 4DAIA 1Q7MA 3MMAA 1Q85A 3MM9A 2YCJA 4G38A 3MMBA 2Y0FA 2VEFA 1F6YA 2GEPA 3VLZA 4DAFA 3VKRA 3H2OA 1AJ2A 3B0LA 2V4JA 6GEPA 4MWAB 3B0NA 1ZJ9A 1AD4A 4O1FA 3MM7B 2BMBA 2YCLA 3TYEA 3TZFA 3MM6B 3OR1B 1Q8AA 4MWAC 2AKJA 4NL1A 1TWSA 3OR2B 3GEOA 4NHVA 4O1EA 3B0HA 2VP8A 3VM1A 2OGYA 4S3FA 3K13A 3TYAA 7GEPA 1TX2A 1TWZA 3MMCB 4S23A 2YCIX 3MCOA 1TWWA 3VLYA 2Y5JA 4G9PA 8GEPA 3H24A 2H9AA 3VKQA 1Q8JA 4C1NB 3MM8A 3H2MA 3TYDA 4DJFD 3TYCA 4DJDC 3TR9A 2DZBA 3H2NA 3B0GA 3TYBA 3TZNA 4PZVA 3MM5A 4NIRA 3VM0A 4MWAD 3VKTA 3NOYA 3H2CA
chains in the Genus database with same CATH superfamily
4OBRA 1U30A 1IXNA 5F7UA 5HUPA 3TYUA 3UNDA 3IGHX 3WSUA 2HJPA 1O5QA 2WCGA 3GHRA 1DQXA 2WKLA 1FHDA 3TTEA 3BZGA 5C7HA 3GDLA 1MZRA 2Z27A 3S6DA 3BH4A 2BOFX 4O1DA 4NJGA 2CERA 3UCCA 3L4ZA 1H7WA 1BVWA 4TO8A 2ZZ7A 4HJFA 2OG9A 3M0VA 4PFHA 1S3HA 3F03K 4UTWC 4LCQA 4ZB0A 3K2GA 3AIVA 4HNTA 1VCVA 2CLFA 3FYPA 4LF2A 3S9ZA 2WANA 3MDWA 5CGTA 1H5VA 3TFCA 1YXYA 1LOQA 4GFIA 1WPCA 2YL8A 1TJPA 1KM3A 2FTPA 3H2OA 3WQCA 3FGCA 1H7PA 1XP3A 3Q4DA 3DFYA 3MM6B 4GJJA 2W79A 1FWSA 4BF5A 1KWKA 1GG0A 5AY7A 2EG7A 3AAMA 3N11A 2PI6A 1TRIA 1MFUA 4CCEA 2WSYA 4KESA 4AIOA 1CTNA 3WK3A 3LSCA 4IPLA 4PMVA 1W1VA 3B06A 1K8CA 2VX5A 2D0HA 3PBMA 3TZNA 5BWAA 4MTVA 5GJPA 4RJEA 2FQIA 1Z69A 4HNOA 3H54A 1UZ4A 3AMLA 1LJYA 2DU2A 2PLMA 3WL0A 3VFCA 4S3GA 3KDNA 3VIGA 4M1BA 4ZE5A 2A0NA 2OSWA 1TZ7A 3SCVA 3CU2A 3GIQA 2GSJA 2DGAA 2YBTA 5AOPA 3UG4A 7XIMA 5E09A 4RDVA 2PFHA 5I3KA 3W26A 2YKKA 3VD7A 2RUSA 3TJIA 2H9AB 1XRFA 3PZMA 3WMSA 2JIEA 2OWWA 3H23A 4JFUA 2WHJA 1OG0A 3VM7A 1P0BA 4XQ6A 5J8LA 1BSIA 5G2IA 4ADTA 3T55A 2IMRA 4FI4A 4O17A 1XIGA 1A3XA 4JTCA 1K9EA 2CEQA 4KERA 1DTUA 1H61A 1RY8A 4DY1A 5ABFB 1BXBA 4N7QA 5HQLA 2QGHA 2VFHA 3U2OA 3T0DA 2CU0A 3ZOAA 1EGZA 1BGGA 1CENA 2O7SA 3MKVA 4RW5A 5M5DA 1ZAIA 1QJWA 4ICCX 4HCLA 4IQDA 3UU0A 2WM1A 3RLUA 3TVAA 3QQWA 4HZ8A 3HV8A 3ABZA 1H3GA 4I7WA 3RLHA 1TJ1A 2XWEA 4PUMA 3ITCA 1F3EA 5JBEA 1FWCC 3AFBA 3RG6A 1SZNA 2QJJA 2FGBA 4JY9A 3MM7A 1YADA 3C3NA 1GJUA 3NNTA 5H8UA 3C2OA 4PSPA 1XSJA 2ZWZA 4LEQA 5BXTA 3TTSA 5LIKX 3QFWA 1OK6A 1SO3A 3STFA 1U5HA 2C8NA 3LCGA 3WJXA 4HU4A 2EBNA 3RCNA 4Q4QA 1FHLA 4BQ4A 4C6FA 2AGTA 3TW7A 4B9YA 3FNDA 4Y9MA 4D8ZA 1ELSA 3FSTA 4OKDA 4Q4OA 2OSXA 3GUWA 4Y96A 1JGMA 4UFIA 4AHOA 1WX0A 1V0KA 1Q45A 2EO7A 5E9AA 1QBBA 3UR7A 1RK6A 3A9BA 2WV8A 4M81A 1D9EA 3EWYA 3TA6A 3CQJA 1U2YA 3BSMA 1M5WA 4XBSA 3R89A 2VP8A 4QQ3A 2OB3A 5FESA 2WVVA 1CGTA 5CKSA 3PS7A 4UFLA 3F4DA 3RU6A 2DUAA 3CJPA 1HIZA 4PZVA 3NZPA 3NGFA 3BQ6A 4UQBA 3OLIA 5IOBA 5KETA 3UCQA 2PDUA 3AYVA 1KTNA 2HWGA 3AOFA 1ECQA 2IKJA 4O16A 2DZWA 3F4NA 3SN4A 3KDOA 4AXNA 5D9OA 4X2RA 3WMLA 1LT7A 5HUOA 1DP0A 3SEPA 3PBVA 2ALDA 4F2UA 2RDUA 5LNVA 4ZENA 1KBIA 3MVTA 3CMFA 1MYRA 4D6FA 1MO0A 5KZMA 3W1NA 4A05A 2CC0A 1WUEA 3KS5A 4DF0A 2GWGA 5D30A 4PH6A 3C52A 4L4MA 4JHMA 1FKXA 3K1GA 1QNRA 3VUSA 4YL2A 1XFCA 4C65A 3WLOA 4N02A 7ODCA 1Y65A 1OCJA 2BZNA 1VF8A 2X1IA 4C6EA 4W86A 1ZJIA 4JTRA 1GVIA 3WQFA 3B9EA 1VIZA 4XD6A 4G56A 1YYAA 4UTUA 2C19A 3UJRA 1HW6A 1A5SA 2GVGA 3MMWA 4QISA 1UUQA 3REQB 3TR2A 3IEBA 4NAEA 5CC3A 1WKDA 5FCZA 4K2SA 4P8WA 3QPZA 2F7FA 3CAVA 4JTLA 1R9XA 4DEFA 4GI9A 2B0MA 4QG6A 1W3JA 3W82A 2XFFA 1QOPA 4Q8QA 4X22A 1BHGA 4IXHA 1JCNA 5MKGB 3F2BA 2YOCA 3NGJA 4Y8EA 5G5IA 3BMWA 1N55A 4I5UA 3S2NA 1IXOA 1QTWA 4RDYA 5AHEA 4X0NA 4F0HA 3RCYA 2PDQA 2Z29A 2ZUTA 3BURA 1SZRA 4W7WA 1GQIA 4J27A 3N04A 3SR7A 2ZXBA 4GE8A 4PTMA 1QCWA 1B3YA 1VLIA 1P0EA 2XZ9A 5FOOA 4EXBA 4HPHA 3RM4A 5BMXA 3T0BA 2I7GA 2VZTA 2X1RA 1E55A 1ZUAX 5CPOA 1MNSA 2GJNA 3S2CA 3B05A 4GI8A 3LENA 3N2MA 1H1ZA 4J3VA 4DPQA 1GORA 3G5EA 1QK0A 2OWXA 2ZDSA 4W87A 3UPBA 1HX0A 3PZQA 4C6JA 4IG2B 1E0VA 1QI0A 1V3HA 3RUBL 3FSUA 1LF1A 3BO9A 3ECQA 1V7YA 2V5LA 2CCRA 4ACZB 5IFPA 6GEPA 2VQTA 1I4NA 3TN6A 1HNYA 1ZFJA 1XLLA 1C92A 3GH5A 3ARQA 4ZB2A 3M6YA 2GJRA 3UXIA 1HJSA 3LGDA 4PA8A 4OBTA 4CCDA 1DE6A 3LNPA 4B5SA 2SFPA 3VIIA 4MVAA 1XDLA 3W6MA 5E1QA 4GKLA 1FDZA 4J3SA 2Y8VA 1W8GA 3PBGA 1VJZA 2JEPA 1EXPA 1WUFA 2PDFA 2HZGA 4P7QA 2IQ0A 2FKPA 4L5ZA 4KBXA 1JDDA 4ZR8A 3PNUA 1KQZA 1VBUA 6REQB 3VKSA 4MYXA 3VFLA 3BLEA 1R5YA 2F6KA 4IM4A 3LZ5A 1GQJA 4HA3A 1PYMA 2BBFA 3OG2A 4IFRA 2ABBA 4XZBA 1V3IA 2D22A 4CLMA 4LBUA 1FXPA 3WQOA 4BK9A 4S39A 1KC7A 1ZSXA 2DVTA 2PD9A 3PUDA 4K8GA 4DELA 5K7JA 5F2LA 2NX9A 3DXIA 3BW2A 4KFNA 4F2TA 4N4QA 1L6FA 3NR0A 3MM5B 1IWAA 4PUWA 1JDFA 1HXJA 3RO6A 6TIMA 1JUEA 2ADAA 3EA1A 3IJIA 1VFTA 5DEZA 5LA1A 1A0DA 4K68A 1GVYA 2IW0A 4PR4A 1UD6A 3TJXA 1EF3A 1R3RA 1R0MA 1PAMA 2FPYA 3MT1A 3L0GA 3WEZA 3DBNA 3G3MA 3S47A 1G4TA 2QPUA 3M9YA 1JEZA 1IIHA 1XCXA 3PZ9A 3HV9A 1F4HA 4HA1A 4JOMA 3H7RA 2QPSA 2PGFA 3MW7A 4K36A 3UP8A 1KFKA 3RLVA 1WOAA 3M0IA 3IVTA 3QZEA 2GQAA 3U5UA 3GVVA 3VIKA 4FF5A 4M82A 2YB4A 3C3UA 3LM7A 4OV9A 4XSLA 4AYGA 3BJTA 3UFYA 4MLJA 1HP5A 1WAWA 4WSKA 1JULA 4PCFA 2XSAA 1CGWA 5CAKA 2E68A 2Y7FA 4R7WA 1XBYA 3H26A 3O3RA 5BNKA 3C0QA 2WXDM 4H83A 4KCVA 4WY0A 3A24A 3PB0A 4I6KA 3WYZA 7REQB 2ZRZA 3IIVA 3JR2A 4PMDA 