4S3CA

Ispg in complex with epoxide intermediate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
402
structure length
401
Chain Sequence
GMRRPTPTVYVGRVPIGGAHPIAVQSMTNTPTRDVEATTAQVLELHRAGSEIVRLTVNDEEAAKAVPEIKRRLLAEGAEVPLVGDFHFNGHLLLRKYPKMAEALDFRINPGTLGRGRHKDEHFAEMIRIAMDLGKPVRIGANWGSLDPALLTELMDRNARRPEPKSAHEVVLEALVESAVRAYEAALEMGLGEDKLVLSAKVSKARDLVWVYRELARRTQAPLHLGLTEAGMGVKGIVASAAALAPLLLEGIGDTIRVSLTPAPGEPRTKEVEVAQEILQALGLRAFAPEVTSCPGCGRTTSTFFQELAEEVSRRLKERLPEWRARYPGVEELKVAVMGCVVNGPGESKHAHIGISLPGAGEEPKAPVYADGKLLTILKGEGIAEEFLRLVEDYVKTRFAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title Atomic-Resolution Structures of Discrete Stages on the Reaction Coordinate of the [Fe4S4] Enzyme IspG (GcpE).
pubmed doi rcsb
source organism Thermus thermophilus hb8
total genus 138
structure length 401
sequence length 402
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04551 GcpE GcpE protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4s3cA01
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 4s3cA02
2AKJA 2VP8A 4S3AA 3MM9B 1AD4A 2V4JB 4DAIA 3OR1A 3TYEA 3TYBA 4S38A 3TZFA 3MMAB 3VKPA 2DZBA 2Y5SA 3H2MA 2YCLA 4G38A 1Q7ZA 4D9PA 3VKRA 1Q85A 3TYUA 3H2OA 4HTRA 3TR9A 3MM9A 4S23A 1EYEA 2E7FA 2V4JA 3H2CA 8GEPA 3MMBB 4AOPA 2GEPA 3V5OA 4DJFC 3MMAA 7GEPA 4G39A 4NHVA 3H22A 3VLXA 3MM6A 3H23A 1ZJ9A 1Q8JA 3MMCB 1TWSA 4D8ZA 4S3CA 1Q7QA 4DJEC 3VLZA 4NL1A 4DJDC 4MWAC 2BMBA 3TZNA 3H24A 3OR2B 2H9AB 3VM0A 1TX0A 4PZVA 3TYZA 3TYDA 2Y5JA 3VKTA 3BOFA 3MMCA 1AJ0A 4DJFD 4MWAB 4NILA 4DB7A 4DJFA 3VKSA 2XSJB 3OR2A 1TX2A 2DZAA 1Q8AA 2YCJA 3B0GA 3MCMA 2VEGA 1ZJ8A 4DJED 3NOYA 3MM8B 1Q7MA 3MMBA 4DJEA 3B0JA 3B0NA 3H2AA 2AOPA 1AJ2A 4DJDD 2YCKX 4MWAD 3H21A 4MWAE 3AOPA 4DAFA 5JQ9A 6GEPA 1F6YA 3H26A 4O1FA 4S3DA 4D8AA 4DJDA 4MWAA 1TWWA 4G9PA 1AJZA 3MCOA 3B0MA 4C1NB 2OGYA 2XSJA 3MM7B 3MCNA 3MM5B 4S3EA 2Y0FA 4S39A 4NIRA 2VEFA 3VM1A 3VLYA 3MM8A 4S3FA 3TYAA 3B0HA 1AOPA 3TYCA 3MM6B 2H9AA 4HB7A 3B0LA 3OR1B 3BOLA 4GEPA 4O0QA 3K13A 3GEOA 5AOPA 4O1EA 2YCIX 3H2FA 4CCZA 2DQWA 3H2EA 2YCLB 1AD1A 4C1NA 4S3BA 3MM7A 3H2NA 3MM5A 5GEPA 1TWZA 3VKQA
chains in the Genus database with same CATH superfamily
3TA6A 3EDDA 4P5UA 3CZGA 1CLVA 4QDMA 3IVUA 4UQEA 3PS7A 1Z8AA 1X6UA 1VFHA 2C15A 1LCOA 2Y7GA 1HVXA 5CJ5A 4G56A 2TSYA 4FIQA 4MADA 1H1YA 1YNYA 3SGGA 4IPJA 4XK2A 3VCRA 1BXNA 1LQ2A 3W7JA 3W7NA 2Z2BA 4GBDA 1SFJA 1VENA 2XDFA 4NX0A 4EP8C 1O5XA 3TQKA 3EPMA 4XZHA 3AIWA 3P5YA 4AH7A 1H7PA 5B7ZA 3B0XA 5D38A 4GO8A 1RCQA 1XIGA 4LBSA 1F74A 2JF7A 3DYMA 1B3XA 1DIOA 2F6KA 4FOUA 3EOEA 3M46A 4DZHA 2DJXA 1OGGA 1WKFA 1XLCA 4ROPA 3U57A 1PKNA 4GI4A 1V6XA 3GSMA 3ZXWA 2G3JA 4M6VA 4JTJA 3WNPA 1TZ9A 3S6OA 4BZYA 5K3VA 1BVWA 2Y0FA 3VM1A 1OF6A 3NL3A 2XIJA 3AISA 3S1XA 2VOMA 1PHWA 1IT7A 3P3BA 4EF8A 4BF5A 2A6LA 3H2FA 3N6JA 1TV8A 3DHFA 2ALRA 1K9TA 2OZTA 2OZ8A 4M3PA 3N3MA 8XIMA 4R9OA 2VP8A 2BY3A 3BWWA 3B0UX 1NFPA 4XKMA 2F61A 4GXWA 2QDHA 1K3UA 3INPA 4WXYA 3GG1A 1SUXA 2TYSA 1R47A 1OX4A 4MYAA 4WKFA 3A47A 3DESA 2D2HA 2Z7GA 3R8RA 3GXPA 1RV8A 1AK5A 2DVXA 2XM1A 2P1FA 4BWLC 3UZJA 4AZIA 4XV0A 4IG2A 3W2NA 4XAFA 3N9RA 1OYBA 2BBFA 4DBWA 4GG9A 3WD4A 5D32A 4K7VA 4Z2IA 4N02A 1DJNA 4LRTA 4HK7A 1OT2A 4O4VA 3AOFA 3BOFA 3KBSA 3KLLA 2J25A 1P0BA 1X8CA 1D9EA 3CQHA 2J8GA 4ZB2A 2Y5EA 1LM1A 3KEHA 4KWSA 4M29A 3W9ZA 3S2LA 4DPPA 4AU0A 2DZSA 3MM8B 1Q7MA 1V6WA 4AWEA 2ZZ5A 3WQGA 3ERPA 2PRLA 2X40A 4LTSA 4W8LA 1NEYA 3FKRA 2ZZ6A 1VC4A 3W7QA 3GHUA 2P88A 2EPHA 4LANA 3AZRA 1S5NA 4DN1A 4H9UA 3DU0A 2XIOA 2BXVA 3W1AA 5LNWA 4QIUA 4IPNB 3OTRA 4HCHA 3O07A 3HMJG 3BK0A 2PF0A 4IT1A 2JQXA 4WLCA 4Q33A 1E9YB 3W1MA 2PDPA 1IF2A 3I7QA 4PMQA 1SM9A 3RU8X 3E6EA 3G6LA 3BGGA 4D9PA 3AXHA 3BTNA 4E6MA 1HG3A 1UW9A 2P8CA 4XKYB 5A2CA 1G69A 3M0HA 5KITA 4MPQA 3H2OA 3BV7A 4L9YA 3URNA 3KDNA 3VIGA 2XVPA 2BY0A 3W7OA 1BGGA 1QU4A 1WPCA 4IQDA 4U4MA 2WM1A 3UGVA 2YW4A 2V0TA 2YDSA 4MJZA 1EBHA 1BG9A 1HT6A 1NDWA 5I2UA 1QJWA 2JGQA 1KR1A 4O53A 3I6EA 3RM4A 3SCUA 2PTDA 4JNZA 3TA9A 4B4FA 4GQQA 5TF0A 4HA1A 3W74A 4HMEA 5G2HA 2C19A 4PMOA 3FXYA 1PTDA 5KZEA 2Z1XA 4UFIA 1AJ0A 1V03A 5EMJA 1XM3A 1WUEA 3N2MA 4BI5A 1WV2A 4D6DA 1REQB 3IUDA 4MJ2A 1HJVA 6REQA 1XRFA 3MI3A 3DXIA 2XFWA 4I6KA 2VCBA 4NZCA 4IPIA 1A53A 1Z42A 4MFDA 3BVJA 1RCXB 3LK6A 5BCAA 5C71A 1XLLA 3KOFA 4UCFA 4OIFA 1OC6A 1NWRA 4L56A 1UP2A 4O0QA 1EOKA 2PDFA 3W3OA 3PPCA 1UOKA 2XH0A 3EX6A 1BGAA 1QPKA 1HUVA 1GQLA 6TAAA 2EHHA 2Q8ZA 3RCMA 1MDLA 4O57A 2D69A 4C91A 5I03A 2VX6A 3H55A 4S38A 2Y5SA 2BSLA 2VDHA 1GTHA 3AXIA 3VC6A 3CXOA 3SGZA 2ZRUA 4JHMA 1PE1A 3M16A 3G1AA 1KTNA 2JK2A 3D46A 1ZPTA 2V4JA 1VYPX 4ZO8A 4GFSA 1OBAA 1XG4A 4DJFC 4EAMA 2P50A 3U2EA 1SMAA 5I3IA 3R0DA 5I02A 1Q3NA 4P2VA 1KBIA 2Z27A 1L6YA 5DRCA 3A5FA 2YLAA 3AQUA 1V6UA 1F3XA 2I17A 3F4DA 4XTDA 1JULA 4IXXA 4V27A 2VELA 3P5ZA 2WANA 2NSXA 5E09A 3SECA 2HRWA 2YFOA 5E6ZA 3NPVA 