4JIIX 1FWIC 1F6KA 2GJXB 3L5MA 1VR6A 3BOXA 1P43A 2WC4A 1QK2A 3T08A 1TA3A 4KH2A 4ZMGA 1MUMA 4XIAA 1W32A 1DJHA 2D24A 4W8LA 5L6UA 1C8VA 3WF1A 1XRTA 1AUSL 1J96A 3H4XA 4B15A 4NJHA 4WUIA 1A50A 5M3WA 2HTMA 4XWUA 4S3FA 3LHVA 4HU0A 4MYAA 4C5ZA 3K46A 1OABA 5BW6A 5A8OA 1O1ZA 3BCJA 3IIZA 4G9PA 1H0IA 4O8AA 3ZMRA 4W84A 2ONEA 4QROA 2PUZA 4PMYA 1UJQA 3ZO9A 1SSGA 4IP4A 4OBSA 1W37A 4FSAA 4E8GA 1EJ7L 4JX4A 4Z1AA 3VKTA 2VRJA 1KR1A 1WYIA 3A64A 3ABRA 1UH3A 1W5PA 3IRDA 1R9ZA 2EEXA 3PAJA 3QF0A 4UCFA 3T2OA 3H4WA 3ATZA 1B54A 3EKZA 1R3SA 1ICPA 1TX0A 1OG6A 4I6VA 1J11A 5BU6A 4WY0F 4AUBA 1XC4A 2PMQA 3VAVA 5HPCA 4YTSA 1TPVA 4L4PA 1JJKA 4HNVA 4GVIA 2FVLA 4PTNA 1UD2A 1PTAA 2C1GA 4O1CA 3ALGA 3F2CA 4C7FA 1RA0A 5T26A 3B0JA 1EH9A 4HK6A 3WF0A 4AHPA 5HATA 3LTSA 3ZT5A 2YFOA 2QPXA 3CUFA 3CT7A 1KBBA 2Y89A 2J24A 4MFEA 1R38A 3E1F1 1QW7A 1EHNA 3SBFA 4AW7A 2WQPA 5J5RA 1KQYA 3QM3A 1IWPA 4AZ5A 2VGFA 2V3EA 4GY0A 4EAYA 4Q8MA 3S2MA 3KBVA 3OZOA 2VNCA 1A0EA 4EANA 1X6NA 4LUJA 5AC8A 1V93A 3HPSA 3NOEA 4NX0A 3R0UA 3QR3A 3VD4A 1W1TA 3NDYA 1YPFA 1TYGA 3M0ZA 4GZJA 3QC0A 2UZ9A 5CLTA 2CBIA 4LH8A 1KRAC 1IT0A 2Y8UA 1JXJA 2X7WA 4R34A 2FVKA 2QV4A 1C9DA 1J6PA 2XSJA 1OFAA 2HS6A 2CPUA 2DSUA 2YDSA 4C6DA 4UTMA 1J0ZA 5CGMA 3AROA 1EQPA 2JIWA 1U1UA 1ZBCA 3PZVA 4XAYA 4EVZA 4DJDA 3BAJA 3AHTA 4FNUA 1CXIA 2P3ZA 3HGSA 3VNIA 1B3VA 4QJ3B 2BY3A 2J74A 3L4UA 3S2LA 3AZRA 5EMKA 3PJTA 2A3HA 8XIAA 2GWNA 4IJCA 5M03A 1GKQA 1XBZA 3GTIA 3NA8A 5KITA 1XH0A 5GJMA 1VFFA 2RAGA 3I6EA 4PMRA 1ONEA 1E1EA 4AEFA 3L0KA 3II1A 4RV8A 5A5WA 2PWEA 3TQPA 1W3HA 1JZ7A 2IKGA 2OU4A 3W70A 3KZSA 3TE9A 1ICSA 3WDPP 4PUKA 3UG5A 4JTAA 1YE4A 3TIMA 3NQEA 5TQLA 1FH8A 3I7QA 2ZX6A 3R5EA 3WF2A 2G96A 3KCOA 4ZSUA 3LS9A 1Z9AA 3H2CA 1AOPA 4EWND 4O13A 2XJ7A 3CWOX 3ZWSA 3TMLA 1T40A 3B8VA 3UZXA 5CXPA 5BXSA 1RJRA 4XAGA 5HPOA 2YBVA 1XGZA 3MMAB 1JQXA 1W91A 3M0LA 3WH6A 3MZ2A 1X98A 4DJDD 4LFYA 4X60A 4LV4A 3A47A 1KM2A 2B7OA 2OR2A 4LW7A 2WO5A 1XLKA 2I9EA 3IGSA 1OFRA 2WSRA 3DI0A 3UZ5A 3BZJA 1J6OA 1V79A 3NQCA 2V30A 3HG3A 1QNOA 4A3UA 2PZ0A 2Y7DA 2WC7A 3L67A 4Q8WA 3KLKA 3LLXA 4HTBA 2O9TA 3IK2A 3AJ7A 4GX9A 3A4AA 2XGIA 2CIPA 1NDVA 4PE8A 1JYNA 4UB9A 1E1CB 4R88A 1TG7A 3ARRA 4DAFA 1D3CA 3QHMA 4W9TA 4HNCA 4GYKA 3SQMA 2JF7A 1DWGM 2D2JA 3WLIA 1UR0A 2VEMA 4B3KA 2WNWA 4NHVA 4BZYA 3VM1A 2IUZA 3WUBA 2PLCA 2ON3A 3SCTA 3SAZA 1V6VA 1Y7VA 2ZZ4A 1HN1A 3BLFA 1R3VA 3WNPA 4IPJA 3AMKA 3SIZA 1NOWA 1YPIA 3SJ3A 1OFPA 2WCSA 4YVVA 3W7OA 2EPLX 2UWFA 1EWDA 1RP8A 1QU4A 4QM1A 3GFYA 3S1GA 4GLEA 4FMVA 1RALA 4D6CA 2I57A 1VIWA 2OT0A 3MUZ1 4GRSA 4PUNA 2PD5A 1AVAA 2VVSA 2WLYA 1S2VA 2GDUA 3P82A 4V2XA 1OFEA 2EKCA 3CO4A 1TPC1 5AVHA 3B0VC 3V5FA 2I1OA 4H2CA 1E0WA 3M5YA 2A1YA 1YRRA 3TC3A 1FWFC 3B03A 2X16A 2Q3OA 1DORA 4POCA 4EACA 1JCTA 1UUOA 5C9UA 4FX6M 4XD3A 1VYPX 1UA3A 4NXSA 2ZA2A 1GVEA 4G6CA 1B90A 4GQGA 1XBXA 3GE7A 4NILA 3B8DA 5CC6A 4C6QA 4V28A 3E0WA 1JRBA 3MKCA 5AYIA 1F8MA 3PP7A 4ZO9A 1F6YA 1GGOA 4BWLC 4E3VA 2C0AA 3JZEA 3GO2A 3W83A 1K8YA 4UCGA 3A23A 3QBUA 3BW3A 4JN8A 2XG9A 2BSLA 2OZ8A 4AQLA 3VE9A 3BAXA 5D02A 1V6TA 3QN3A 1B57A 4HYWA 3NCOA 1G7UA 1I2PA 4HSNA 4RNJA 1AZ2A 1DIOA 4PTVA 2YW3A 5KMYA 1GOKA 2PEVA 1O5RA 5AYZA 3VZYA 3WFAA 3OO2A 4PMXA 2PDXA 4B4FA 4C6CA 3BLLA 1UKTA 4DYKA 5AYXA 1E3XA 4CU6A 5DLCA 1FCBA 2PP1A 4LUTB 1R2SA 1EA9C 3SGZA 1GVRA 3FVMA 1JAEA 1YDNA 1BSLA 5K9CA 3IJ8A 2H90A 1MEHA 2DZSA 1WQ5A 4NF7A 1JZ2A 4O11A 1UBPC 3E74A 1EEPA 3AMGA 1DJZA 4I8YA 4QDPA 3M0KA 3W53A 3E12A 4HMNA 4NSBA 4UFKA 2FHCA 2W92A 3HG4A 4ML9A 5I6SA 1FHVA 1QNSA 3EMZA 3AQUA 3FJ6A 1NFPA 4I7VA 1G0CA 4PFMA 4QAIA 1KGXA 5HMFA 2BGSA 2CLOA 3OYXA 1XYMA 3OVQA 2Q8ZA 1OCNA 3C8NA 3ZJ6A 3THDA 3PK7A 1AJ2A 3NQ6A 4Z2HA 2J62A 1ZJ9A 5H2ZA 4L4LA 3SUUA 4GO9A 4HK5A 2OCZA 2FFCA 1YKWA 3TH6A 4UQEA 1Q6FA 2QYGA 4B5UA 4CU7A 2Y7EA 1TWDA 1I60A 4XKMA 3UXLA 3Q58A 3BMVA 1ZLPA 2WM0A 4IX0A 4LYPA 5CQ1A 1SO6A 3UA4A 3G8EA 3C2RA 3EPMA 4AYSA 2X1TA 2J8TA 2D0GA 3BLPX 5BU9A 2F8QA 1K4GA 5L9FA 4ES4A 2W67A 4D6IA 4YVXA 3MCMA 4J5NA 3EOEA 2HVOA 2PRMA 2FDMA 4NZFA 3WJYA 3LGGA 2WMJA 4U10A 1DHKA 4AVOA 1YTKA 1EO7A 2D3LA 1R3QA 3QY8A 4A3RA 3BV7A 3GQYA 1LWJA 3GVWA 5LNWA 1RPXA 3TEVA 2HK0A 1D8WA 1LWHA 4LY8A 1NVMA 4Y8FA 2A21A 3QRHA 2EJ1A 3IUDA 5EBAA 2F84A 2XN2A 1QBAA 4C6BA 4QS5A 1KCKA 5XIAA 3M46A 2D2OA 4XB3A 4IFKA 1L9WA 3PAOA 4N9BA 3EDJA 4RE2A 5CZTA 2QDHA 1EKOA 1U33A 4M29A 5EMYA 3ZLGA 2YCJA 3BE7A 3EX4A 1XLFA 2I17A 1GOOA 5CSYA 3BGJA 3W2JA 1A0CA 1DJNA 2V69A 3PTQA 4QNEA 5E9XA 4HSOA 4PTXA 2AAAA 3VKAA 3MTWA 2QAPA 1F8IA 1E5NA 1C7TA 3TAKA 4ZCWA 1JYWA 1EUAA 3LCHA 3PG9A 4XKYB 4D1IA 1U5VA 1Q65A 1US3A 4UUIA 4GGHA 2R6OA 1QI5A 1AQMA 4NJJA 2XU2A 4ZOBA 4MJ2A 2AOPA 1PZ3A 4PCSA 4CN6A 4MWAA 3DFPA 1UCWA 2E6AA 3M41A 2A6NA 1MQQA 3KHDA 2FPTA 4LRSA 4KS0A 3VNMA 1FUYA 3TW9A 3HB9A 3G18A 3DG7A 4DWSC 1XF0A 5K3VA 4JX6A 5DMNA 2HRWA 2P0IA 2YA0A 2W66A 4F3HA 2C18A 3W7IA 1H7OA 2YLLA 3N2CA 3IUIA 1UBSA 2Y1HA 3V18A 3KL3A 1FWBC 3A22A 4Q7IA 3BOLA 3VDCA 1D7FA 3USZA 2PWVA 2X2GA 3SO7A 3AI0A 5DXYA 3P80A 4BHYA 