3GG7A 3UCDA 4DBUA 3NM3A 3ICJA 3RLGA 3MMBA 4PL1A 1QWKA 4BI7A 3ZVIA 5D05A 3NEHA 1VEOA 3NQEA 4PMDA 4FR6A 2H3DA 5D2TA 1ECEA 2GVLA 4M0XA 4N4QA 3R25A 1W17A 3H4WA 5GNXA 4UTMA 3FS2A 4NSBA 3N9SA 3GUGA 4V15A 2CIPA 4N0RA 2YCIX 1CI1A 2ZWYA 2G96A 4IUOA 4CGTA 2TRSA 3NSMA 2NX9A 4A21A 3ORWA 1VFSA 4E2BA 4E4PA 3GQYA 3W29A 2X09A 5BNKA 2A0NA 3FN9A 4EWJA 3UYIA 4HNUA 1BYCA 4YTQA 1JUKA 3R8HA 1VPXA 1OFEA 1U5VA 3G1SA 2OEMA 4AVNA 1QDSA 2WOQA 1PZ0A 2INEA 4B5XA 2AQVA 3HG5A 5M2FX 2XHYA 3JZEA 1ICSA 2VWTA 3BOXA 1DQXA 3S5ZA 3CMGA 3GLCA 3P6LA 1H4PA 1S2UA 1G9HA 3H23A 3EDFA 1WUFA 3NA8A 3HV9A 4NQ1A 5HQLA 3WF1A 2ZUUA 4CD6A 4PBFA 2W9MA 1G7VA 3R8GA 2EKGA 3QYSA 2RKXA 3SURA 1JZ4A 4WRHA 1WZLA 5C55A 4RXGA 2BOFX 3MY9A 4HYRA 5J04A 2FTWA 1Q6RA 2PGWA 2YDRA 4LALA 3CTTA 2VRJA 3FVDA 2ACQA 1WKEA 3YPIA 4HU8A 1V0MA 2XVKA 4DJED 6XIMA 2A7NA 1ZHAA 5FJRA 1UIPA 4M19A 2FPTA 2PDYA 1LROA 4KRUA 4Y9AA 4KWWA 4RZBA 3IGSA 1TMQA 3TMLA 3L5MA 2O7QA 1VB9A 2UWFA 1AZ1A 1U83A 3EEZA 2QCEA 4MB1A 4YWSA 2VCAA 3UXLA 4OTKA 4AX6A 3TW7A 3W02A 2W6RA 1V3JA 5AHNA 5F1UA 3TAKA 2VEKA 2NT1A 5KZ6A 4HZMA 2VOTA 1POKA 4U5KA 4NI3A 3UXKA 4S3KA 3MMCB 4GVIA 5G5IA 5A6JA 4JTRA 2E0PA 2HPIA 2A4AA 1CB2A 4O52A 3VZZA 1V3IA 5FJIA 4Z1DA 4GXMA 3CZ8A 1JCMP 2AKMA 4ZODA 2MUCA 7ODCA 5L6UA 2HSAA 3CQ0A 4GKTA 4DF2A 3FYPA 3QMTA 3FDGA 2NLIA 4S3GA 4XAPA 3RCYA 2CLPA 2XYLA 3O6DA 1GPFA 4IP5A 3P93A 5IHRA 4L1XA 2DV0A 3VCNA 3I7SA 1GKPA 3MM5A 5JH2A 1DJYA 1W5PA 4FHAA 4H8UA 1GTEA 1SZNA 3IJ8A 2B7QA 3CZEA 4QDPA 3EOLA 2QXWA 1GJUA 3DFHA 5H2ZA 4UFJA 2ISDA 1FH9A 3WBYA 1ODZA 3WDPP 1PDYA 4EXAA 3UWYA 4ZA0A 1GVIA 4X0VA 3TXZA 1WDRA 4JFVA 4DUVA 2Q8LA 3SDOA 4AWTA 4A8NA 5D30A 1EPXA 3HPZA 1ZY9A 3EYPA 5SWUA 4FPSA 3PJWA 2RDWA 2FPYA 3ENLA 3VC5A 3VM0A 2PDHA 3WF0A 3DEQA 4QROA 1ITXA 1TJ0A 1MFVA 1AH4A 2DH3A 2FKPA 2GSJA 3GD6A 3UVIA 3QC0A 3B9AA 3ARYA 3NXFA 5I24A 3ZMRA 1Q8AA 5AZ1A 3W2MA 1NELA 4QXIA 2G50A 4OOUA 4NJHA 3AWNA 1TWDA 1TWWA 3L21A 4JS3A 1KRCC 4EVZA 4HOZA 3C86A 1NY1A 4L4OA 3A9BA 1P7TB 1UOZA 3RR1A 3W7EA 5BRPA 3BG3A 3VLYA 1K03A 1KM4A 3PG8A 3OR1B 3LSCA 1KFBA 3MUXA 3N3TA 1MDRA 4PTWA 1XRSA 2ANUA 2E67A 2BZNA 3MZ2A 5CPNA 3LRKA 3STEA 2VI0A 1VFOA 5D02A 3GR4A 3UG4A 1CLKA 1T0OA 1BAGA 2WW5A 1LQAA 3PZGA 3CS2A 4O16A 3VOJA 5HNUA 1PZ2A 1GVFA 3T9PA 3BW4A 3ARQA 5LIXX 2NUWA 3AHYA 3ECQA 1UZ4A 2PWHA 4XD4A 3BAKA 3W1UA 3PAJA 1P6WA 2J4GA 3LV6A 1BF6A 2OYKA 3QMSA 4LT9A 3C8NA 4J3WA 1X38A 3DFTA 3QLLA 3RPTA 3Q94A 2G3MA 4JCMA 3TTYA 5IFTA 3TYZA 1FP9A 4O54A 1ADSA 1GQJA 1S2VA 2A2IA 2QDDA 5CPOA 2OMAA 4W4QA 3DCPA 3K30A 5DMMA 3VIHA 3F4VA 3WUBA 2DZAA 4IGSA 3CLMA 3EKLA 4GQBA 4DY1A 4JEQA 2GJXA 3UWEA 3G8EA 1ZCCA 2ADAA 4HMNA 2PLKA 1IXOA 1LDCA 2PWFA 3RIKA 1QOPA 3PC0A 3U5UA 1FWEC 3MSRA 3VU2A 4LFYA 3UR2A 4XO7A 2EQDA 4MKNA 1POJA 2OT1A 3SRHA 3N14A 4GO9A 3PZTA 4MJMA 4CCZA 1IEVA 5GVJA 1IZJA 3GNRA 3LCWA 4DLMA 3WK3A 1ISWA 1MUWA 3G2GA 3MDWA 4LYQA 4YVPA 3OLEA 4I3GA 3GTIA 4LC6A 4UFMA 2VFIA 2GUBA 3U7VA 3MPGA 3BAYA 5M3WA 1GONA 4UBPC 2JEPA 1HP5A 1WAWA 3QW3A 1MEHA 2GQ9A 3V1PA 1I4NA 3WX7A 1UWRA 4LNYA 2IMRA 3RK8A 4H9MA 1JAKA 4Q8MA 2FHBA 3NGFA 4LAZA 1A80A 2E9BA 3DDMA 4M24A 4UB9A 1BKSA 4JIQA 2ASHA 5DT7A 1KXVA 1R9YA 1KO0A 4JNYA 3TNOA 4OVXA 1H51A 3DKJA 1GEHA 4M8UA 4YWIA 1IIGA 1HKJA 4DX3A 1M6JA 1W1B1 3E2VA 4AVOA 3LY0A 3QQ1A 4IIDA 3MJYA 3Q58A 4LCRA 1GKRA 4DAFA 1XICA 3UWVA 2I56A 3GAKA 4DNMA 3IJ6A 4PA8A 4L9XA 1SFSA 4YTTA 3GNOA 5BOEA 1R86A 4JFWA 4IMAA 1Q6DA 1BFNA 4GQGA 1O5QA 4ERIA 1B9ZA 1W1ZA 1TIWA 4KPLA 3DHPA 3H2EA 3S3GA 4HNOA 1Q6EA 3C52A 3OBKA 4ZTXA 1P0EA 1WNOA 3GDTA 1UR8A 4WXZA 4WD0A 3VZYA 3EX1A 3TTOA 1QASA 2WLYA 2AAMA 4PUKA 1DIKA 3OYZA 1S3TC 1OZQA 3SSJA 3W2JA 4UC5A 2GVYA 1K9DA 2UY5A 3DH7A 3UETA 2FHFA 5AKQA 3RMJA 3K5XA 4HOWA 2J7GA 4AF0A 3GUWA 3S5NA 3T78A 4JY9A 5CJMA 1RQBA 2PLJA 4B5SA 3AU2A 1NSJA 1E0WA 4L4LA 2BMBA 2ZCGA 4UFLA 1GW9A 4RDWA 3LPOA 1NU5A 3O1NA 3WK1A 1FWTA 2WSYA 3I7RA 4XVEA 4E38A 1YX1A 3IGXA 1JYWA 3FAXA 4PR4A 4NP7A 1WDDA 2WAGA 3T8LA 4KF1A 2AL2A 3E1F1 3BLKA 4YLWA 3V35A 4YPJA 3THUA 5D2XA 1FX6A 3OBEA 3WO8A 4CQAA 1EL3A 5EU9A 3CO4A 3LCXA 1GHRA 4YVXA 1H11A 3ISIX 4QNWA 2QS8A 4AXNA 4H6KA 3LRMA 4HNLA 5DCDA 3IIVA 3IK4A 1HF6A 4L5ZA 3FEMA 1TWZA 1TYGA 1A3HA 5TBOA 4WX2A 3P82A 1BKHA 3MB9A 4MUZA 3OEXA 4K68A 3B4YA 3RN6A 1JI1A 3PTMA 9CGTA 1F5ZA 4L6DA 1UUQA 1XWYA 4EACA 4O11A 1C8XA 3RRAA 1JRBA 3E2SA 4IFRA 3AIQA 4LRSA 3PZMA 1QW7A 4AYSA 3TONA 3EXRA 3DYOA 4QCEA 1GJPA 3JUGA 5TIMA 1Q85A 4D6IA 5H8UA 1ZZMA 3M41A 5FA5A 3M7WA 1H62A 2R1MA 5U7SA 4DO7A 3GH4A 4GIYA 1VZWA 3NO1A 3WD0A 3GE7A 3NURA 3NDZA 1FA2A 1RR2A 4R7WA 2F6UA 1TTJA 1JQXA 1EKOA 3GKFA 3D3FA 3ARZA 4L80A 2ZZ4A 1K4GA 2BHZA 3CZJA 1X96A 1F8MA 3NVTA 4A35A 4IMEA 1R46A 4OU1A 1U2YA 1A5AA 5FOOA 5CQ1A 2HVOA 1VCVA 4IL2A 4UWMA 1FWJC 3M6YA 1QR7A 4B3ZA 4INFA 1PKMA 1E0XA 3GXNA 1NQKA 1VKFA 4EIVA 4O8RA 4H6RA 2W63A 4FLRA 3OHIA 3P7YA 3GH5A 4ZBCA 1PCKA 3GTNA 3G1XA 2NSOA 1DKWA 2OOGA 3PWIA 3G6MA 4ACYA 3GFYA 2R8WA 1V8EA 1XRTA 1PTAA 3FX4A 4HA3A 2O9OA 3A3XA 5I78A 4JTFA 3VD4A 3KOXA 3RAOA 1IEWA 3APYA 1YMYA 4WDUA 3FNDA 1VJSA 4JTLA 3CM4A 1NP0A 3LV5A 3T4CA 1QATA 2CITA 3MUAA 3TN3A 4J3VA 2IQTA 3E9AA 4IX2A 1R3VA 1NOWA 3UZ5A 3N2OA 5MF5A 2C79A 4E8DA 3N4AA 3UG8A 2F2KA 3L68A 1ZL1A 1TV5A 5H8MA 1PVNA 3IJ9A 2GSHA 5LIYX 4IMDA 4JTIA 1DQUA 1QCWA 2Y7FA 4LV4A 3O3RA 1I2NA 2ICSA 1FFQA 4DJEA 4NNCA 4P7LA 3TCEA 2YDAA 3STGA 1TKKA 1VBGA 4UTHA 1VAHA 1RQEA 4HZ6A 4HKPA 2TAAA 3WJYA 5MKGB 1RBOB 2D0GA 2DT3A 4FP1A 4FX8A 1BD0A 2R1PA 3VOHA 2IQ0A 1QO5A 3K13A 3BANA 3RU6A 2ZYFA 4XWUA 1AW5A 5HNTA 1DWHM 1GG0A 1ZJBA 3GDBA 4AXKA 4LY4A 3LU2A 3EWUA 4KCWA 3UJ2A 3AJXA 1FY6A 1I1WA 3WIJA 1W5NA 2D2GA 5F4SA 2HMCA 1I0DA 3ZLFA 2OKOA 5AC7A 2YKKA 2PI6A 1XKJA 1PWLA 3PSWA 4CN1A 3LMZA 2TMDA 3V1HA 4MAZA 3VXGA 3NQ8A 5C7VA 4HHHA 5FJUA 3CU2A 5IHSA 1ALDA 2PMQA 3SI9A 4YMZA 3PNUA 5I3JA 3SUTA 4JIPA 2WVTA 3CH9A 4HN4A 4AY1A 4FNSA 5HMEA 3NOYA 2D73A 3T42A 4MJ4A 4MZ1A 2CBVA 3RFAA 5C8BB 1OT1A 1FWRA 3POCA 3O06A 3V16A 1CPUA 3MCOA 3W7RA 1R2SA 4HT3A 4HNCA 3TXVA 2QEZA 1KFWA 1F3TA 4B9ZA 3LM3A 1TJRA 5G4EA 2W3ZA 4YTUA 4EK7A 4A6GA 3KCOA 2CXGA 3EXTA 4JPGA 3GW0A 3W24A 2ZX6A 3I4KA 2F8QA 1V3KA 3BAXA 3TU9A 5DLCA 4CU7A 4IH3A 3W2LA 3W7CA 1A3WA 1TV3A 5BRQA 2XH4A 5TNVA 2PFHA 1XH2A 3DGBA 3EX4A 2SFPA 2GEPA 2OJPA 2A79A 1ZJAA 2HCVA 3TEVA 3A22A 4HCLA 4OBTA 4JQ1A 2OXNA 3OLIA 3ABRA 1V02A 3I3DA 4KWOA 3IGUA 4B5TA 4TV5A 1ZFJA 4A3YA 2ZZ7A 1PV8A 2WZEA 1JCJA 2V3DA 5XIAA 1QNOA 1TG7A 4RW3A 2HBXA 5HAOA 1GOWA 5EMLA 2WZMA 2GL5A 4JXCA 3GU9A 3BLPX 4QLLA 4N9CA 4GZJA 4MSSA 3LCHA 1W91A 1W1IE 2PF8A 2VUNA 3U7BA 2GLKA 1YRRA 5FSEC 4JEJA 2YOCA 4NRRA 4QHRA 4YU1A 5K9XA 1VQTA 2HNEA 3BW2A 4Z1AA 2J77A 5DMLA 1F8IA 3KHJA 5IBXA 1OVDA 2ZUTA 3KXQA 3VK5A 1O94A 3H2NA 3QTPA 5GEPA 3AHXA 1FHLA 3GKAA 1QTWA 1K9EA 4H7ZA 1GEQA 7CGTA 2PLCA 3EB3A 1CCWB 1E1CB 2YCLA 4M6PA 1CENA 4H7VA 1FWBC 4ZCWA 3WLOA 1CXLA 3R94A 3PBUA 1KNWA 1HO1A 4LUYA 4O1DA 2ZX5A 3VE9A 4GVGA 3BCDA 3O63A 5EB8A 5M1TA 1BRLB 3I6TA 2X2YA 3BH4A 1DVJA 2WHLA 4JN7A 2QT3A 3ABXA 4GUHA 3H8AA 3KW3A 3A3HA 3SCNA 2VFEA 2Y7EA 2FTYA 1IGWA 1XC4A 1RD5A 4C6CA 5HR6A 4XG1A 4RCXA 2JALA 2PB1A 5A6BD 4PULA 3V36A 2DZPA 2G41A 1XIMA 4RV8A 3DERA 2WYSA 4CQDA 4AYGA 1QHOA 3CPGA 1H61A 1QI4A 1ONEA 2W92A 1E4MM 3T6CA 1C9WA 5AC6A 2E8YA 1HZYA 1K8ZA 3MC5A 4D8AA 1YPIA 3HPFA 3R12A 3EX3A 1XIDA 2QQ6A 4N6FA 1IWBA 3ZJKA 3B0HA 7PTDA 3ZS4A 4XX6A 3HF3A 4O1EA 3HU7A 4A4AA 1NARA 4AZ6A 3IARA 3PWAA 3OODA 4Y8FA 1NF0A 1OINA 3TSDA 2QCHA 4EXQA 2Y70A 1I1XA 1UD2A 4ADSA 2JIEA 4Y9OA 4B2DD 2XSAA 5AC5A 3RHGA 1W3HA 5L9FA 4JFTA 2ZDRA 4JFSA 2BOGX 2I16A 3BSGA 3PUGA 3WLKX 4Q8UA 3NPXA 1S2WA 1PJ9A 2Z26A 4HNTA 2WMFA 2CESA 2NV9A 2I1OA 4MG4A 3V18A 4ZSUA 2VL4A 4IICA 3NQBA 3NQDA 3W7GA 2JKPA 1CDGA 4TQTA 3O8AA 1DWAM 1DJWA 2FPVA 3LLDA 3PBMA 4UCGA 3DFPA 5FKYA 1XISA 4GC4A 3GDLA 3J7HA 4P61A 4CUCA 1VFLA 4ZO7A 2WBKA 1VJZA 4FK9A 2XFRA 5CG7A 2PPGA 4UTTA 4ZL1A 1BXCA 9XIMA 4PE8A 2VM8A 1U30A 1S5TA 3TQVA 4YHGA 2GGGA 4IF2A 4O13A 5D4YA 1NFBA 4IHCA 3H12A 1JPDX 3TQ0A 2V38A 4REQA 2CWNA 1GOXA 3THAA 1XBZA 2DQWA 3TFXA 2J47A 4ZEPA 3HGSA 2W91A 3GS6A 2BY2A 3ZWSA 1JUBA 3GVQA 3NGJA 3WJSA 3CASA 3NSXA 1UG6A 3C6CA 3BQ5A 3ARPA 1QXLA 3U4FA 1TCDA 3M64A 1VP5A 3G0SA 3G5EA 3OZYA 4H2HA 4GPNA 2QUNA 4EX4A 3SRKA 5LZLA 4FXSA 1XW8A 1YPXA 4NASA 2FMNA 2D20A 4I8DA 1FCBA 3FJ6A 4ATDA 5A8QA 1N8IA 1K7EA 1NDVA 2J79A 3GNDA 1NDZA 2E9LA 3KOWA 4M81A 1H5YA 1KXHA 3EXSA 2MNRA 3VUPA 3VI2A 1EO5A 4JHZA 2HQAA 2DW6A 2VGIA 4NILA 3V0UA 1E43A 3DGRA 2UY3A 1UA7A 4JR5A 1R30A 4IFKA 3UXAA 4QEEA 3H26A 4FXFA 1HL8A 4J4KA 1UIOA 1W1YA 2A3HA 2HK0A 3LHYA 1TWIA 1AVAA 1UMLA 4DF0A 5HK4A 1ECQA 4TVCA 4OJYA 1OD0A 1EC8A 4UQCA 3WNNA 1N8WA 3BLLA 4PMJA 5EPDA 2BY1A 4J7RA 4XO6A 1X98A 1GQNA 3QRHA 3WDQA 1FXPA 1SW7A 4MY1A 1UZDA 1XSIA 1TPVA 2PDJA 3WMBA 1QUMA 3M4HA 1NQ6A 3VE7A 2CLLA 4YTRA 3CAQA 3H2MA 3TLLA 4AHQA 1EJVC 1CLXA 4HMDA 4QQ3A 4XZMX 2E7FA 1G1YA 4XAYA 3IPWA 4B3KA 2VMFA 1BTMA 4K7YA 3U5YA 3SM0A 1JPIA 1KA9F 2ZX7A 3OGVA 2JE8A 3W2UA 3U48A 2UY4A 2J7BA 2B7OA 5FCZA 3RPMA 4H19A 2CZEA 3AYSA 3B40A 2ZA2A 1XJBA 4LUSA 3VD7A 1OEPA 1BQCA 1KW1A 3STPA 5C70A 3QGKC 4IISA 1EBGA 2Q6ZA 6TIMA 2J13A 2DZWA 3N18A 2QV4A 3CV7A 2EPKX 4IWWA 3TMQA 3SQLA 2I5GA 4PTDA 1MFUA 3RILA 1XLBA 2BWGA 4LJ3A 4R9XA 1JNEA 1P6BA 1ZAHA 4ILSA 1W9DM 3MMDA 4GYPA 2CZDA 1W2VA 2OQHA 3OYXA 4ZFCA 2J66A 3MP3A 3ZR5A 3RF9A 1OFQA 3ITGA 3SIZA 4HQVA 5HNNA 1CXHA 4IQLA 1I2QA 3B8WA 2JEQA 3WMSA 2XFYA 2VUYA 4OHQA 1M7JA 1W8SA 5D9PA 1Q66A 3QXBA 1OQFA 4CNTA 1BSIA 4EOUA 1V0LA 4D6EA 3LBCA 1B9BA 5F7UA 1TB3A 3FHAA 3M0ZA 5D04C 4ZXOA 1DORA 2A85A 5EA9A 2QF8A 1V3MA 4HVXA 2C0HA 2ISSA 4PC8A 4F8XA 5JU6A 2UY2A 1C8YA 1HN1A 1FDJA 4S3JA 5A2AA 2VZOA 1WE5A 1BVNP 4PCSA 4L64A 2A3EA 4C6IA 1NM9A 1F2JA 1GGOA 1QNRA 3NL6A 4F4RA 5CSUA 3WQEA 4R34A 4DJFD 1KBLA 1QNVA 4BEQA 2CHNA 3BGJA 2E6DA 3VGFA 4ZR8A 