4C6NA 3E0VA 4HZMA 3GYCA 2VEGA 2J7EA 2VUYA 1OCQA 1TUXA 2FGLA 5I02A 3B8IA 2VEFA 4XVEA 3ZM8A 1TPEA 3RU8X 1E40A 2HPMA 2A5HA 2Q09A 4C1KA 2ZUMA 5F4SA 1LZOA 4B5WA 1ENUA 3KFTA 2INEA 1I2NA 1NOFA 2ESCA 3GM8A 3UR2A 3RITA 3N4AA 4ZFCA 1TWZA 2NQ9A 4RKAA 3O07A 1HO4A 2PRLA 3WJZA 4I90A 4A3YA 3BDKA 5CG7A 4UTKA 1EC9A 3QGKC 4C6LA 1ZP4A 3GR7A 4GI6A 1LOLA 2FFIA 4OVXA 3FGCB 3MUIA 4MWAD 2QUTA 2F61A 2YLAA 1ZALA 3GHSA 1EB3A 2PB1A 5IM51 4GINA 4DN1A 4DLMA 4QBXA 3K8LA 3P67A 2ZE0A 1JFHA 4IWWA 2UY5A 4IF2A 3MM6A 3KBMA 3HF3A 3V5CA 1VRXA 3CHFA 2VELA 3NIYA 3GDBA 2PDHA 3KVKA 4LYRA 3DZ1A 4UTTC 2DIKA 4U2ZA 3V16A 1XQLA 1KCLA 2CKRA 4QFUA 5A2BA 1EDGA 4QG8A 2R82A 7CGTA 3T8QA 1ONRA 5AKQA 1NWSA 4GI4A 3VKCA 5GPRA 7TAAA 4HU3A 5TAOA 4JQ1A 4UNIA 3CAWA 3MM8B 3KRBA 1UR8A 1VD6A 3URNA 4Z2IA 2DT0A 2Z2UA 2OVLA 3FCPA 3QMTA 5DCDA 1AL8A 3UNTA 2WCAA 4GZEA 3TU9A 4KWWA 4PRRA 4W5UA 1X7FA 1SFLA 3QY6A 5FSDC 1DXEA 4GBDA 4AZBA 1F07A 2D0FA 5EMJA 1K9DA 1PVNA 3GK0A 2P10A 4O57A 5IDZA 2H9AA 1ME9A 3PWGA 1E6ZA 3GVQA 3LHWA 4LAMA 4YHGA 3ZJ8A 1ZCCA 2PGRA 1QPNA 1JXKA 2EJAA 4U4MA 3RRXA 3NOYA 4FP1A 4XZHA 1BYAA 1IGSA 1J5TA 4RNFA 2QJMA 2Z00A 2YGYA 3WFLA 3H2FA 3E3HA 2BOGX 4GIAA 4ZQRA 1GOQA 5A69A 5FAGA 5ABFA 4QSHA 2X1UA 1QOXA 5B7YA 1OZQA 4IOTA 3I65A 4GCXA 3C56A 3UJSA 4YJ5A 3OBKA 2GQ9A 5CEWA 2E8YA 3EMQA 2OYLA 1ZJAA 1KWGA 3OVPA 3EWCA 1JDCA 3P0XA 5D2VA 4DJFC 1W9DM 1VS1A 3IUHA 4TX9A 2QDGA 4FALA 2BVWA 4U3CA 1RJPA 3DENA 2FB2A 3ZIZA 3P62A 4MDPA 5CG0A 9RUBA 3PTDA 1M7XA 1M7PA 2GGHA 3VUPA 3KWSA 2R1KA 1R7OA 3L2IA 4KEUA 4DAIA 2AKMA 4OIFA 1W9BM 4ZOAA 3R1ZA 2VX7A 4CQ8A 2G37A 1SW7A 1RP9A 1KTBA 4AMAA 2XH7A 3DYOA 5G2HA 1IZJA 2BVTA 2W63A 4E5TA 4J35A 4B92A 3TSDA 3U2ZA 4ZVJA 2ACUA 3EOOA 5D2XA 1E0UA 3E5BA 5RUBA 1W2PA 2AMGA 4NZ5A 3CZJA 4CN4A 2PTWA 3FLUA 1V5XA 4F4RA 4XZLX 3GG0A 2MUCA 1PX3A 1VFSA 3UCDA 1V6XA 2J66A 3P60A 2BHYA 2GUYA 4FIRA 1A5MC 2J75A 2JKEA 1A3WA 3T78A 3SECA 1UB3A 5D4YA 1UPMB 2WLZA 2W3ZA 3PUGA 4H6EA 1SVDA 4XUGA 3TLLA 1E4MM 3MBFA 2J7CA 1YEYA 1UMLA 1TR1A 3S5ZA 5CJNA 1W5NA 1JPDX 2W4XA 3C4UA 4JL2A 2BASA 4J3XA 3VZXA 4O8RA 3UD6A 1Z44A 4DX3A 1E70M 3ENLA 3OQEA 1XKJA 2NT0A 2Z25A 1YLVA 1PKYA 1O66A 1QI2A 3W71A 1EDQA 2RJHA 3PR2A 5JQ9A 1GG1A 2WMHA 4IPNB 2QUUA 2QCLA 1YBQA 1TZZA 2P8BA 1BXNA 5AC7A 1R87A 2J9XA 5FF4A 1Q6GA 4XAZA 3TLQA 4LWWA 2YDQA 4OE7A 2A85A 4HGXA 3E0LA 1KCZA 3LHYA 3CH0A 1R3YA 2INFA 1QO2A 2DV0A 1HGWA 3SN1A 1NFGA 3L5LA 5FA5A 2V2HA 3RX3A 4QCFA 4Q6JA 3LXCA 3MSGA 5LKYA 1V0LA 4UR9A 4XZ9A 3O6CA 4D6DA 3SY1A 4CQCA 2DJLA 1W3NA 4O0KA 2D1ZA 4EPKA 3TYCA 2ATSA 4MGGA 4EP8C 1GZJA 5EMMA 3H6OA 4J4KA 2P50A 1F61A 2XN0A 1JCMP 4ROQA 4Z1DA 4KIEA 2XWDA 3LHUA 4L9XA 3I3BA 3QGVA 4O18A 3REQA 5ABHA 5C7VA 5K2ZA 3IVSA 3V1HA 3HO8A 3LQGA 5FF0A 3EA3A 3KBSA 3MO7A 4Q3MA 3R4IA 3KL0A 5MKGA 4FX7A 4JYDA 2VFGA 4LBRA 5TD4A 4YHEA 5FIPA 1H50A 1NELA 1P48A 4WDWA 1VEOA 3SN0A 3ES8A 2OX1A 3C8FA 3ZVIA 4XZNX 1ITXA 1E71M 3W00A 1Y5XA 1NJJA 1UR3M 3EEGA 1MW2A 1YW1A 3A9IA 4DQWA 9XIAA 2GVEA 4GUIA 4TVUA 3OR1B 4DUWA 4IJBA 3MMDA 3FHAA 2PSNA 3G0XA 4O1EA 1V4YA 1TPDA 4AXKA 1XPGA 3FW6A 2DW6A 1ESWA 3MMCB 4D6EA 4JDBA 3U2CA 1UKOA 1NQKA 1WA3A 3L0NA 3PJWA 4DF2A 1Q8JA 4IG2A 4H9XA 4HPNA 4LUSB 3AIUA 4DVOA 4TMCA 4XVDA 1DIKA 3RILA 2ZX7A 4KW2A 1QRQA 4ACZA 1W5QA 1DVJA 1GYMA 2TSYA 1K02A 2OEJA 1DWFM 3CEUA 4A2RA 2XM2A 4LU0A 4CVUA 5C5YA 1SM9A 3NFUA 2QCEA 4QG9A 2KAUC 2RGMA 3GU1A 3WIJA 1RQBA 3AXIA 3CUIA 4BWLA 4X0VA 3DIPA 3IAPA 1DYSA 3SCRA 1GTEA 1OC6A 3N34A 5D37A 4R33A 1J2BA 4TOQA 1CCWB 1U1HA 5JMUA 1TPFA 1AD1A 1YX1A 3J7HA 3W1AA 1LQ2A 2IXVA 3WBAA 1CECA 3ZS4A 3DX5A 4JD4A 2V2DA 5A8GA 4QLJA 1J0YA 3SADA 4A21A 4C1LA 5ABGA 6REQA 3W1XA 3CL6A 5M2FX 4DYEA 5JH2A 1O4UA 1OYAA 4NI8A 4H9VA 1V3MA 2DIJA 3ARWA 1ZAJA 3BSHA 3MO4A 4FLQA 1MQPA 4NZJA 3W75A 3MY9A 3OGRA 4O12A 2FH8A 1MEIA 4PMOA 1KBJA 4JFVA 1W1YA 2VRKA 4Q6XA 2BV9A 3MM5A 3VOJA 2FTYA 3LN3A 2WNZA 3CGTA 4GVGA 2PP3A 4HN4A 3VLXA 3CPRA 3EBVA 1OB0A 1BVNP 1OGBA 3STPA 4LOCA 1Q3NA 4NZ1A 4MLRA 4M7TA 1T6MA 1VH7A 3MSDA 3CMJA 3OLDA 1RQHA 3LSBA 3OZYA 1UWRA 2XGZA 3VCCA 4BCEA 1QWKA 4LX4A 1JIBA 3OIXA 2NUWA 4HTYA 2J8FA 2NXGA 1VENA 2CLEA 4NXKA 1UQYA 3UVAA 1GEHA 1VKFA 1TIMA 3BAYA 4ZZ9A 1KV8A 4OOUA 2PAJA 2PCQA 1TFVA 3S83A 2VCBA 2WJEA 2QV5A 4Q4KA 1XG3A 3UJFA 1V08A 4BQ2A 1NH6A 1E15A 4EE9A 3YPIA 5M17A 4BI7A 2QDDA 7ENLA 2VJXA 3AALA 3VKRA 6TAAA 3G24A 4MUPA 4Y9NA 2DT1A 3G1FA 4NZ3A 3TFXA 1P0DA 3BLKA 1TPWA 7REQA 3R43A 5LIUX 1R86A 3LOTA 1K4HA 1T8XA 4JQ4A 3W23A 2REQA 3R0DA 2GJXA 3INPA 3UY8A 3SUTA 3SUWA 4XK2A 5HMDA 3POCA 1LM1A 2C71A 3O0KA 4FR6A 1V8EA 3SY5A 1H2JA 2Z2AA 2XISA 2UV8G 4HPJA 1KM1A 3BV4A 4WD0A 1RV8A 4MKSA 3R7MA 5U7SA 2V9DA 4N4PA 2V0TA 3QVQA 2J7HA 2W9MA 4CKQA 1CX9A 4Y6GA 3VNDA 2ZICA 2WZMA 4JN6A 4H7ZA 3N1AA 5GNYA 1K7FA 3BMXA 4F0LA 2BGQA 1S2TA 3O05A 1IR2A 4WKHA 1DL3A 1ZJBA 3DFTA 5A6SA 2AL1A 1GOXA 1JFXA 2VYOA 4NKCA 5AC5A 3OHIA 3GTXA 2ICSA 2NV1A 4HHPA 3RX4A 4P7OA 2ZZ3A 1FWRA 3VI2A 3W07A 2DY3A 3HMCA 3TN5A 1CLVA 3DCPA 3EMCA 1TVNA 3L21A 2YJQA 3P0WA 3R8HA 3JZUA 