1UWAA 4C60A 1PIGA 1J9YA 4B15A 2V63A 3RM9A 2C1IA 4ASTA 1FFRA 3GDMA 3S5OA 3H54A 2B7PA 3IRSA 5D33A 3CUJA 1B54A 1TR9A 3GEOA 1ISYA 1XINA 1EA9C 2YZRA 1LQ0A 4XQ6A 1E6XM 3SY8A 4GXPA 2CU0A 3H70A 3CB3A 4TTGA 4N6EA 4AD0A 2VR2A 3PPFA 4WY0A 2DZBA 1XL9A 3E0WA 1GOIA 5H1WA 4NAEA 1GKQA 3VFCA 1QBAA 2QJNA 3D47A 3NFUA 3UR7A 2D0HA 1DWIM 1T5AA 2ACSA 1W3JA 4YTSA 2OYMA 4V28A 1UJQA 1OC7A 3UG3A 5HBFA 4DUXA 1W54A 2Q3RA 2DSZA 4HNVA 4A3UA 1LOLA 1XGZA 2BASA 5A95A 4V33A 2GK1A 1QI3A 2BVWA 4OZOA 2Y5JA 1JCNA 1US0A 1DPMA 1FH8A 3VMPA 1J11A 3PVFA 4DQWA 4MVAA 1RJPA 5HQEA 3TN4A 2UV8G 5EY5A 3LN3A 1LLOA 4GWEA 2XSJB 3MA8A 2ON3A 1DYSA 3WLQA 3KLKA 5DQPA 1AJ2A 1E3ZA 2I5QA 1P6CA 4HPGA 3WG6A 1PDZA 1EX5A 4LUJA 2P3EA 4GABA 2IKGA 3M0IA 1ZQ5A 3H7VA 1H49A 1C7SA 4EANA 1A5NC 2YBVA 2G8ZA 1Z9AA 4R3UA 2IPJA 3GBEA 4QJ3B 3R0UA 1UP3A 3K1DA 3T2QA 4US5D 3AIVA 4HMCA 4GA8A 3UP8A 2PTXA 4BK9A 1IR1A 2DORA 3IUIA 3Q65A 4C6OA 1L9WA 2GGHA 3RPDA 3AMLA 4JYFA 2CZ5A 2VT0A 3T40A 4D6FA 2VFDA 3B9EA 2WO5A 1V79A 1GORA 4BJHA 2C7FA 2C91A 3ZR4A 1JDEA 4C7FA 5HMFA 3ABSA 2O55A 4LUTA 3VNMA 3QC3A 2JKAA 3NYDA 2HK1A 3KVMA 3ES7A 1V93A 2NX1A 4U5IA 1TCMA 2VQTA 3UD6A 3I3EA 3MWCA 2PC8A 3REQB 2YYUA 3FFSA 4H6EA 3I6RA 4UZSA 1B57A 4MOZA 3GIPA 2QUTA 5LNSA 3A6OA 5FF0A 4MY8A 3HM7A 2E9MA 3ZM8A 3GYEA 2I9EA 4MWAB 3A4WA 1PZ3A 2PTYA 1YHTA 4L9ZA 4KEUA 5JMUA 1PS9A 4UUIA 1LRNA 2WMHA 1Z3NA 1J6OA 2OB3A 5TAOA 2PDBA 3UERA 3E5BA 1G4SA 3MM7B 1OGSA 5FJPA 1JD9A 5K9CA 2O7SA 2Q09A 2JBMA 5IDIA 4Z17A 3EMZA 3LQGA 3OOQA 4JTGA 4FAMA 3ZT7A 1FXQA 2AKJA 2H8ZA 4MAVA 4MPKA 2IUZA 3SY5A 3ZLHA 3DIPA 2OLAA 4I9MA 2WKLA 4JCLA 1E6ZA 3L12A 1O68A 2Q8XA 4MMWA 3HPAA 2ZTJA 2ISVA 4YHEA 1E6PA 1E9LA 2Y85A 3DX5A 2HV5A 5A2BA 3WJWA 1OFOA 1QMLA 3S47A 3FGCA 1F07A 1X6NA 3SR7A 9XIAA 3N2TA 2V67A 1SFLA 2PDNA 4HJWA 3VUSA 4LSBA 3K8MA 1IYXA 2C1HA 4ZOCA 2GWGA 4JX6A 2V6AA 2YL9A 1QFEA 2E77A 2HNHA 3PTQA 4ATWA 1CXIA 1QPRA 2ZTKA 3P60A 3TX9A 2C16A 3C4UA 4QLKA 3URAA 4J2PA 4W7UA 3IWPA 3EKGA 2YCJA 8CGTA 2AGTA 4K1WA 1CXFA 3VABA 2A3CA 2Z1BA 3VKCA 1HKKA 3CUXA 3SGUA 3SRDA 1OIFA 3W7PA 4M1BA 1KD0A 1M01A 3LDVA 3W87A 2QAPA 4GNJA 3ONBA 2ZIDA 4AIEA 1OWQA 4FR1A 4GK8A 4K8HA 3NDYA 5CPMA 1GT8A 3PSVA 4GIRA 1XRVA 2FMOA 1FBAA 3M5YA 3C0JA 4GJ1A 3WDIA 3B8UA 1XCXA 2FH6A 1XBVA 2A21A 1DXIA 1RUSA 5E0CA 1PIFA 4B2DA 4N9BA 1VCFA 1KGWA 4NZ3A 3R7MA 1ZP4A 4AZCA 3LPPA 1QVBA 3B05A 4GI8A 3ITCA 3B9NA 3RMEA 4IGMA 3SJNA 1EHNA 2FFIA 2WXDM 3QSTA 4JL2A 4DO5A 5J5RA 4Q4OA 1MI3A 1JDAA 3T09A 4ZO9A 1KBJA 1KCXA 4H9ZA 3GAYA 2CCRA 2ZRYA 3TZNA 4Q8PA 3B0PA 3MSGA 4FF7A 4JIEA 4UTKA 3KRZA 4ENLA 1IZCA 5T8GA 3NVDA 1N55A 1E1CA 1JZ3A 3OVQA 4LVAA 2Q01A 5HWMA 1IXPA 4PL2A 1OY0A 3P80A 3OR2A 1PWMA 1W9UA 2P3ZA 3KTSA 3FEQA 1GYLA 1W3IA 2WMKA 2V5JA 4W7WA 3W7IA 1LUCB 3M9YA 3NZQA 2V2HA 1NOUA 2DSVA 3DFYA 3E12A 3U6WA 1TTPA 3LCFA 2A7RA 3T2OA 5PTDA 2FFCA 3L4WA 3VDHA 2PP1A 5A5WA 4GIAA 2LLEA 3TC3A 4UNLA 4WCJA 4DXKA 3WF3A 1M68A 1D3CA 4BCEA 4JD4A 5I3HA 2I5IA 1E70M 5AHIA 1J2WA 4YN5A 1UZ1A 2WZTA 1UASA 3UESA 1SMDA 1M04A 2J27A 4HNNA 4Y7EA 4FA3A 3AXMA 2F6XA 3GX9A 4KGLA 1B1YA 3HQPA 2X7VA 5CZKA 3QPYA 1EXBA 1ITQA 3IANA 2ESCA 3N2CA 3TTQA 1W5QA 3ABZA 1GZGA 3VD9A 4HHLA 3QOMA 5JBDA 1JZ5A 4NHVA 3TJIA 5CC5A 3AUJA 2EJ1A 6ALDA 2YGYA 3K4WA 1EGVA 2WC7A 4UTUA 3JVAA 1R3RA 2V81A 5J8LA 4ML9A 2WWDA 4MM1A 4UQAA 3GC4A 3W86A 5JVLA 2QR6A 3O16A 1UD8A 1QBBA 4B16A 1J8VA 2WBGA 1OC5A 2B81A 1UWUA 1RA0A 1CGUA 3SCWA 2Z6JA 1M03A 2VC9A 1YBQA 2ZXBA 3VVGA 3B8SA 3KM8A 1GG1A 3IJDA 3D5HA 1VCGA 2FJKA 5E0FA 3NQ6A 1I9CB 3WNMA 1FWNA 3NQMA 1XLIA 3KP0A 1VRDA 3S83A 2VFGA 2BS9A 2PWUA 2O56A 1WBJA 1MXDA 3WH9A 3LEPA 1O6IA 2VZVA 1RZMA 2PEVA 2YA0A 2QKFA 4DI8A 1DXEA 3NL5A 4UR8A 1I2RA 4FNUA 1D8WA 4JZ5A 4QEHA 1H41A 4UMBA 4A05A 5BOFA 1Z48A 1SJCA 3WF4A 1TPWA 3P0WA 2VC5A 3QVQA 4M51A 3VKJA 1S2CA 2RJGA 5K9DA 1YTEA 3LRLA 1ISZA 3A5VA 4QLJA 2AKZA 4O0ZA 3SN0A 2VD9A 3DZ1A 1VYSX 2HXUA 4W85A 1NWSA 1PX8A 3VKTA 1TFVA 3QLDA 4CNOA 5D09A 4F2UA 1SQ7A 3R2GA 3QEZA 1EEXA 4F0LA 1HL2A 1RBAA 4WGHA 4TOQA 4ZVJA 3CIXA 1R3WA 1WZAA 2QJMA 1S5VA 1W1A1 4UXDA 1L8NA 4ZE4A 1EDTA 5JQ9A 2CLKA 1H7RA 3QHOA 2V69A 2C13A 3R5EA 1S1PA 2DY3A 5FF4A 3N17A 4S2CA 2FLIA 4PCPA 1G7UA 4MLJA 4ZQRA 1TE6A 4XZWA 4WOQA 3V0SA 4GCXA 4FALA 1CX9A 1MQRA 3QV9A 1XR2A 1LLZA 2OODA 1UPPA 3GY1A 1X7IA 1THFD 2VDGA 3P8JA 4GZIA 4BEUA 3RJXA 4PEEA 1KQYA 5JIPA 3M0MA 1UR1A 4UR7A 3TP4A 4IIFA 2XGBA 5AFDA 2HE5A 1TV7A 2E1DA 1TE1A 3LCIA 2XIIA 3GBDA 3H4GA 3EBVA 1XLGA 3M5ZA 2OSYA 5C9UA 3PBYA 1ELSA 1DP0A 1A5CA 5I06A 3SCTA 4Z1CA 4B5NA 1D3GA 1G5AA 3VNJA 2DEPA 3QBUA 1RVGA 3AXXA 3PNZA 2ZRZA 2X0HA 2BX7A 5FF7A 3FA3A 3P0XA 2VCCA 4E0CA 4A3QA 2WMJA 5JH1A 3W23A 4DJFA 2H8XA 3HG4A 2E4TA 2EKCA 2A6NA 4IJRA 1PCWA 5HJLA 3O0KA 3BLFA 4PMUA 3USBA 2AOPA 1OB0A 3ARSA 1XG3A 1F6YA 3L65A 2Z2AA 4UNIA 1G01A 1YE6A 2BLEA 3VIOA 4U28A 4EPEC 3OJGA 3GFXA 4NIRA 3LSBA 6CGTA 5E9XA 3MYOA 3W7LA 3T0CA 2FZBA 4RKAA 2V68A 5LYRA 4DWSB 1LOSA 4C6KA 2YL8A 4GY1A 4UTJA 2EG6A 3VGBA 3A12A 1TMHA 2BG5A 4D72A 3QPZA 3VNYA 3DFQA 4IIGA 3CAKA 4US6A 4E3TA 4F9JA 3KS5A 3CV1A 2Z0IA 4HPNA 3L4UA 4LVFA 4ONVA 4DO4A 3VKRA 4MDOA 1FOBA 2PD5A 3G1FA 3WBAA 3O9NA 3MM9A 4X9SA 3N11A 3QFEA 4DXVA 1FDZA 1WBHA 2NUYA 3G18A 4W8AA 1W3LA 1SJAA 2VKZG 2QUUA 3TAOA 4MZ8A 3U2ZA 3VTRA 2Y62A 4JX5A 3H24A 3W81A 4UOZA 1IT8A 5HWJA 4HD5A 2J78A 4LYKA 3GRIA 3Q45A 5CLTA 1FWAC 4IP4A 5ECUA 1VPQA 4ATLA 1TSIA 2Y7DA 4XTIA 1HX0A 4QISA 1C29A 3CTLA 4LW7A 3VILA 5KINA 3R1ZA 2DU2A 2VEIA 3O7UA 4J5NA 1OSEA 5ABFA 1QNQA 3CL8A 2GOUA 4F0KA 2ZE3A 2PWGA 1M7XA 5IRPA 3IUHA 4JTUA 3UW6A 4AZHA 1GOMA 4RPQA 3MW7A 4Q7NA 3AHVA 3TKFA 3KL0A 3F4NA 3MYPA 3PWGA 3IVTA 2IS7A 1SJBA 1EJTC 3QGAC 1HKVA 3R6IA 3B06A 5DCEA 2X05A 1K6AA 1V7AA 4US5A 3WZ0E 2C14A 2WJDA 1WQ5A 3LTYA 4CQ8A 3PPGA 4FNRA 2V30A 1B30A 5DXXA 1R2TA 3PR2A 5LGZA 4JKLA 3F2BA 2IPFA 4YCOA 5E70A 4GY7A 3V75A 3SBFA 1UQZA 3LHVA 1FWSA 1E40A 1KC7A 1OCNA 1PKLA 1T41A 4Q22A 1U5JA 2QF7A 1NAL1 2YXGA 4F48A 1A49A 1PBGA 3VLZA 4RPPA 5KETA 3LHUA 4WJXA 2REQB 4XB3A 3FV9A 1CT5A 1I2OA 1AW1A 2YFNA 4AW7A 2PGEA 3UJRA 4QJ5B 5C5YA 4CNUA 3VKSA 4OOZA 2QGYA 3ITTA 1UH2A 5FL0A 1V02E 4IGNA 3VIPA 1M5WA 1EJSC 4W87A 3L4ZA 1OCQA 3NQ7A 4ZE5A 1VF8A 3O15A 2AMGA 1KR0A 2E8ZA 1A5SA 5AHLA 3XINA 1AJZA 2V5BA 1RBLA 2ZC8A 4HOXA 3KS6A 2CETA 3EA2A 3PFRA 1AODA 4AX7A 2X41A 3EOSA 3QMRA 5DBTA 1KV5A 4OWGA 2OEJA 1I8JA 4NXSA 6A3HA 2ZXDA 3KTXA 2O4MA 2GUYA 2WNNA 4BF9A 3C61A 3B4UA 4ZQNA 5A6TC 1W5MA 2OOFA 3MQTA 3CHDA 3NG3A 4Q4KA 3IK2A 2QJHA 3LI0A 1JYVA 4X63A 3AI0A 1LORA 3AU6A 1E71M 4HTRA 2QCNA 4PFHA 3QQWA 4XSLA 4IOTA 1E6QM 4RZ5A 1ITUA 3E5PA 2CLEA 3ABQA 4GJIA 3UFYA 5I0DA 3MKVA 2CPUA 3SN4A 2OLSA 1FUYA 1RXOB 3AS1A 3QR1A 3A23A 1TJ2A 2VX4A 1W9XA 1ITCA 1FCUA 3KVKA 4PBGA 5C7HA 2FVKA 3PF3A 4FX6M 1FWFC 1E6RA 2CLOA 1KGXA 2CXEA 3CHCA 2XISA 4Q8NA 3WENA 4AQLA 2BGQA 3GYCA 2PDGA 3FIGA 1OZMA 3DN5A 2ZQ0A 1F3EA 2AL1A 5KZMA 5GJNA 5HUPA 1G4TA 2NXHA 2W66A 1IT0A 2HS6A 1BYDA 5LXXA 4WSKA 3L5LA 5FEXA 4C6FA 2YX0A 3MDUA 2ATSA 3PAOA 1J0YA 1L6WA 3WLMA 6XIAA 1M7PA 7REQA 1A3XA 3NTYA 5HULA 3U3HA 3L5AA 1M41A 3QR3A 1TPC1 4R33A 3B8VA 4IJBA 1O95A 3REQA 4D6HA 5CJNA 1SSDA 1TVNA 6ENLA 2BP1A 4DXXA 3NQCA 3PZUA 1MWOA 3COTA 2WKGA 5I3GA 2V5KA 1XIIA 4DELA 4MB4A 5I7GA 4ZQPA 3PB2A 1HJXA 3QN3A 3S1UA 1R9ZA 5LSMA 4L65A 5CPLA 2GPTA 4XIAA 2VRKA 4KERA 1VIWA 2OWXA 2NVCA 1WOAA 3E0LA 3BAJA 1VLIA 2D22A 2WVVA 3V7PA 3HG3A 3S1WA 3JS3A 1GOOA 1V4YA 1EJ7L 4LVDA 5CPSA 4W5UA 2XVNA 1JG9A 3F4WA 4GVHA 4LYPA 4PTNA 3DC0A 3MP4A 3TW6A 4M7TA 1B4EA 3QQ0A 1A5LC 5BYWA 5HDRA 3VIIA 3LERA 4FS9A 3BJFA 5I3DA 1WKYA 1X39A 1EOMA 4IUGA 3AXKA 4CCDA 3VIFA 1J5TA 1K7XA 1UB3A 1EIXA 1HJWA 3H4XA 1R3YA 1CEOA 4HPXA 1J4EA 1EUNA 4LPCA 1GK8A 4S3DA 5DMNA 1F61A 3CV2A 3T44A 2HS8A 2HWGA 4IIEA 5A8PA 4NNAA 3E49A 4P7QA 5KZDA 4DIAA 4MNKA 1GQKA 1XBXA 1FCQA 1RA5A 4WVXA 1K77A 2CBIA 4M6UA 2PU1A 3K1GA 4RR4A 4DM1A 9RUBA 1XLJA 3UVAA 4D6GA 3MT1A 1EFZA 2FB3A 2NWRA 1LG1A 1YDVA 2DVUA 3R10A 1HQTA 3TCSA 2E40A 2VRQA 3R13A 2XIBA 3ZJ6A 1JZ2A 1E3XA 3CMFA 4IG2B 4Q4PA 4Q32A 3SFWA 3AYVA 4JL1A 2C3ZA 2VGBA 5GQBA 1XC6A 4RK8A 3KHDA 4O10A 3OZMA 1ZJ9A 2V3FA 3M0VA 3ZJ8A 4Q3MA 2VQUA 2WMIA 1JGMA 3NQ2A 4LVBA 4G1KA 2CHOA 4HJFA 2FGBA 1FHUA 3R89A 3MHUA 3CUZA 3WF2A 3VOCA 4AWSA 1D7KA 3B8TA 2NZLA 3WQ6A 1VD6A 1OM0A 3KE0A 2WJFA 4F2BA 3GC2A 2JKEA 4GYFA 1KCKA 1SYTA 1KCZA 4I9JA 2WPGA 1Y5XA 4OE7A 3Q67A 3AOPA 2Y4SA 4BKNA 2BXZA 4MNMA 4GX8A 2GDQA 2NW0A 2O9PA 3UZYA 1G0CA 1VFMA 4GCAA 3WMLA 3Q4DA 4RZ4A 5AC4A 4MB5A 4QS5A 4GEPA 2PRHA 4ECLA 2Y63A 1CGXA 3K4AA 4LQ1A 3QH2A 4OBRA 2GJRA 2GDVA 3N13A 2FB2A 4ALDA 2CNCA 1FKWA 1J93A 2DUZA 1QW8A 3VDGA 4G7EA 1YW1A 1Q7ZA 2OEKA 3K8LA 4GLEA 2QCLA 4JN6A 3VAVA 4RV3A 4ZB0A 4MGGA 3MMWA 1FKXA 5I3KA 5A94A 4D1JA 1YE4A 1IHIA 1YDYA 3FJNA 4YIWA 4N9DA 3MMAA 4GH3A 4H3DA 4J28A 1TTQA 3CT7A 3SO7A 4TMBA 1UPMB 1S46A 1LL6A 2AMXA 1V6VA 3GK0A 1PYFA 3PB0A 4FZIA 1M65A 5GPRA 3L2IA 4ZOBA 1M1BA 3HO8A 3EX2A 2NUXA 6REQB 1QNPA 2EEXA 2FZNA 3NOEA 4AIBA 4AZBA 1ADDA 4D1IA 2WSPA 4LCQA 3N9KA 1WXZA 3UXIA 3M1ZA 4PMXA 4GD0A 3B8DA 1JIBA 4G8TA 4GZ7A 3HA1A 1XI3A 5D03A 2YSWA 4AEFA 4XD5A 3N6HA 1TUFA 3NNTA 2NXGA 5E1QA 3MKKA 3E0IA 4AD3A 4QQUA 4JTSA 2HE8A 3QW4B 1S2AA 3VA8A 4B9YA 3SCVA 3B3DA 3GNPA 1E1EA 2CLHA 4E5TA 1F3WA 4C7DA 1ZBVA 3VD3A 2RFGA 2V4JB 5FF3A 1EP3A 3LI1A 4W86A 3XIMA 1XD0A 1XUUA 4FLOA 3ITOA 2X1IA 5BW6A 2H90A 4AZ5A 1PO9A 2QIWA 4MZYA 1IEIA 4YL2A 3CL7A 2VFHA 4B5UA 4XAZA 4O1AA 3IAPA 1H5VA 1LRTA 3IJQA 3N2XA 2X1RA 4F0HA 1CGVA 2J8FA 4O14A 3LX9A 2Z28A 1UD4A 1CNVA 2WSRA 3IJ7A 5DT5A 4AZGA 4QG9A 4P7OA 1OFDA 1YXYA 1W56A 1K02A 1C91A 1NIUA 2R1NA 3VM5A 4WJEA 4O12A 2WLZA 3I4EA 3UCCA 2BTMA 1EA0A 3VKBA 1DQWA 3GXDA 2OZ3A 1N7KA 4UTIA 3NZRA 3OVGA 5A8GA 4IIBA 1A4MA 1T7LA 5D2YA 4Y96A 2XINA 4MWAE 3GVWA 4I7UA 1UUOA 4OGZA 1Q65A 2VC6A 3B0VC 2XPKA 1TELA 3B8IA 5FD0A 4E2DA 