2OQLA 4CD6A 2ANUA 5A6AA 2Z1BA 3GTHA 3VDBA 1UP2A 2OYMA 2DQXA 3LPGA 1YDOA 4OT7A 3B0HA 1RR2A 2OGYA 4QEHA 3TYAA 3LCFA 4HMCA 5AHMA 1NWTA 3L2MA 5D03A 3LPOA 4ZL1A 4JTKA 1JCJA 4DM2A 3BICA 5SWUA 3E96A 1JDEA 2VDGA 3WD3A 1IR1A 4GWEA 2GQ3A 3FYOA 4M3PA 1HTIA 5JH1A 1A5BA 2NXHA 5BOFA 1OC5A 5D2TA 1XS2A 4TVCA 3TOPA 2RH9A 5CPTA 1QW8A 3TP4A 3LHZA 5H6HA 2XH4A 3S5NA 1OK4A 5D09A 1HP4A 1C8XA 1HJVA 3MMBB 1ZY9A 4CD7A 1XSKA 1O1HA 2HK1A 4K1WA 4ASTA 1SZEA 4RDWA 4MB4A 3NJ3A 1EA0A 1HL9A 4IGHA 3OHMB 4NT0A 4W88A 4QJ5B 5FD0A 3BANA 3P3BA 1TV5A 2H3DA 5I00A 3BGAA 4O4VA 3OODA 2YA2A 1BF2A 4MZ8A 4YCPA 1EYEA 4MB3A 4AF0A 1BGAA 2XSJB 1Y8BA 2CHRA 1ZTVA 3ICJA 4K3ZA 2Y6ZA 1E43A 3KTSA 1KCXA 1LDCA 3WF3A 3SRKA 2J6VA 1VQTA 2YR1A 4JKKA 3WNKA 4FO4A 2YFNA 1GOIA 4QITA 5DANA 4ZQNA 3WQ8A 3U9IA 4WZHA 2OEMA 1X7IA 2QR6A 1DEDA 1WZAA 1UP0A 1OINA 3QSRA 4FS9A 3LCLA 4QE5A 1DXIA 3T81A 5DF0A 1GOMA 1O95A 1W1IE 2OJPA 4LY4A 2QUMA 2FMOA 5GVJA 4UTTA 1YTDA 2DZTA 1WO2A 3KRUA 4ACYA 1W1B1 2DDXA 2J9YA 3WBYA 1KFEA 3QC3A 3GLCA 1UR4A 3QSTA 5CH9A 2NT1A 1ZENA 2AKZA 2HBVA 5AC4A 1SU5A 1UZDA 5D9MA 4L64A 5G4HC 3CQKA 3CUGA 1UKSA 3TSMA 4FXJA 2B7PA 3B9OA 3M64A 1YXCA 3ARUA 1OGGA 3HA1A 4AX6A 3ELFA 3KM8A 1V3KA 4IMCA 3FJ4A 4KCWA 4OV4A 1QWGA 3DUGA 3WNLA 2GJPA 4H2HA 4UMBA 4REQB 1FWJC 4MB5A 2QIWA 1GPFA 2B4GA 1I9CB 1F3XA 3GNPA 3PPFA 3PULA 1VPXA 2QF7A 4HA0A 3S3GA 2Y5SA 3MMAA 4GUJA 4JTDA 4G1KA 2GEPA 3H4GA 4R27A 5BWFA 1B30A 1EWEA 4JTGA 1ISZA 3WX7A 3S6OA 3U7BA 2PF0A 3LLDA 4E8CA 2PTXA 3DDMA 4Z42C 4GABA 2WNQA 1XLAA 3NPXA 1W3IA 3GRIA 3TNBA 1TMLA 1Q6EA 3G1SA 3CLWA 4L9ZA 4XIMA 1LP6A 1RLDA 1S1PA 4GX8A 2R1MA 3SCUA 2PC4A 4RW3A 3ERPA 4NZ4A 1E1CA 3O9NA 4DJFA 2CLIA 1EXBA 1RBLA 2BHZA 3O1NA 3BAWA 4BQ3A 4H9TA 3I68A 4MNKA 3MS8A 4HYRA 1SFJA 1IEIA 4UTHA 3NQFA 3DU0A 4YLWA 4AY1A 1UOZA 1V77A 1A5OC 5LIYX 2JK2A 1DIDA 1EJRC 1O5XA 4ZQPA 4ORIA 3DGBA 2DSZA 1M7JA 3LCXA 5T9BG 2NQJA 2EKGA 1Z32X 3NO1A 3W84A 4PEEA 1PTDA 2X40A 3L2LA 1SYTA 3RAOA 3WELA 4OFCA 3R8RA 3FIGA 4BF9A 3A4WA 5AHFA 4WKFA 4DNMA 2NVCA 3K4DA 2FIQA 1LTDA 3W0KA 3AIEA 1JF5A 4L4OA 4KGLA 4NASA 4H8VA 3OR2B 4CCCA 2OLSA 2PP0A 4A35A 3WQVA 3S1UA 5D05A 4NUWA 1UJPA 4ZE4A 3WNMA 1XLCA 4PMUA 2CKSA 4PODA 2IQTA 5HQMA 1XYZA 4UIOA 2QCDB 5JU6A 4JYEA 4DJFD 2DZBA 1BXCA 1ISWA 1C9WA 2XPKA 4BR1A 3V36A 3HGRA 1RA5A 2NWSA 4J9JA 1K6AA 1OCBA 1S39A 1KR0A 1HG3A 4H8HA 8RUCA 3GG8A 2XVGA 2NZLA 1Z6KA 3I10A 2X0HA 1WBHA 2IQDA 2HS8A 3EOUA 3QKZA 5EMLA 2Q01A 4NVTA 1HO1A 4FLOA 3BWWA 3SQLA 2W91A 3A21A 5FACA 2PZNA 3HQPA 1PYFA 3KRZA 5CPQA 4B3LA 3L4YA 5CSUA 3VMOA 3EX3A 3JW7A 3DG3A 1GQKA 4L1XA 5FJUA 3OVRA 2KZHA 3WL1A 4DBWA 4E3TA 1TV7A 5FJOA 3PBYA 3H8AA 1EFZA 3ABSA 4PRTA 2V5DA 4RDZA 5CPMA 3VMPA 4H7VA 2ZVIA 1K8XA 1PE1A 1DBTA 1LBLA 1MZHA 4O50A 2C6QA 3OOQA 1XLJA 3DFNA 4IP7A 3GBDA 4PL2A 4UXDA 4IIBA 3O7UA 2XVNA 3QKEA 3P2VA 1W9VA 7GEPA 2FZBA 4EXQA 1K9FA 4YTQA 2A6LA 4D71A 2VGGA 2YXOA 1XFBA 3WK1A 2ZXDA 3NL6A 4D1JA 3CC1A 1H0GA 5BYWA 1XYAA 2AQVA 2OSYA 2ISFA 4Q8TA 4CU8A 1O60A 2BOEX 2WPGA 2O4MA 2CHNA 4JAWA 3G2GA 3FHQA 4JY8A 1QI4A 3B4UA 1RLCL 1GW9A 3S9YA 4ZO8A 1UROA 3D0CA 3KXQA 4WDTA 1PBGA 3ITGA 3OGSA 4TV6A 4S2BA 4IIHA 4UC5A 5KZ6A 4LS1A 1T41A 3UPMA 4ZTYA 3LZ3A 1BYCA 3THCA 3BK0A 1Q2RA 5CZJA 5A6TC 3H7VA 4V33A 5LHEA 1QPRA 1VB9A 3QH2A 5I03A 2EQDA 3BQ5A 4FOUA 4PL1A 2J27A 2AAMA 1UHVA 2GVJA 2OZTA 4GUFA 2NWRA 2R8WA 5LGZA 2CZ5A 3U7VA 3WFZA 2Y0FA 1NTHA 4JHZA 4CEXC 3P8IA 3ARXA 4WJXA 4IHCA 1HL2A 5FI8A 1CBGA 3PBWA 4ERIA 1Y0EA 4JFSA 3FDKA 1JGIA 1FRBA 1G5AA 5E5CA 3H24A 3QYSA 2CZEA 4YXGA 2V82A 1WDRA 3GDTA 2PWDA 2XSBA 4Z0SA 4MAZA 4G7FA 5E6ZA 3ZZ1A 1XRVA 1L2UA 1L8PA 3LY0A 4N9EA 2O9OA 3T2QA 3NG3A 3CL8A 1RUSA 2UBPC 2FLIA 3V0TA 1XL9A 4MADA 4FOKA 2G3MA 2WYSA 3QMRA 1VHNA 2VFIA 1HJXA 3WUFA 1M65A 1LG1A 3L65A 8A3HA 5DBTA 4GNVA 5FF2A 2DORA 5IBXC 4ILSA 1UIPA 3KUMA 4TQTA 4XKYA 3ZR6A 4ATDA 1TCMA 2D69A 5FL1A 1B3ZA 4BY3A 1FWEC 3FN9A 4UOJA 3EKLA 1FDJA 2D73A 3A5VA 1XXXA 3IIPA 3URBA 4NQ1A 3UYIA 3SSZA 4TR9A 4H8UA 1JYXA 2I5IA 1RBAA 5AHIA 1VEPA 3W7QA 5IDIA 2OX4A 4LB4A 2QDEA 1DQUA 1XICA 2ZA1A 1BEUA 1GUVA 3ORWA 4UMAA 2IXUA 4M8UA 4U5KA 2VFEA 3RN6A 4O1FA 1XIMA 3RGTA 4EK7A 2ZCGA 1XLHA 1FOBA 1N82A 3NSNA 1R2RA 2CZVA 4JTTA 1ADOA 5F1VA 3T9PA 1TELA 1TV3A 3TUUA 3R8GA 2E77A 3PZIA 4WEVX 1VCFA 3N15A 3P81A 5FEWA 3TONA 3SI9A 3K8MA 3TYBA 4HOXA 1LL7A 3T7VA 1XH2A 5T91A 2OT1A 3GD6A 1JI2A 3VE7A 3DYMA 1PDZA 2V3DA 3SSJA 3N17A 1OVDA 1BQCA 2DIEA 3M0XA 3UPWA 2OKOA 3K30A 4GH3A 4E2OA 3M0MA 3LBCA 4XD4A 4WGHA 3QTGA 4L9YA 5EFDA 4IISA 1ITUA 1SFSA 1FWHC 4CNUA 3BXWA 3XISA 1RH9A 3DI1A 4H9YA 3UY7A 5A8QA 1MW0A 1J0JA 1PS9A 3M0YA 5HAOA 4ALDA 5EB8A 3A13A 1MRQA 1L0PA 1TPH1 2CNCA 1XBVA 2ZZ2A 4R7JA 1JI1A 3IJ9A 4HN8A 1FA2A 3O16A 2V2CA 3ITVA 1ZQ5A 3UXDA 5A6LA 4DBDA 3BG5A 4N9CA 3KP0A 1JPKA 1GVSA 3CMGA 3WBWA 3KOXA 2Y63A 2POTA 4TX8A 4WCJA 4QIUA 4INFA 3FVDA 3QPYA 3TYEA 4ZEPA 3FOKA 5CLWA 2NQ5A 1V6YA 3AXKA 4H9MA 3OB8A 1S38A 1QDSA 4WLCA 4RK8A 2A3CA 4PULA 1OFQA 4AIUA 3ZSSA 4PB3A 3BVJA 3QOKA 4XO7A 4A8NA 4C1NB 