4CD8A 2F9RA 1MXSA 4KFNA 5D9MA 4C1NA 2Z1VA 1QW9A 3VNLA 3FVMA 4AY7A 3MHFA 4UTWC 2PZ0A 3IIPA 1CYGA 3JU2A 3OLGA 3E96A 5G1YA 1JXKA 3W1XA 1Z89A 1MNSA 5H6HA 2OZ0A 3LA4A 2OSWA 4B4HA 2HPMA 4BF7A 4XZIA 5EMUA 2PSNA 2NXIA 4MIMA 4EPDC 1Q5MA 4CNNA 3PUEA 4KGJA 1WDSA 2PZNA 1EZWA 1EB3A 1AQMA 2I57A 4QP0A 3WYZA 3HN3A 4LB3A 1XIHA 7GEPA 3B04A 3MVTA 1F6PA 3LNPA 1Y5WA 4UMAA 3URQA 4L6HA 2YR1A 1ZS2A 5C9WA 1QHZA 3PPHA 5F2LA 3EA1A 3CEPA 1HGYA 5ABTA 4MWAC 3AZSA 2PDLA 4ADUA 2H9AB 2OX4A 2FHCA 1K1DA 1SZEA 4FO4A 2J9ZA 4NJGA 3UA4A 4FNTA 1XCWA 3KRBA 1WA3A 1QK2A 3G24A 3M6DA 4WSHA 1ESWA 1YEYA 3EWCA 4HYWA 3B0GA 1VS1A 2MANA 1R7AA 1EWEA 3AO0A 6GEPA 1N8FA 4R88A 4ZZ9A 3TDFA 4PRWA 4S2BA 3WD2A 5B7YA 3W72A 2PS2A 2ZX8A 4DWDA 2V3GA 2WSKA 1QK0A 4LV9A 5H8PA 4GMEA 2BDQA 1Y65A 3H7UA 4MUPA 2X42A 3PZIA 3AHZA 3HBLA 1XLAA 1E5JA 1MNZA 3UZWA 1A5KC 1T8XA 3RDKA 3LLXA 1TMLA 4H41A 1SR0A 3U9IA 2FZ8A 3CMJA 1ONRA 1Q6CA 2DW7A 5JUVA 1HP4A 1O12A 1HXJA 5CZTA 3S2NA 1P4CA 3NIYA 1AL8A 5DANA 4DHGA 3T2PA 1R3TA 4GYKA 1W1VA 4HA0A 3MO7A 4MFEA 4G6CA 4WIWA 3HQNA 3W88A 1VYRA 3I68A 3LG3A 3KDOA 5DELA 1TJPA 3QYQA 3AS0A 4OKDA 3ZWTA 4AD4A 4LBRA 3NWRA 1MQQA 3M47A 2DQXA 2VZUA 1TUXA 4RDYA 4Q6XA 2BVYA 1UH3A 4K36A 2PDXA 1Q6OA 4AG0A 1RPXA 3SRFA 4N7QA 5LNVA 3WD3A 3ARXA 2G3FA 3N73A 4GY0A 2WB5A 3WNOA 3USZA 1DE6A 3KRSA 4Q8TA 1LBFA 1BF2A 3NZ1A 3WQWA 4LNCA 2OR2A 5CZSA 2KZHA 2VR4A 1LWHA 5D2VA 1PUDA 1ZUAX 3MM5B 4L61A 1PZ1A 5AYZA 1W1TA 4QR6A 4AD2A 1XYMA 2C18A 4HB7A 3RLHA 1XYCA 3RX3A 3FXGA 1C7TA 3TC6A 2X1UA 3GG0A 3UY8A 4P7RA 5LIWX 3CWNA 3W70A 2DDXA 4A29A 2W27A 3LXAA 1KTCA 5FIPA 4P7NA 3DFNA 3UZZA 3MO4A 3AWOA 1UC4A 2RGLA 4JKMA 3W6LA 1TV2A 4Z42C 1AQ0A 1JRCA 2OWCA 3R0KA 3BCJA 3R58A 1FH7A 3ARWA 1EP1A 1SZGA 1BTCA 2BVTA 4N42A 3GHRA 1E0TA 4WHBA 1YPFA 4QAWA 4PN2A 3W7MA 1W5OA 4M56A 4RNJA 2NQLA 1JPHA 4QG8A 2BNJA 4LVGA 5I00A 3G1VA 3N34A 2YPIA 2HTMA 1E6SM 5FI8A 1CGTA 3BAWA 4DB7A 2OU4A 2YW3A 4H01A 4OV4A 3WDJA 5GNYA 3HB9A 3RLUA 4S1FA 4W9TA 5B80A 3HJZA 3AYTA 3LM7A 1I45A 3M0LA 5CKSA 2O92A 2J6VA 3ARTA 3LHTA 3SCOA 5BXRA 2EPNA 3HGOA 4BHYA 4TUFA 4ZQMA 1KM2A 2CKSA 3LZ3A 1S2TA 1AD1A 4TR9A 3L4XA 2D23A 4NKCA 3SB0A 1WAUA 2BB0A 3K2GA 1FWIC 3W1NA 2O0TA 4RUBA 2Z29A 2VVSA 5IDZA 3ZZ1A 1K9FA 2ZC1A 3RR4A 4CU6A 1TPEA 2CLIA 1AQFA 4KESA 3AIRA 3TYUA 3WQPA 4J9JA 5G4HC 1M3UA 1GJWA 4PODA 4P8WA 2ZA3A 3LTSA 2IPWA 4Z2GA 3WJZA 5BXPA 3P14A 2C1GA 1P5BA 1X7FA 1WDWA 4UFKA 4H04A 1KFCA 4IPLA 3R11A 3FSUA 1JZ6A 5RUBA 4GNVA 3TYDA 3AIUA 3P8IA 1MMFA 1FTXA 3PZ9A 3CYVA 1BPLB 2GJXB 4RDZA 1EDQA 4ZQCA 4TXEA 2B31A 2FDMA 1XV8A 3VX0A 2RJHA 4U31A 1JPKA 2FZMA 4QSHA 3EGJA 3Q2DA 4W84A 4JICA 1UUMA 1K8CA 2VZTA 3KFTA 3PJXA 2G4JA 2RDXA 3CAWA 4LCSA 3W2KA 3GXTA 3LNMA 2X7WA 1B3ZA 4XUGA 3MM8A 3IIXA 3RG6A 3SY1A 4CKQA 3ALGA 2V9DA 2HISA 2ZUSA 2QPUA 3SZ8A 3TVAA 5BMXA 4H8HA 3G0UA 3ARVA 1J18A 4LOCA 4Z0SA 1GPWA 3RITA 3N19B 3CWOX 1XYZA 5FEZA 4DAIA 1PX3A 1I60A 1YTKA 2HXTA 2WM0A 4QSFA 5MHBA 3CPRA 1UQYA 4Q4RA 1LZOA 1OIMA 2PDMA 5D9OA 3KP1A 2XFFA 4Q4MA 1GVRA 3WKZA 3CB8A 1NH6A 3QKEA 4XBSA 3WBEA 2A3BA 3AAMA 4W89A 5G1MA 3V5CA 3CH0A 1RP9A 1BWVA 4G39A 5CH9A 1WO2A 3N4EA 4IPPA 4RXFA 4GZEA 1OFAA 1SO6A 4XKYA 2VD8A 3G8RA 4O50A 3DKLA 5CSRA 1RAKA 1W3TA 4PGLA 1D8CA 1W32A 2VGGA 3BC9A 3W71A 1EPVA 4GGBA 1Z69A 4NRSA 5A6MA 4IMGA 2R91A 2R9RA 1FWHC 4KIRA 5AY7A 2IKIA 4IQEA 1F7BA 3HJEA 3BLDA 3LD5A 1TJ1A 4C6NA 2QDEA 3D6NA 4Y9PA 2W67A 5D9NA 1ZGDA 1BQGA 3OIHA 1LLWA 1YLVA 3LGDA 3CK5A 1H3GA 3L9CA 4WDWA 5K4ZA 4LH8A 3CGTA 5GJPA 5BROA 3DHDA 1REQA 1SJDA 2GWNA 3L67A 3GB6A 3S2JA 4FEZA 2VURA 5FEWA 3TNBA 3EWYA 4LAOA 4TX9A 4DBSA 5CC7A 4UNKA 3IEBA 2CHRA 2Z1KA 1LL7A 3R79A 3NPWA 4IFOA 3SIMA 3HFTA 4WJ8A 3FAWA 3WBWA 1C9DA 2C0AA 1O1HA 4AFYA 4NJKA 4AF0B 3UYCA 2GQ3A 2D3LA 5CGQA 2CYGA 3BCFA 3QHNA 4UIOA 3EDKA 4A2RA 2NV1A 4IIHA 1BLIA 3SUUA 3OBAA 2ZRWA 4CCCA 3M0KA 4R27A 1PPIA 2W5FA 3ZFHA 1L2QA 2X1SA 2ACRA 2WHMA 1KKOA 4F2TA 4R7JA 4NAFB 4RLIA 3L23A 1R87A 3WY1A 2XTKA 3P74A 3CUFA 4KH2A 4ES4A 4HSOA 3WNLA 1ZU8A 3S1VA 3RJYA 3NSNA 5LHEA 1W9PA 3EMQA 1O66A 1YKWA 3LS9A 3GR8A 3APGA 1QRQA 4DJDC 3BLIA 1OCJA 4HBKA 4XBKA 3CEUA 2AL2B 1MRAA 2Z00A 4WY0F 3QSRA 4RNIA 4J3ZA 2HVNA 4C1KA 5KTLA 1OADA 2CFFA 4BY3A 3PZVA 1GW1A 1Y8BA 2PODA 1GVOA 3OIXA 4PCFA 3TC7A 2B7NA 4I7VA 2ZUVA 4M82A 3EB2A 2QGHA 1XDMA 2YCEA 4DWSC 2QVHA 5CSYA 3THQA 3W01A 2OTDA 2ZZ1A 4AEEA 4O4WA 2QV5A 1I6NA 3O0FA 3BOLA 4F3HA 3STCA 2GDUA 1MUMA 1F9CA 4PMYA 4PUMA 1C8QA 1ZBKA 2DT1A 3GVGA 5LA2A 3NUKA 2DZTA 4GUFA 4I90A 2VVNA 4HK6A 4B91A 5FSDC 3W37A 3VKPA 1LWJA 2WKJA 2GUUA 1MVYA 3HFYA 4KIEA 3F2CA 3WH6A 1XH1A 1XLKA 2ZE0A 3TSMA 2E3ZA 4UQ9A 2AAAA 1UP0A 3O6CA 4U10A 1W31A 1DTNA 1EF3A 1QI0A 3MUY1 1M53A 2HBVA 3ARUA 3WQFA 4C6DA 5AHMA 4DBEA 1X1ZA 4C6LA 4TX8A 4RJEA 3GM8A 1EEPA 3CUHA 3C3UA 5K2ZA 3II1A 2PBOA 1EX1A 1H63A 1OABA 3MKCA 5CAKA 5ECVA 3EZ4A 4AIUA 3U2CA 4GI9A 3B03A 2GVGA 3APTA 4XISA 3PUOA 3ZVHB 4JIHA 5U4NA 4AY8A 1Y7VA 3NR0A 4MB3A 4RW5A 3S8HA 4LAMA 1G6CA 2FVMA 1IV8A 2GVEA 2WK2A 5CBIA 2VEFA 4QBXA 4YS1A 2P0IA 3NDOA 1E55A 5HANA 3WEOA 1IXQA 2EXOA 5HATA 4C1LA 4M6QA 5JIWA 3G0XA 1MW0A 1UD3A 2ZX9A 3TWAA 2B4GA 1T40A 1Z7AA 3UQNA 4LAKA 1BHGA 3TE9A 3NQVA 1AD4A 1W3NA 1C90A 3TYBA 2NQHA 2KX9A 4DVOA 1J01A 2R1KA 4U3AA 2RAGA 4PMRA 3BAIA 4DZAA 1V6TA 3QM3A 1O5KA 8GEPA 1J10A 2WPBA 2DSUA 3XISA 4C5YA 3T55A 4GQ0A 2FQIA 2G97A 4JN8A 2VX5A 3WEZA 3P62A 5T26A 4H9XA 3BARA 1ZAIA 2OKTA 1Q45A 5E6YA 2Z4GA 1TRIA 3U0HA 4U2YA 3ZO9A 1Q4NX 4FLQA 4N9EA 4TU1A 3SCRA 3CNYA 1TX0A 3W1QA 4NF7A 3MMCA 4MNLA 3O6AA 1HJQA 2XSXA 2GJNA 2D24A 4AHOA 2GGJA 3W28A 1ICPA 5HPOA 3WELA 3VNZA 4Q4QA 3W25A 2OLHA 1EO7A 4Q4SA 4C6MA 4PUJA 3S9YA 3QHMA 4GUGA 5FJJA 1QI5A 1AMKA 1Q6FA 4ORMA 1W9BM 4HN8A 2NQZA 7ENLA 3PJUA 5XINA 2WVSA 4KCVA 4I9TA 4EE9A 4KWVA 5A6AA 2PBGA 2WHJA 1PB0A 2QLYA 1ONWA 3SW6A 1AOPA 3JRKA 2WCSA 3BICA 1SW0A 5AHEA 4X22A 1CTNA 3LHWA 3RRXA 3DHUA 2PWDA 3E02A 4AD5A 1BWLA 3UU0A 4JY8A 1H2JA 3L66A 3TZFA 3W07A 5FESA 2E5CA 2ZICA 3N4FA 3LYEA 8XIAA 1Q2RA 3SUSA 2ODOA 4ZOEA 3LCLA 1JAEA 3C2YA 1S39A 1VR6A 3CWHA 3K8KA 4JYEA 2ZXQA 3TLQA 2W79A 3NL2A 5KSWA 3WBXA 1I0BA 4HU4A 4FIRA 1F05A 1TQXA 2EGZA 3WFAA 4DYJA 1A0CA 4PBEA 2YA2A 1NDYA 3IS4A 2FIQA 2QJIA 2XH7A 4DPQA 3VZXA 3DFSA 3AROA 3OLDA 3SSZA 3FSTA 4J2MA 5CZJA 3BXWA 3U4AA 4JKKA 3KTCA 1GVSA 1LBMA 2CBJA 2VGFA 1TQJA 3VGGA 1AQHA 1J0JA 1KFLA 4NX5A 3TJ4A 2VEGA 3ELFA 4A22A 3DBPA 3UCQA 3UWZA 1YIXA 1UYQA 5F2MA 3LMYA 3ITXA 2FZDA 2YL5A 5G1TA 1UR9A 6PTDA 4S3EA 1Q4WA 4HTYA 2RH9A 1LT8A 3CT2A 4YYFA 3LOTA 4K8EA 2E5BA 1XLDA 1VFFA 2H9AA 3EMCA 1EJWC 4HU0A 3MSYA 4RNHA 3UPMA 3VKKA 1KM6A 4H7CA 1PX4A 2NV2A 4QNEA 3W7DA 1OCBA 5DFAA 4RL3A 5HPCA 5M03A 1P7TA 3SCQA 4Y9MA 4AMCA 1AUSL 5C2GA 2QULA 3A13A 2C71A 4Z2KA 1TV4A 1B5TA 5A8MA 4F9DA 4S3AA 3A4JA 3OR1A 2X0SA 3Q37A 4MDPA 3S5SA 1UKQA 1AH0A 4QGCA 4ZQOA 1PXGA 3AS2A 3G22A 2CLMA 3A64A 3AFBA 4KS0A 1DV7A 1UWQA 1XCFA 1R0MA 4I5XA 2NQ5A 4DF1A 3M5VA 3ITVA 1HJUA 1B4KA 3T0BA 3PJTA 4P8UA 1UH4A 2WSQA 2OQYA 1P1XA 2RUSA 1VBUA 4HIBA 3EWZA 1UCWA 3CHVA 1H1NA 1JJKA 4JQ3A 2OELA 4X2RA 3C5QA 3TH6A 3QOKA 4HCDA 4Q8VA 2QUVA 3ZT5A 2DUXA 4Z1BA 1AH3A 1KM0A 4EAYA 3LPGA 2BOEX 5TQLA 4ZTYA 3LXBA 4O17A 2PDIA 4KEMA 1RH9A 1KLZA 3UF9A 1HKMA 1SZRA 2X8RA 4F0MA 5HA7A 1KQZA 1XLEA 3S46A 1GWJA 4FSAA 4JDBA 3KCJA 4KFPA 4AAJA 3SCPA 1C8VA 2WQDA 4IGHA 5FACA 3SN1A 3B97A 1LF1A 3RNDA 4LB4A 1X8FA 2YCLB 4PB4A 1UKOA 2F7FA 2DIKA 3S6DA 3PBVA 1G4EA 2QDGA 1WB0A 4AZ7A 3RLVA 3PFMA 4I5UA 4J35A 4FNQA 1EUAA 1JR1A 4QFUA 1XP3A 2OYLA 4J3XA 4POCA 3WQVA 3T4WA 4EPKA 4R5EA 4V2XA 1EIBA 1Q6LA 1WDQA 2P8BA 1H0GA 4KEVA 4NYUA 4LAUA 4Y9NA 4LF2A 3N12A 2XN2A 2J88A 3TIMA 5CCZA 1EF2A 3P84A 3W73A 1UKTA 5LHFA 2NVDA 1JCLA 1LT7A 1EDGA 3VKDA 4O28A 4QRNA 3V4BA 1IXNA 3WUFA 1XKYA 4H9YA 1H0IA 3AMDA 1IEXA 3N04A 2QVNA 4I9AA 3O2LA 2FGLA 1C92A 2QW5A 3OG2A 4XZNX 2ISFA 1ZJ8A 2O4QA 4GVFA 1JDDA 1DWJM 3GH7A 1XQLA 3F7JA 1LJYA 1E0VA 3FLUA 4JTDA 2J7FA 1E1FA 3WUEA 4JFUA 4Q8WA 3CIWA 4D2JA 4A2SA 2VTFA 3GFZA 1O4UA 5DBUA 3EPOA 3D0CA 1XGDA 4WKHA 5I07A 3QJAA 1AG1O 3VKAA 1TTIA 4FB7A 3GZAA 1B3VA 3LB0A 1P0NA 3QV7A 4G2DA 4ERGA 2PAJA 3WK0A 5H91A 1CGYA 4X61A 1TPB1 2VYOA 1DJGA 3E2RA 3W27A 3GO2A 1JCTA 3BLOA 2WZIA 4L7ZA 1X6LA 4HPHA 3TJXA 4PCTA 4PUNA 1U1JA 5HMDA 5AB3A 2XN1A 4CN6A 2QMKA 3WLTA 2CC0A 5BWAA 3TTSA 1U1UA 3BG9A 3TSBA 5DXYA 4JBRA 3G1DA 1QHPA 2YLLA 2R1LA 4P8VA 4GOAA 2Y89A 2YJQA 1RK5A 1XFBA 2EJAA 3P67A 1EQPA 2IKHA 4KEZA 1EXPA 4D6JA 1LL4A 4ZOAA 1OFPA 2E25A 3UEQA 3NCOA 4HHPA 3SFKA 3WMCA 4K2SA 3PM6A 5AN7A 4NU7A 4EF9A 2X2GA 2HZGA 2YCKX 1LBLA 4REQB 1E51A 4AWUA 3BW3A 2G3NA 2Y2WA 2GQAA 3P2VA 5E93A 5ENLA 5FJTA 1UD5A 3ME3A 2OVLA 4B3LA 3AZTA 3KBWA 3R4IA 3T08A 1XYLA 3CUGA 2DP3A 2XUCA 2ZVRA 2FYMA 4W5ZA 4PSPA 1KM3A 4LF1A 1CBGA 2VZSA 3WQDA 1A5UA 2VEMA 1XDJA 1MW3A 2J9XA 5ABGA 2ISWA 1RQHA 2YA1A 3BUVA 4H4IA 4H9TA 2CERA 1EZ2A 4CEXC 1GZ1A 3VD5A 4OUIA 1MW1A 3V5OA 3OP2A 4XAGA 1O60A 3H22A 1ZRQA 2Q71A 4QTGA 5DF0A 3C8FA 3E3HA 1Q7QA 2YB1A 1L6FA 4XIMA 4WDTA 1PSCA 2GZXA 1F4HA 2V3EA 2YXXA 5FAGA 4U2ZA 2WNQA 4MYXA 3CHEA 1SFTA 1V3LA 1OG6A 4IFKB 1S5MA 3DBNA 1VIZA 4GUJA 2GFTA 1BXBA 3HV8A 3N29A 1WCGA 3T1GA 1JEZA 3LPFA 1TA3B 3PP7A 3MP5A 1MO0A 3LLFA 2ZUNA 3VMOA 4MY9A 2XN0A 5A8OA 3PTDA 2QPXA 2NLYA 1MUCA 2WJZA 2Y61A 4I8YA 3TYAA 3KOYA 3WH7A 3ZYZA 1JNDA 1Q63A 4P8XA 1LWIA 3NO5A 2DUAA 2W61A 4PTVA 3EOUA 4MTVA 4UTLA 1IR2A 1ZBCA 4HPJA 4C6EA 4EPBC 3WNKA 4Q8QA 1PEZA 2OGJA 5HOSA 4FX7A 4FLSA 1XPYA 2W4XA 1TPFA 1TVPA 5DY2A 1MZHA 3WSUA 4C65A 3D3AA 2E68A 3DG6A 2JIWA 4NZFA 2E1WA 4OT7A 4MHBA 1PKYA 3PN8A 2AQOA 4LUSB 2GSEA 1IIHA 3A9IA 4S3CA 1DJHA 1WYIA 4AIOA 1NJJA 4GGHA 2V82A 4K8GA 3RX2A 3L2MA 5EFDA 4CNSA 4PZVA 2DIEA 1RP8A 4HGXA 4NZ5A 3M43A 1Z6KA 4H1ZA 1R6WA 4A3RA 1CB7B 4JHOA 3TN6A 2WQPA 2DSKA 4H2CA 1WKDA 1U5HA 2WJEA 3RO6A 3FK4A 1U1HA 3ANYA 3BQ6A 3TV8A 1KXQA 