3DC0A 1K70A 5LNUA 2EGZA 3DN5A 3MM8A 3EWDA 3LEPA 3OLGA 1MNZA 3T0CA 1UYQA 3DESA 2E9BA 2QUVA 3W7HA 4HNLA 3KWXA 1H09A 4AZHA 3OVGA 1FBAA 4IUGA 2Z1XA 2VZOA 1QVBA 1W2VA 3TV8A 4CNSA 3W22A 2C13A 4JPGA 3FKKA 3EWUA 1Q7QA 2V4JB 5IXEA 3HG2A 4YIWA 1VGAA 2RDXA 4MG4A 1UWQA 4Y90A 1F4AA 3WQEA 1TMQA 4LRTA 4Z2LA 3KCJA 1FWTA 2ISDA 4LANA 1GQLA 1BYDA 4J28A 1L6YA 1R85A 4S3EA 3AZSA 3G0SA 3CS2A 1EQCA 3TROA 4DYJA 4HTRA 3U4FA 3UZZA 1VJSA 2E6FA 3GS6A 2FPVA 3LRLA 1PX8A 1WZMA 5BXPA 2V3FA 3L4WA 4V15A 2DZUA 4AAJA 3DFOA 2FVMA 2BB0A 3OP2A 4URIA 1J01A 3LTYA 2HNHA 2FH6A 1WE5A 4V27A 4LAUA 4DIAA 2E25A 4UBPC 4KRUA 1V7AA 1NF7A 3WLSA 4HK7A 4Z1YA 2A7NA 2CESA 3WDQA 3AHYA 3GUGA 2GDVA 5REQB 3VNKA 1JPMA 3ZVHB 4G5DA 8GEPA 4JKLA 3NQ8A 4KRTA 3W6LA 2OYKA 2ASHA 4TIMA 3HQOA 1JL8A 2ZIDA 4PGLA 4Y9PA 1BG9A 4GCAA 2WSPA 3W6YA 1OT2A 2XH2A 1Q4NX 3P6LA 1PTGA 5DQPA 1AK5A 2QXWA 4C6IA 4EOUA 3THUA 3VTRA 3TTOA 3QV6A 3FXGA 4GZIA 1H62A 5AB3A 1Z42A 2ISWA 5AHNA 5FJPA 3TCSA 4MHBA 3BL3A 2B81A 4LV9A 1ITQA 2ZFAA 1UPPA 4M1RA 4O4WA 1O7AA 5C9WA 1NDYA 1YTEA 1J9YA 1PDYA 3MYOA 3ITYA 1W9UA 4QLLA 3CB8A 4GISA 1OSEA 2QCHA 2HCVA 4DJEA 2UY2A 2FHFA 5I09A 4WDUA 1W31A 1WXZA 4H00A 4GIYA 3RPTA 2ACQA 1LWIA 1DPMA 3QXBA 4JIEA 3SRHA 5CBIA 3TW6A 4RNIA 5A8PA 4GVFA 1I1WA 4V1YA 1CXHA 4JQAA 4O15A 4EPEC 5I3FA 4MZYA 1W3LA 3HGJA 1XIEA 1XLEA 4R3UA 2WZIA 3OQ8A 3UGRA 1NP2A 3VGEA 1IHIA 2YCIX 4L6DA 2E5CA 1YBQB 2PTYA 3KBJA 2NSOA 3RMJA 4FXSA 3IK4A 3H2NA 1NU5A 3K5XA 2PDIA 4KGJA 2CWXA 2OKTA 1SJDA 3IV3A 1C90A 3SGGA 4IMAA 3MJMA 1GZ1A 1P1XA 2BY0A 4XBJA 2G4FA 4Q7BA 2PDKA 3EWZA 4KWOA 1GYNA 4DUOA 4MZ1A 3P8JA 1K7XA 2YL5A 4PC8A 3NZQA 1FVPA 2WBKA 3W2UA 4B5NA 1H7RA 4H6RA 5F2MA 1F5ZA 2BFGA 4DWDA 4CNOA 2Z7GA 1RSCA 2VC6A 3O15A 1GQNA 2Y7GA 1X1OA 2VMFA 4DJED 2HXUA 2VDHA 3ID7A 2GUBA 4ZO7A 2PWHA 1MEWA 3PBUA 4KEVA 4GIEA 4OHQA 1HF6A 1C8QA 5EKYA 5DN1A 5EYWA 3OGVA 1TV4A 3W74A 4LJ3A 1ZZMA 2R1PA 3Q65A 1E0XA 2L5HA 4ZGYA 1I0BA 4H8NA 1MW1A 1BD0A 2YXGA 5BXRA 3L66A 2BVYA 3KEHA 4AVFA 5CC5A 4IGMA 1SW3A 3LK6A 1QHZA 3SGUA 4K8HA 1ZU8A 4FNTA 3NUKA 2YDRA 2JQXA 2QJNA 5A6MA 3A5FA 3PVFA 1QOQA 1I2RA 4IUOA 5LYRA 4E38A 1DKWA 4H04A 2IKHA 1IXPA 5GNZA 5C2XA 3CZGA 2EXOA 3W88A 1DE5A 3OR1A 3G1HA 1ZS2A 2GL5A 4DI9A 4M56A 5PTDA 1S5MA 1A4LA 4I7UA 1CB7B 4LQ1A 3W7RA 4S38A 1PXGA 3MMCA 4PBGA 4GJ1A 1JAKA 4IGSA 4J2MA 2XDFA 3KE0A 3G8RA 3WJWA 1OX4B 1YDYA 4D8LA 5BROA 4LUSA 5HR6A 1UUMA 2PA6A 4WSHA 1PKNA 3EGJA 3MP5A 3PHAA 4JS3A 1M41A 1QPKA 3U57A 3EWBX 1FWAC 1L6WA 3WQPA 2VZUA 2X30A 1XCWA 3E2VA 1NOUA 1XLGA 5GNXA 4UFMA 3UT0A 4Q7NA 1TB3A 4W85A 4BI5A 3WN6A 1RY0A 5I78A 4Z08A 3NXFA 4CD4A 3JVAA 4RR4A 1FHUA 2QCNA 1RBOB 3M7WA 3AUOA 3M5XA 3NSXA 3QHOA 3UESA 6XIAA 4H6KA 4JTSA 3GHTA 2LLEA 4JNMA 4YNGA 1HKWA 5ABEA 2H8ZA 4IIEA 4AB4A 2XFRA 1Q6LA 4IMEA 1VFLA 1E9IA 1BTMA 1FX6A 5XIMA 3CUXA 1AQ0A 3CUZA 4MAVA 1EPVA 4LCRA 2YIHA 3RR1A 2BY1A 3UQNA 3DAQA 4Q8PA 4KQNA 2ZXQA 6ALDA 3MJYA 3NEVA 3TC7A 3M44A 1OFBA 2ZBTA 4B16A 3KVMA 3DOPA 4FR1A 3DFQA 2FZDA 1GYLA 2QGYA 4B90A 3EWXA 1SQ7A 4J40A 5I06A 3AJXA 2NSXA 4ZQCA 5I0DA 1CGXA 4DNHA 1TQXA 2QUNA 3B0XA 3UZYA 5DFAA 5HNNA 1IXQA 5K9DA 4HB7A 4QJ1A 3UEQA 4FNPA 4LGXA 3V0SA 1MXSA 4P5UA 2F9RA 2VVNA 3EOLA 4L1WA 4NRRA 2VCAA 2BTMA 5LIXX 6PTDA 2AKJA 3NPWA 1EZWA 1TJRA 2ZKMX 1OHLA 1QNPA 1RD6A 4O10A 3PFRA 4IL0A 4FNRA 3ANVA 1AG1O 3NQGA 3VNLA 4K39A 4JN7A 3MCOA 1EP3A 1BAGA 1E72M 3QLDA 1GHSA 2FGZA 4GKTA 3LPFA 3MV01 1C8YA 2X0SA 3TJLA 2ZRXA 4JEQA 4M51A 3WLKX 3NL5A 1XC6A 2REQB 2E9MA 2D2HA 1KV5A 4NNBA 2WMKA 5AVNA 1XD1A 3G6LA 4R7OA 3W81A 1TV8A 3AXXA 3LTPA 2F2KA 2EPMX 1J12A 2WJZA 3UETA 3LV6A 3W7PA 2WNNA 5K9XA 1FCQA 1TVPA 1P1MA 3UXAA 1WDWA 5A3HA 3W7NA 4P61A 3W1LA 3RR4A 3RF9A 3ZFHA 3D5HA 1JUKA 4UOZA 4TTGA 1BQGA 1AMKA 2Y2WA 3MI3A 1OZMA 2EG6A 2PDWA 2C91A 1HFBA 4QE4A 4N6EA 2OOGA 4H4IA 2HVNA 2YW4A 3UG8A 4C90A 2BVDA 2JALA 3E49A 2I14A 3W1RA 5AFDA 2NX1A 1SUXA 1Y5WA 3T4CA 1UH4A 1EGVA 2DVXA 4JYFA 2WVSA 2VHLA 5G1YA 1P0NA 3PWAA 1OX6A 3TA9A 4B91A 3GFXA 4ML4A 3U4AA 4D72A 2NLIA 5BRBA 2HPIA 3LNMA 4UQ9A 2G3JA 2O9RA 3I7SA 3VPLA 1Q66A 3AWOA 3VOGA 3B8WA 4DWSB 4Q8UA 1FFQA 1MQRA 2G3IA 1REQB 3CBWA 4H1ZA 1DOSA 3EA2A 5CSRA 4WQ6A 3VDAA 2C1HA 3S9IA 4M7SA 1NM9A 5JBFA 2GQ8A 5DCBA 4MJMA 3MKKA 4F9DA 1WDDA 1GPWA 1A5CA 3W86A 1S2WA 1B0IA 4A6GA 1W8SA 2WC3A 4JIRA 1RCXB 2ZADA 1VBJA 2E4TA 2CITA 2QT3A 4BKNA 2PPGA 3OLEA 5HJXA 1R2TA 4FLSA 2DH2A 4PYSA 4DB7A 3WNOA 3CT2A 2DVUA 3CNYA 1ZBWA 4MJZA 3MMBA 4Q22A 3MYPA 4GIRA 5HQEA 2NQHA 2XVKA 2BNJA 5D9NA 3EXRA 2E6YA 3QY7A 1S2UA 4PMNA 4JTIA 3ALFA 4ZO6A 4G8TA 2ISSA 3OU8A 2CLLA 4Z2GA 1RK5A 1DJQA 1L8NA 2XIIA 4AF0B 2GFTA 2YZ5A 4UTWA 1XUUA 2EHHA 4O54A 1G4SA 4LBSA 1MWOA 1PZ0A 5DMLA 1CGVA 5D8ZA 1US2A 3MHFA 4DHGA 1Y5VA 4PUEA 4CUCA 1B5TA 1VFUA 1CW2A 3A4XA 1XV8A 1IEQA 3H55A 3T07A 1SO5A 3IJ6A 1JCYA 4XZIA 2WVTA 3L68A 4A8RA 2AOSA 1XGDA 3RXZA 3CXOA 3VGDA 4WXYA 2AMXA 3SFKA 5A8MA 2GGJA 2JGQA 4Q8OA 1FH7A 1RHCA 1PCWA 1K8ZA 5E70A 3R94A 3EX6A 1KM4A 2WSQA 3DHFA 1XGEA 2Z1KA 3M1ZA 1I2OA 5G2WA 2QJHA 2DQWA 4M0XA 1B9ZA 4KEMA 3UWZA 4JR5A 4XAPA 2X05A 2ZRUA 2Q02A 3HURA 3NVDA 3RO8A 2QQ6A 3WLTA 1YE6A 1QASA 4GFSA 1I75A 4PBFA 3W9ZA 4H9UA 3M7SA 1J4EA 1S1RA 4LYKA 3WMCA 3QV9A 1SFTA 3SQSA 2W0UA 2YA1A 2INZA 1G69A 4LPCA 3ZLFA 1OM0A 1KFBA 3GTNA 2F6UA 3LUTA 2ZXAA 2PDCA 5I77A 4REQA 1IF2A 5E0FA 1KFWA 2XM1A 3WD0A 4JHOA 1JVNA 2WWCA 4Y2WA 1VPQA 3O6AA 1NIUA 4G7EB 2PDBA 1IZCA 2V67A 3N19B 3Q67A 2DUZA 2PLKA 5CPNA 3QJAA 2AL2A 3GW3A 3OA5A 4HD5A 4V1XA 4DZ5A 4WF7A 1OQFA 2XIQA 3GY1A 5EU9A 4NNAA 2RDWA 4JTUA 4WHBA 2VEIA 3VGGA 1FTXA 2OEKA 4JGDA 3T42A 4OJYA 3ZT7A 2Y85A 1YXDA 3CAKA 4DLFA 3B4YA 1YNYA 4AD3A 3AU2A 5D32A 3W27A 2RGLA 1NFBA 5I7GA 1LROA 1WP6A 1R30A 9CGTA 4MIMA 1S2CA 3FXYA 2ZZ1A 4B5XA 3E9AA 3CV1A 3P61A 5D33A 2Z26A 4IFOA 4ONVA 2H6RA 1H1NA 3F7JA 4WJ8A 2VFDA 3MA8A 1G6CA 1TCDA 3W85A 4ZFMA 1WDQA 4CQAA 4KFPA 1RAKA 3QV7A 4E0CA 6A3HA 3ZWTA 2VGIA 3S1VA 1E6XM 2Y5JA 1C93A 3MWCA 4MY1A 3QHNA 4IH3A 1MMFA 5BRPA 4FAMA 3UA3A 1EF2A 4J1OA 1BKSA 4YTUA 1JZ4A 1NSJA 2A4AA 3KCLA 3R2GA 4AOPA 1DWIM 1P7TB 3UERA 2HISA 4K8EA 1V0NA 2V68A 3N73A 2VD8A 2E5DA 4EF8A 3VM5A 4MB1A 5HNUA 4J3WA 1H7NA 3OR2A 2VX4A 1HKVA 2BODX 1IIGA 3F5LA 3STEA 2DZAA 1Q6OA 3RYSA 3LCIA 2WMIB 3DHPA 2CZDA 4YS1A 1ZL1A 2YL9A 3OG3A 4FOJA 4DUXA 3BC9A 3VGBA 3W4RA 2GJLA 4EPBC 1EOKA 2QCDA 4Q4SA 5C6MA 3RX2A 4KF1A 1XDJA 4YN5A 3V0UA 1BWKA 3LGEA 1IQ8A 5EBUA 3LPPA 4FB7A 3MPGA 2JE8A 1W6TA 4QP0A 4P8XA 3TTYA 5EPDA 4D8AA 1FWNA 1UZ1A 1PZ1A 3H12A 2OPJA 2W5FA 4HA4A 3B0LA 1PV8A 3B8SA 3DEQA 1GVOA 1SMAA 3RM8A 4AY7A 4D6GA 1SO4A 3LHTA 4BF7A 1PO9A 2WZEA 1JCLA 1W17A 1W5MA 3LI1A 2ZA3A 3FAWA 3TYDA 4AWSA 4DJDC 3TR9A 1BRLA 4L56A 3EB4A 3VM0A 1JPHA 4QSFA 1ME7A 4FA3A 4ICNA 4E4PA 4XZWA 2GSHA 2WK2A 1W9XA 2FJKA 3BG3A 3CHCA 3WQ6A 4QEEA 5HR7A 4GQ0A 3W2NA 4OOZA 5FL0A 4GNKB 1WXYA 2YCEA 3AU6A 2D23A 4BEQA 3BARA 2Z24A 1JF6A 2WJDA 2PCEA 2WZHA 3GXNA 3HTWA 3WH5A 2VR4A 3C61A 5C0QA 2FTWA 5M1TA 3M07A 3SIMA 3S2JA 4E6MA 3R6IA 1ZHAA 2P88A 4QR6A 3B0PA 1O12A 3TXVA 2V5KA 3L4TA 4UMCA 4RE3A 1JNEA 5CJ5A 1ZB5A 2CETA 1EIXA 3MP3A 3T4WA 3AICA 4ZSTA 4DO5A 4QHRA 1UH2A 3CUJA 3TZFA 1CT5A 1BWVA 4NL1A 3HPXA 3UF9A 2QAFA 3W73A 3DFHA 1KXVA 1VCGA 1VHCA 1O94A 1C29A 3WEMA 5K4ZA 4X63A 1KLYA 4QX4A 3QOMA 4LVDA 1OADA 3W1PA 1KBKA 2J77A 4R85A 2Y61A 4LNYA 2J4GA 3UR8A 3LD5A 3HQNA 3HJZA 2JF6A 3EZ4A 1MRAA 3N2OA 3IRSA 1M7OA 2VEPA 3UZWA 4Q4MA 4PB4A 4A2SA 3M5ZA 4AD4A 3LBMA 4XISA 3QZAA 3GU2A 1PSCA 3BLIA 2OQYA 3RRAA 4YTRA 3Q45A 4GHRA 3JUGA 3Q37A 3T09A 3WQGA 3CZ8A 3MI6A 4YU1A 2Z6JA 4UR7A 1CXKA 2IPJA 2D3NA 2EPOA 3LM3A 4J3UA 3BGGA 1A5NC 4R9XA 1X6LA 1BPLB 1TR9A 4JTEA 2VZSA 1KM6A 1O68A 1K9TA 2OO6A 4PUDA 3B8TA 4I3GA 5I79A 3V75A 5HMSA 1UC4A 4UZUA 2D2GA 1QW9A 3HFYA 4AIEA 3TYZA 1VPYA 3WDRA 1THFD 1FXQA 4IQLA 5HWJA 4JEJA 1M1BA 3RJXA 1NY1A 4LYQA 3WCZA 3TTQA 1KLZA 4UFJA 5HANA 4H01A 4MY9A 1Z7AA 2PS2A 2XINA 3GZ3A 1KNWA 2YSWA 3N3TA 3MBDA 1XIBA 4KWUA 3GXMA 1U1JA 3AS0A 2XIMA 3MSYA 2PODA 3E38A 2OMAA 1J0IA 1Q4WA 4ORMA 3DGRA 4X2PA 2OTDA 3N4EA 4O1AA 3VKBA 3VKQA 1Z48A 3NWRA 3FYYA 3WNNA 4NJKA 2C3ZA 2IKIA 3ANUA 3QYQA 3D6NA 2I5QA 3P93A 3UWVA 4IZGA 1FP9A 4UQAA 2I16A 3WD1A 1S5WA 5ABTA 4ZXLA 3IJ7A 2ABAA 3H2EA 3G1RA 3EKGA 3W76A 2JGYA 1LL6A 1WAUA 1W9PA 3NVTA 2YCLB 2YL6A 1KRBC 1OF6A 3DKLA 2XVLA 3U6WA 4HT3A 2WW5A 4NI3A 3B8UA 4M6VA 2NVDA 1WKYA 1H5YA 3TAOA 3CQ0A 1VC4A 4DBEA 1UG6A 1E51A 3FEQA 5EGRA 2W27A 3VK5A 2MNRA 1UASA 2EPHA 3MQTA 5DO8A 1XYCA 5AYBA 1ADDA 4G2DA 3EEZA 1PHWA 1EX5A 1Q85A 2VURA 4WK9A 4Z17A 2DFAA 1AMYA 3W2KA 3W7GA 1VFMA 2HV5A 3QR1A 1WKFA 3ABXA 3JS3A 1KRMA 1UR1A 2G5WA 4J3ZA 2J47A 1JPIA 1OWQA 2VL4A 3AMDA 4O28A 1CGUA 3BCFA 2OELA 4LCSA 1X96A 3WENA 3HBLA 3M47A 1XYBA 2FHBA 4IMDA 1MDLA 1B3OA 3T6CA 2GGGA 3KP1A 1ZNNA 4DZHA 4M80A 3W1TA 1HJUA 1VYRA 3WLQA 1OY0A 2O4QA 3PANA 3PZTA 2P1FA 1IEVA 4AC7C 4LVFA 2X2YA 4RPPA 4G1NA 1AH3A 2Y62A 4Z2JA 3WH8A 1GKRA 1RCOB 1TWIA 1HGYA 4WSJA 2QVNA 3WUEA 1A4MA 4EXAA 4C1NA 2ZX8A 1L6GA 3VIOA 5FAJA 3URAA 4L61A 3ARSA 1T8QA 1QFEA 1DJGA 4U31A 4F48A 1FP8A 3RM9A 3UW6A 3T8LA 4L6HA 1SPQA 5TF0A 2P3EA 1OD0A 4W89A 5LGXA 1YPXA 2PDNA 2Q8XA 1JQVA 1EJTC 3IJDA 2DSVA 3ONBA 2QCFA 2V4JA 2XZ7A 5I24A 3NQAA 1LCOA 4I9JA 4LS0A 4L7ZA 1L6SA 3N13A 1E3ZA 4H41A 2DUXA 4RPQA 1OC7A 1QATA 2BX7A 4LVBA 4P7RA 3IJLA 1W5OA 1EX1A 4HCDA 3W7KA 1KGWA 8XIMA 2TAAA 1H7XA 1Q6DA 3EPNA 1HKMA 2G0WA 1E6PA 1CI1A 3E2QA 6XIMA 3PUEA 3S5SA 1GOWA 3H22A 3HFTA 3B3DA 1XCFA 3OW1A 3PTMA 4MWAE 2ZYFA 3WKZA 3MCNA 4JBRA 1MDRA 3O2LA 3E5PA 5REQA 4LAZA 2PTDA 4FZIA 1UMYA 3ZVHA 3AXHA 4LTSA 1HJWA 4C6KA 4F0MA 2VOTA 4MKNA 4GBUA 3HG5A 1PIGA 3SUVA 2R1NA 1SZGA 3VOIA 1TTQA 4IXXA 4ZXOA 3F1QA 1IE7C 2YCKX 4UTJA 2R14A 4DZAA 3NTYA 5C54A 3RMEA 1KO0A 1JUBA 2G97A 4GJIA 3N29A 1H51A 3EYPA 3VA8A 1XLDA 3GVRA 2PF8A 2XN1A 3LLFA 3VKDA 1Q8AA 4MWAC 4RUBA 3F5KA 3NSMA 1V03A 4E8DA 2X42A 2PLJA 3WQDA 5HULA 3A12A 4JQ2A 3CEPA 4IIFA 3UZJA 1UD8A 2Z1WA 1KB3A 1W56A 1GK8A 3SDOA 2NQZA 3GKFA 4YWSA 1PUDA 3VU2A 1UOKA 3HN3A 3W28A 4NYYA 1HKIA 3KOYA 3VDHA 1HVXA 2F6XA 4TV5A 4M5PA 3GSMA 4ZOCA 1EJVC 3MM9B 2P76A 3KZPA 1A3HA 3SCWA 1N8IA 1TJ0A 3RFAA 1FCVA 3PM6A 2E3ZA 3CV2A 4EF9A 4S3AA 3AHXA 5XINA 1Q6QA 3PZOA 3EOSA 3L9CA 4F40A 1VFHA 1DV7A 3ES7A 5DRCA 4HNUA 3AHZA 4W5ZA 1LRQA 2O0TA 4R5EA 1J18A 2X09A 1U83A 3JU2A 1UWTA 2A2IA 3AIWA 2XVPA 1A49A 5HK4A 2WKJA 4X61A 5TBOA 2HE8A 2E09A 2XUCA 3BJSA 1AD4A 1HVQA 1UQZA 4Z1BA 3CO8A 1MVYA 5AZ0A 5HWMA 3V35A 2X41A 4LAOA 1MXDA 5CSSA 1LUCB 3CHEA 4AEOA 3FV9A 1XIDA 5CPSA 2PU1A 4MUZA 1CLXA 1EDTA 4F0SA 5G1TA 4QJ4B 1F3TA 3GXTA 3C0JA 3AISA 5HNRA 3TOYA 3CIXA 2H3BA 1TQJA 3SCNA 1X1NA 4C6PA 4CVWA 3UWUA 4PN2A 1TIWA 4EKJA 2YB1A 3D3AA 3ABQA 2AGKA 2NX3A 2NW0A 4DUVA 2NUXA 3HU7A 2Y4SA 3U3HA 3TN4A 1LORA 4P7NA 2QHAA 2RKXA 3W29A 4AEEA 2I5GA 2HQAA 4RXGA 1T0OA 4GG9A 5E0CA 4DXKA 5D2YA 2XGBA 4C91A 1WB0A 4NP7A 3S4TA 1B4EA 3MSRA 1TSIA 3LI0A 2VWSA 5D2WA 3MP4A 3O8AA 1L2QA 4RZBA 4O1BA 1T5AA 2CZFA 5CBBA 3FA3A 4NX5A 1A53A 4FXRA 1D7KA 3NYDA 4PCTA 1EJUC 3M0JA 2OZ0A 3S6TA 2X7VA 3S5YA 4N42A 1UKQA 5E93A 1F05A 5FJTA 1T96A 4NAFB 1OX4A 1E4LA 1OJXA 2WMFA 2B31A 4CNPA 4HU8A 1IZKA 5AECA 3M16A 4QCEA 2VM8A 3P7YA 5U4NA 2XIBA 1EO5A 1EYWA 1QO5A 1J10A 3WK0A 1CLKA 3S8HA 3QFEA 1WCGA 5T9CE 3FX4A 3T0AA 3C5QA 1MI3A 3NL2A 1F73A 2OODA 2CLMA 1H63A 2GPTA 5JUVA 3ONCA 1H4PA 4IMGA 4ZA0A 3QMSA 5G4WA 3U5YA 2J8GA 3MC5A 1TVLA 3URQA 4I8DA 1OYBA 1GW1A 1F3WA 4WOZA 1E56A 2ISVA 4MNMA 3BAKA 5I3HA 2ZWYA 5I3DA 3T05A 1AFSA 4UWMA 1RD5A 1C3FA 3B40A 1KXQA 3SJNA 1PIIA 1KKOA 4H6QA 5CZ0A 3WG6A 1H11A 2FMNA 2Z7KA 1XIIA 2ZZ5A 1PX4A 4A4AA 1GZGA 1XLMA 5AYYA 1AW1A 1WBJA 1G01A 4K37A 4TUFA 1B4KA 3L7RA 4W8BA 3BPWA 2G3FA 3GNNA 3W1MA 4LC8A 1MUCA 2HROA 4JCLA 4ZBCA 1S5NA 2CBUA 4RV3A 5I3JA 1WDSA 3KRSA 4UTLA 3R79A 3PC0A 4O0ZA 3NQVA 2MANA 1X6UA 4IICA 1EOMA 3CWNA 1PCKA 3LRMA 1QHPA 3N12A 4O53A 1TTJA 3O06A 3VCRA 4AFYA 1E4IA 4X9SA 3C0LA 3HPZA 3B0YA 2ZUNA 3VILA 2Q3RA 1TE6A 4AU0A 4A22A 2J25A 1JNDA 3GXPA 4AC1X 3RJYA 2QULA 4TU1A 3NDZA 4W8AA 4ADSA 4EWJA 1LQAA 1GKPA 3MU7A 3UGVA 3RDKA 2E9LA 3DHUA 2BXVA 1SMDA 4A8IA 2GDQA 3TCEA 2BLEA 1OF8A 3ARZA 5TIMA 1H1YA 4M19A 4B3ZA 4MMWA 5LZLA 1R9YA 1KFCA 1PJ9A 3THQA 5E6YA 3OTRA 3UXKA 4GVHA 3KOWA 2TYSA 2QEZA 1JZ8A 4UNLA 4D2JA 1SSDA 3QTPA 3CPGA 3AUJA 1QI3A 3NM1A 1EP1A 3TWAA 4JTJA 3AIQA 4C7DA 3GFZA 5LHFA 3C86A 2ZRWA 3K13A 2CBJA 4NNCA 3AO0A 2J78A 4PRWA 2CWNA 1UWUA 3QPEA 1K1DA 2XYLA 5AOUA 1S2AA 4KIRA 3SCPA 3NAVA 3EDEA 1UP3A 2ZC8A 3CIVA 1JD9A 3GDRA 3JRKA 3UWWA 3OZMA 2UY3A 3C0SA 4IIDA 4L1GA 3VABA 2QVHA 5HINA 3WDHA 3S46A 1TPB1 4LEFA 2HSAA 2NV2A 3N9RA 1ADSA 4XTDA 4ZQOA 4UQDA 3VGHA 1XIHA 4GC4A 2QJGA 4JXCA 1PIFA 3WLLA 2OLHA 4CQ9A 1UD3A 1EEXA 3ARYA 4IGNA 3A3XA 3NQBA 3VIFA 1K03A 1OT1A 2Y8KA 3QQ0A 4P8UA 1B3WA 2WB5A 4RZ5A 1Q6CA 1Q63A 4DWSA 5LXXA 2NQLA 2BG5A 9XIMA 5G4EA 3K1DA 2DT2A 1REQA 5EY5A 1JD7A 4U5IA 1NDZA 2QCMA 1KFJA 4MJ4A 3TWBA 3CYJA 2WVUA 3GTFA 3G22A 1GVFA 2PWUA 1GONA 1G67A 4GUHA 4C6MA 4PEKA 5CZSA 3H53A 3UVIA 2PBGA 1FWGC 3B9AA 4DO6A 4I9MA 4PUUA 2ZDRA 1QPQA 1KM5A 4AMCA 1CNVA 4MPKA 1X8CA 2PDMA 1UWSA 4DO7A 4HMEA 1K6WA 3GYEA 3ME3A 5FEZA 4Q4PA 3N6JA 4WR3A 3EPOA 3EX1A 1K3UA 3GDKA 1KXHA 1F6PA 1CPUA 1VRDA 3VO0A 3RK8A 3VOCA 3SUSA 3VNZA 3R11A 1GVQA 4Y9AA 1RJQA 2E6DA 4O0QA 4JTFA 4E2VA 1XJBA 3NDOA 1R46A 2CXGA 3KHJA 3SRFA 4G39A 1TUFA 4YMZA 1WDPA 1X39A 2TPSA 4YPJA 4GPNA 1G1YA 3G1XA 4NY2A 2PRHA 3EXTA 1IEWA 5KINA 3FFSA 3DG6A 5J04A 2Q8LA 1ECEA 1HKJA 4GC3A 2WQDA 4B2DA 4D6JA 3ABOA 4W93A 1IV8A 4DI8A 3M43A 1XSIA 5FJIA 4DWSD 4CNNA 5C9RA 2J7GA 5K4XA 1FFRA 5LNSA 3BOFA 1PHQA 1JZ5A 2FYMA 3Q94A 5F4WA 3CHDA 3I6TA 5JIWA 2DJXA 3N2XA 2ZUWA 4WXZA 1XIFA 3FEMA 3O0FA 2DZVA 1EPXA 1IEXA 3KTXA 4FNSA 3PNZA 1VFOA 5DX7A 3GG7A 2VOMA 3VX1A 3V4BA 3S1WA 4X9YA 1O5KA 1TWWA 2BXZA 5C9XA 1E9YB 3ZLHA 1EGMA 3LXAA 4MDOA 1CXEA 1P5BA 4HPXA 3CAQA 1KM0A 1AA1B 4PBEA 3CLMA 4C60A 1SGJA 1MXGA 1S5TA 2D20A 5A2CA 1J93A 1V02E 3H7UA 1TO3A 1F2JA 1LLWA 5GQBA 1Q2SA 4H3DA 2ZC1A 4U28A 2G41A 4QDMA 3VKPA 1PZ2A 3HOJA 4LNCA 3T1GA 3M0HA 4GY1A 4AH7A 4IT1A 5DT5A 4GYJA 4HJWA 1XD0A 1SZFA 2YDAA 4AG0A 4B2DD 1FDYA 3TC6A 3UBPC 2WHMA 3GU9A 4GY7A 2GGEA 4ECLA 3GWQA 2AL2B 3VXGA 4G7EA 1DXFA 8CGTA 1ZBKA 3FKRA 5TNVA 5B7ZA 3I3DA 4AIBA 1NDWA 1I45A 3VD5A 2GK1A 4HHLA 4AWUA 5I2UA 2VD9A 4JFTA 4AZCB 3LDVA 3XINA 2DH3A 2FJUB 8TIMA 4QS6A 4N0RA 1E1FA 4GXPA 4HSHA 1AQFA 1FY6A 4WJEA 3A3HA 3COTA 5EFFA 3I4KA 1MSSA 4HHMA 4TVDA 2R91A 3KX6A 2A79A 5HJYA 4A3QA 3B97A 4LC6A 1RXOB 2J6XA 2YYTA 1XYFA 1PPIA 3HIJA 3R12A 2P0OA 3TNOA 5HDRA 1RZMA 4PCNA 4WX2A 2WMGA 5A95A 3SB0A 2O9PA 2VWTA 3ITTA 5HMEA 2BDQA 3P5ZA 4A8LA 2WBGA 1A80A 4MY8A 1QPOA 2VKZG 1A47A 4OQVA 4FXFA 1ZRQA 3KTCA 3S5OA 4F79A 2VC7A 2VC5A 4I5XA 1GTHA 4QRNA 1DJXA 4RCXA 3LMYA 1IT7A 1VEMA 3IV8A 3PSVA 1OGSA 2J7BA 4KFOA 4JIHA 3P14A 3ZSTA 4IJRA 1LRNA 2Z2BA 3ZYZA 5KSWA 1P7TA 2V6AA 1XINA 5DMMA 5A2AA 1A5UA 1OFOA 1N7KA 1YIXA 5JBDA 3A4JA 4HOWA 2PDJA 3GAYA 1M68A 4AY8A 1XISA 1FCUA 3APGA 3CQHA 2WMIA 5ENLA 1XG4A 3AS3A 3PPGA 3ZR5A 5CCZA 4O52A 5D04C 3B0NA 5CAHA 1HQTA 4NRSA 4JCMA 3PG8A 1TWSA 4BI6A 3CTLA 1MUWA 3DECA 4PMZA 4FK9A 4OGZA 4F66A 3VLYA 3M5VA 1QXLA 4DO4A 3N4FA 3LG3A 5C9ZA 5C2CA 4AZIA 4IQEA 4L65A 2R9RA 1YDVA 2GGIA 1EC7A 1VJIA 4UQCA 2QMJA 3KOFA 4RNHA 4C7GA 1HKKA 2YYUA 1W1ZA 2ZRVA 2JKPA 1MW3A 3STGA 3E2RA 4AISA 1PEZA 4XZMX 2E28A 3P84A 3EB2A 1ME8A 1TTPA 2PC8A 2VGBA 1ZBVA 3IGUA 6CGTA 1BRLB 3N9KA 3NM3A 1R3WA 1D2KA 3C2VA 2NUYA 3CPUA 1T7LA 5FF3A 1W3KA 1M6JA 4UZSA 2GLKA 1TV2A 1HL8A 5ECVA 3CUHA 3F4WA 3C2FA 1NF0A 2XSXA 2ZOXA 3N6QA 5DT7A 5AN7A 4Z2KA 1XWYA 1ZAHA 4KEZA 1N8WA 4US5A 2A3AA 3EX2A 5B80A 3AWNA 2PDGA 4L80A 1QMLA 2RJGA 3GC2A 5CJMA 4CGTA 4I9AA 2PWFA 3PZNA 4KPLA 3PPCA 1CYGA 2VQUA 3ARTA 2ODOA 3GXIA 3WH7A 3VIPA 2VXNA 2PGEA 3S42A 3GG1A 3LBOA 3TJ4A 2QZRA 2DSKA 3PFMA 1C7SA 4IP5A 1JYVA 2O92A 1U22A 1H41A 3L4VA 3N2TA 2E0PA 2QF8A 4H9ZA 3KS6A 1Z3NA 2CLHA 4U33A 3V5OA 3UYCA 4JIQA 4XSMA 4XD5A 4S3CA 1QNQA 4FIQA 3N3MA 2BP1A 4CN1A 5KZEA 3HPAA 4PSRA 1NEYA 3WLRA 2FB3A 3W25A 3TXZA 2IS7A 3VD3A 2C14A 2FDSA 2Y5EA 3IJQA 4F2BA 3SRDA 4CD8A 3GXFA 1LL4A 1TPUA 2QCCA 5FEPA 1SW0A 4US5D 2X0YA 1XHGA 3PTKA 2GVYA 4UNKA 1AODA 4WGXA 3GW0A 1AL7A 2RHGA 1V6WA 5I3GA 4OUIA 5CPLA 1Q7MA 4MPQA 4E4FA 3RPMA 1ML1A 4ZOEA 2J7FA 1GCYA 3ITLA 3NURA 4YTTA 3MM7B 1I0DA 4CEUC 1N8FA 4RXFA 1KRCC 4KMQA 5IHSA 3L4XA 2FZNA 2I56A 1AW2A 2Z28A 4BQ5A 3GNRA 3HM7A 1TX2A 4CQBA 3MDUA 3MANA 1UWIA 3UWYA 3USBA 5IRPA 1XPYA 3OEXA 4K38A 2Y24A 2J7DA 1E6QM 3SFWA 1XW8A 3KL5A 2QNEA 4MF4A 4AD2A 3G1AA 4YVPA 3G1DA 5D9PA 1NQ6A 3IAQA 4K7YA 2VT0A 2Z0IA 2ZE3A 3NZGA 4CQDA 4OECA 2GYIA 2ZZ6A 1AZ1A 1P6CA 3WLMA 4FLRA 3OIHA 3APYA 4XAFA 3VX0A 3AS2A 4K1GA 4JL1A 1QNVA 3SM0A 3STCA 1NWRA 3WBEA 3W38A 3MMUA 3IPWA 1Z41A 2E67A 4B9ZA 1PL9A 4HVXA 2Z1SA 4IL2A 1LBMA 4I9TA 4AWTA 2WVVB 4J3TA 1LYXA 3MB9A 2YXXA 4GGBA 5J5DA 2PTZA 4GD0A 2FZ8A 4GQQA 3W24A 1F7BA 2O55A 1BLIA 1G4PA 1E9ZB 1Q6RA 2VRQA 4U3AA 2V5CA 1W3TA 4W4QA 4DPPA 1I6NA 1ZJHA 3SCQA 2V38A 3G0UA 1V51A 3VKKA 1VBHA 3PB2A 3VLZA 4YWIA 4KCUA 4EIVA 4UOQA 5I3IA 2KX9A 1H49A 4HMDA 3O63A 3QW4B 2P8CA 3W7JA 2WAGA 2YCLA 3LX9A 4WKAA 4R53A 1ODZA 3SURA 1UD5A 3GEOA 1DWJM 2OLAA 3EDKA 3TQVA 1MFVA 4F0KA 1DHPA 2YBUA 2POZA 4M6PA 1VLWA 4S1FA 3GR8A 4AZGA 2G50A 4ZQMA 2CLKA 4B5VA 4LVAA 3PF3A 4PUJA 3CM4A 3BSGA 4J7RA 4NIRA 3LYEA 4PMQA 4EX4A 3MUY1 4QTGA 2EPNA 2QCGA 4XG1A 5DXXA 1IWBA 2WJFA 3E2SA 3FJLA 3FK4A 3O6DA 5HBFA 5CGQA 3TKFA 4GYFA 4AD1A 4BFAA 3N9SA 3FY1A 4Q8NA 3N14A 3BUVA 3AYRA 4ADUA 2C16A 1XDMA 1UZHA 3VC6A 3GNDA 5A6JA 3C6CA 2C7FA 2CW6A 1DJYA 2FZ9A 4NAEB 4GACA 2ATMA 1D8CA 4MKVA 4MFDA 3S0CA 3DYPA 2OO0A 4WIWA 5KZDA 5I23A 1YNQA 3CL7A 5A1AA 3CYVA 3A6OA 4BEUA 1BWLA 4GXWA 4ZB5A 4HHHA 5GEPA 2QKFA 2G95A 3W2LA 1O6IA 3QZ6A 5A94A 4MNLA 3H70A 1JZ3A 1G7VA 4QAWA 3PN8A 3D3FA 3DH7A 2VFFA 4HYVA 2VO5A 2O56A 3HJEA 3VD9A 4C6OA 4PTDA 1LBFA 2IPWA 2VTFA 4GOAA 3TQ0A 4BA0A 3ITXA 4LUIA 1BFNA 2PBOA 3AYTA 4WDXA 1EHAA 4KETA 2JBMA 4GNJA 5C55A 7TIMA 1UR9A 1H60A 4CD5A 3U2EA 1KFLA 3GZAA 1HJQA 1A5LC 4S3DA 3DC8A 1QUMA 3CZLA 1E73M 3EDFA 4MSSA 1WKEA 2QIIA 1TE1A 3VINA 1KKRA 4Q33A 1RVGA 1F74A 3BJFA 3NPUA 1XKYA 3CH9A 4BS0A 4B4HA 1E6NA 4GQBA 4WRHA 2AQWA 5H1WA 4P7LA 2HDJA 4KCTA 1G94A 3BW4A 1EBHA 5G1MA 3A3WA 4E2BA 2BHUA 3TSBA 1VP5A 3QEZA 1TREA 3O6YX 3ZQ9A 3G1VA 3WQ4A 2PGWA 1ONXA 1ZCOA 3CZEA 3PJXA 4DBUA 5C70A 3WZ0E 2OOFA 1B3XA 1KXTA 3FA5A 3WLJA 1CEOA 2F2HA 1CZ1A 5H8PA 2YPIA 1TRDA 5MHBA 2R24A 3CIWA 3AZTA 2VUNA 3ZJKA 5H8MA 3DHDA 1GT8A 1FQ0A 1SR0A 1V0MA 3TK7A 1E9LA 1A5AA 3MUAA 4JX5A 2XFWA 1ALDA 4KKXA 2VENA 3RPDA 1OEPA 2TRSA 3WBXA 4NU7A 1XM3A 1VZWA 4OZOA 4WVXA 3PY2A 1WV2A 1CB2A 2CLPA 4GXMA 1ONWA 3MHGA 4P8VA 2WWDA 4JNYA 2A7PA 4M6QA 1BF6A 2VCCA 2WSKA 4GYPC 3DKJA 1AQHA 3E0IA 1GJPA 5DBUA 3G6MA 4J2PA 2I9UA 4GQRA 3U48A 4XUYA 2AQOA 2W61A 3GIPA 2Y88A 4M6UA 4WOQA 3LXBA 3GX9A 5A6BA 2PDYA 5BRQA 1R47A 1W1PA 1LOSA 4N2YA 1M3UA 5EA9A 1FKWA 4LUYA 1ZP3A 4OTKA 1YMYA 2OWCA 3W2MA 3WQ5A 2BGNE 4UFHA 3VMNA 3K4WA 2XHYA 3AC0A 3T40A 1DWHM 4NJIA 3I7RA 5H91A 4LVGA 4U2YA 3C2EA 3UG3A 1QHOA 4PTWA 3W01A 3MZNA 3N6HA 3SZ8A 5T8GA 3HPFA 1E4NA 1UC5A 4XV0A 3SW6A 4HCHA 5DY3A 1SJCA 2VX6A 3WDIA 5BCAA 2Z1VA 3VNJA 2PDLA 4AVNA 4QLKA 2GUUA 2OXNA 5BOOA 3WD2A 2V5BA 3LA4A 3MM9A 1V3LA 3CK5A 3PZUA 4IX2A 1M03A 1NWUA 5I07A 3GC5A 2GOKA 3Q2DA 4F8XA 1WZKA 2V63A 3C2YA 4RL3A 3TMQA 2OQHA 1UD4A 3CV7A 3E6EA 2BWGA 2WHKA 3UWQA 3W72A 3CASA 1Q13A 1OX5A 4AZ6A 4KWSA 4QDWA 4PB5A 3WK2A 4WY0B 3QLLA 1EL3A 1S3TC 1EJWC 1OIFA 4HZ6A 2ZUSA 3R58A 4QGCA 3VNYA 1ODUA 5A6BD 1IYXA 2V3GA 3LRKA 4UTIA 3RIKA 5DELA 1QR7A 4UTFA 3HMJG 2GVLA 4RE0A 1JR1A 1M04A 1TA3B 3RCMA 1CWYA 3SCSA 3GVGA 3KBWA 1ZGDA 3DERA 1K7EA 2B7QA 3V1PA 1V02A 3GAKA 3NL3A 5C71A 1JG9A 2VR5A 5KTLA 3B9NA 4XO6A 4OUEA 2PDPA 2W62A 1LUCA 4DRSA 3PWIA 4JIPA 4GZ7A 5FSEC 2C79A 6ENLA 1ITCA 3KVLA 3RHGA 5HOSA 4GA8A 2HBXA 1SJBA 3CV6A 7A3HA 5LSMA 2ZX9A 5LXEA 3DBPA 1J79A 2ACRA 2J9ZA 3G77A 1BKHA 3IWPA 2HXTA 3AIBA 3EB3A 3QQ1A 1D3GA 1BYBA 2DZPA 2DSWA 5CZKA 2V8ZA 4DXXA 4JFWA 4LS2A 3IACA 4RX0A 3VIJA 4N9DA 4LT9A 3R0KA 2WZTA 1TKKA 1E5JA 1KGUA 1Q5MA 5A6KA 2PE4A 3I3EA