3WLIA 1E73M 4NAFA 4QJ1A 4LBUA 3B0NA 3ALFA 4XZBA 3UY7A 1JF6A 1UR4A 4RDVA 5EGRA 1VHCA 2GGIA 3UZXA 4UZUA 1Q6GA 3W22A 3W1RA 4L1GA 4JOMA 1XH0A 1YXDA 1FWWA 4LUIA 3WLLA 2HDJA 5F2GA 2QCMA 4AUBA 5MKGA 4K1GA 3W1LA 4XUYA 2HVMA 1ISVA 3SUVA 4TTUA 1HIZA 3PBWA 3BO9A 4CN4A 1PIIA 1E72M 3MBDA 2WCAA 5A6KA 1CXKA 3OW1A 4CVWA 2WV8A 3UWWA 1B3YA 3V3WA 3VFLA 3ATZA 3MVIA 1T96A 2INZA 1JXJA 1C93A 3OGRA 1JGIA 3OA5A 2J9YA 2PC4A 3DG3A 5AZ0A 2Y8UA 1FDYA 4BA0A 5LXEA 2E28A 1X1NA 3PZOA 1HNYA 1LYXA 3FA4A 5BRBA 1KXTA 4TX6A 1W0MA 1BWKA 2YL6A 4NI8A 1KFKA 4HTBA 2IW0A 4JQ2A 3UPBA 5AYIA 2YBTA 4ZXLA 3WLJA 3CJPA 3B0JA 3ZJ7A 3C0SA 2ZXAA 5F1VA 3HIJA 2VR5A 3GIQA 4BR1A 3SQSA 3HPSA 3S42A 3W6YA 2DSWA 1R7OA 2F38A 1V08A 3VINA 3ZQ9A 3B0LA 5G4WA 4WY0B 2QAFA 1DL3A 5EBUA 3S2CA 3JW7A 4S3BA 3AHTA 4UMCA 2OCZA 4NAEB 1XDLA 1RHCA 2JF6A 5I77A 2J24A 1TPH1 1DJXA 3WEMA 1KFJA 8TIMA 3BDKA 2EPLX 3ZVHA 4G38A 2J6XA 1SO5A 2OO6A 4QE5A 4QITA 4ORIA 1VBHA 3N25A 1VFUA 5EYWA 4H9VA 3GXIA 4QCFA 1FWDC 4NJJA 4BQ4A 2GK1B 3U2OA 3GW3A 3F03K 3DC8A 3MWAA 1CZ1A 3WJXA 1E4NA 3CAVA 3DENA 4O1BA 2J8TA 2PGFA 3MU7A 4NL1A 3TQPA 3NM1A 1ADOA 2XIMA 1SR9A 3L4TA 3VGDA 4I7WA 1QWGA 2J7EA 5A6LA 4DNHA 1HTIA 1HGWA 3DFOA 4AC7C 1R2RA 3G3DA 2XWEA 1RLCL 1CWYA 1QPQA 3DG7A 1MXGA 2EPOA 3WN6A 3KBNA 3AICA 3OGSA 2POZA 1KB3A 2DIJA 1DEDA 5DMYA 1J0KA 4MWAD 3FA5A 4YXGA 3MV01 3B0MA 1DJQA 1JPMA 1E5NA 5I09A 1US3A 3TR2A 1VHNA 4QJ4B 3CLWA 4M1RA 3HGRA 3DI0A 4JDYA 1PAMA 1FCVA 2HJPA 3QTGA 3SCSA 4YNGA 4ZMGA 2P76A 3M7SA 2Q02A 1KLYA 1RK6A 4OBSA 1U22A 3IIOA 3CQKA 1GCYA 3SAZA 4B5VA 4CD5A 3OPSA 3VO0A 4PSRA 1K6WA 3TW9A 1J79A 4LUTB 3LXCA 1XS2A 5E5CA 5CPQA 2XZ7A 4A8RA 2GVJA 1V7YA 4J3UA 2VXNA 2Y1HA 5AYXA 5HINA 1QI2A 4F79A 2AQWA 2WVUA 1XBYA 1HKWA 1WZKA 3UA3A 2ZKMX 3QY8A 1MZRA 1JDCA 4H6QA 3IJLA 2Y8KA 3WLNA 1QPOA 2ZZ3A 1EC7A 1YNQA 4HU3A 1TREA 3T0TA 3WLRA 4GFIA 4JQ4A 3E38A 4Y6GA 1BRLA 4M7SA 2CKRA 4JTKA 1K7FA 3VNKA 2NX3A 4HA4A 3FYYA 3IVSA 3BMXA 4BQ2A 2Y6ZA 1TX2A 4E2VA 1AL7A 1LOQA 4CD4A 1KRAC 3F5LA 2HROA 4BFAA 4GHRA 4DEFA 1OD8A 1XX1A 3E0FA 3HOJA 2H3BA 3BZGA 1B0IA 3KZPA 3A4XA 4ZFMA 3UWQA 1JFXA 3ATYA 3VMNA 2WZHA 4DUWA 3AIBA 3TTEA 4L4PA 3S6TA 1KFEA 1J0HA 4TVUA 1Z41A 5G2IA 5M5DA 5LIUX 2FVLA 4ICCX 5T91A 1E6NA 5FEPA 3FGCB 5M17A 3QZ6A 1UJPA 1TPUA 4B5WA 2O9RA 2ACUA 4PRTA 3W76A 2CLFA 2DVTA 3EAUA 1E9IA 1JQVA 4LXFA 2WC4A 2BGNE 2G95A 3OO2A 4ACZB 3HQOA 1RJQA 3UNDA 1FHDA 1PHQA 4HP5A 3WLSA 4W93A 1QNSA 2OQLA 1ZCOA 1EC9A 3NEVA 2PD9A 4UFHA 3GDKA 1XLFA 2KAUC 4F0RA 5I23A 1VH7A 4J3TA 1ZLPA 2QMJA 1WP6A 1UROA 3KRUA 4ERAA 2ZFAA 1ZAJA 1RJRA 3C3NA 4K3ZA 1A5MC 4WR3A 3GU1A 1NVMA 4LGXA 3W82A 3ID7A 4YCPA 1L8PA 4WGXA 1SZFA 3R43A 2R94A 2W62A 1FP8A 1NF7A 4ML4A 3OZOA 1JI2A 2Z25A 3FOKA 4Q8OA 4TO8A 4OFCA 2J7CA 4ADTA 1TZ7A 3T07A 2A3LA 3TK7A 3GVRA 3KBJA 2EG7A 3M07A 3MS8A 4KETA 3ANVA 2VENA 1LRQA 4AZCB 3VKQA 3AALA 3VOGA 2PWVA 4GIEA 5AYBA 4RE3A 4QG6A 1XD1A 1U33A 4IMCA 4I6VA 1FQ0A 2PRMA 3UGRA 4O0KA 2VJXA 3LGGA 4CQ9A 1KGUA 3GNNA 5AVNA 2VHLA 4BI6A 4A3HA 1UC5A 4AOPA 2W0UA 4D6CA 4KW2A 2NQJA 4AC1X 2Z6IA 3KOZA 4JX4A 2EG8A 2Z7KA 5FF2A 5BU9A 4MNJA 1KM1A 1W1PA 1KBBA 3GTFA 3OR2B 3LZ5A 2L5HA 2ZVIA 2ZRVA 3QY7A 4CLMA 5I79A 4DRSA 3DUGA 1SO4A 4CNPA 5I6SA 4G1NA 3GNXA 4DYEA 1P1MA 5CBJA 3H6OA 1G94A 3ES8A 1RCOB 1RY0A 4GJJA 3M0XA 4LC8A 4JAWA 5E9AA 3G1RA 2QJGA 4LWWA 1VRXA 3H2AA 4JIIX 1V0NA 2RHGA 3LBOA 3RCNA 2BXYA 2CZVA 3B0YA 1H7NA 4KRTA 3T8QA 3HPXA 3AS3A 3CHFA 1JCXA 5LIKX 3CC1A 3HQ1A 3KWXA 4GE8A 4F66A 1A0DA 1A5OC 3RGTA 3MM6B 1HO4A 1B90A 4HK5A 4WOZA 1WZMA 1X1OA 2BHYA 4KWUA 1UWIA 1Z44A 1F6KA 1ZENA 3W00A 5LNRA 3OZPA 1J5SA 4IXHA 2DT0A 2EF9A 2QCDB 3PBGA 3L0GA 5DX7A 3NQAA 4V1YA 3MSDA 1IGSA 1F4AA 4C7GA 2XZ9A 3K46A 4GUIA 1NFGA 3MV11 2Z1WA 4IZGA 3TN5A 1OFBA 1KTBA 1BSLA 1TWSA 4D8ZA 3S4TA 3T7VA 4NXKA 1XIFA 4DLFA 1QAPA 4Q7BA 3LGEA 4JQAA 5AVHA 1TO3A 4FMVA 1AMYA 2DJLA 4K37A 5CEWA 3TOPA 4NVTA 3WQOA 1YBQB 2XGZA 3BJSA 1SVDA 4KQNA 3TJLA 1AW2A 1R3QA 1KRBC 3FCPA 3N6QA 3B9OA 3WFZA 3VNIA 4D8LA 4IL0A 3HMCA 5DRIA 3CYJA 1WXJA 3BLEA 3WFLA 1B31A 3VX1A 1BG4A 1ZB5A 3W7KA 1MSSA 3GVVA 3S2MA 3BSHA 1S1RA 3E74A 5CG0A 1YNPA 3AYRA 3WUGA 1Q13A 2I14A 3W7HA 1AZ2A 1GOQA 2UZ9A 3AMCA 3FHQA 1Z32X 5CC6A 4XVDA 1JZ7A 4JGDA 2IPGA 3I3BA 4QE4A 4QM1A 3POHA 3BZJA 4EKJA 3UR8A 3THCA 1NP2A 4GNKB 1F73A 2INFA 4LS0A 3WH5A 3OQEA 1NWUA 2V2DA 4E4FA 4C90A 1DBTA 2Q3OA 4XZLX 3ZIZA 1TPDA 3H7RA 2WC3A 3IRDA 5BMWA 2GJPA 1O5RA 2PURA 3C2VA 4CQCA 4CQBA 1YDNA 4J3SA 4N4PA 2E09A 1PYMA 3AC0A 3GR7A 3UJFA 2ZZ2A 2BVDA 3BMVA 4LYRA 1ZSXA 5A3HA 1SW3A 4JTHA 1V3HA 3RX4A 4XBJA 1QPNA 2V5LA 2GJLA 4DJEC 3CZLA 2GOKA 2V2CA 1ENUA 5T9CE 3MUCA 4ICMA 2ABBA 5A6SA 4UTFA 3NAVA 2PLMA 5G2WA 3SADA 1JYNA 2QZRA 3C2FA 3DAQA 4TV6A 5CC3A 1E4LA 1W37A 3S9IA 4NNBA 1Q6QA 2WCGA 2BGSA 1ZP3A 3CQIA 4CU8A 1OGBA 4JTTA 2I9UA 3VIKA 1YTDA 3VOIA 3UR5A 1S38A 1TR1A 2X1TA 1V0KA 1GQIA 4IMFA 4PYSA 4DJDD 2XJ7A 3M44A 1DOSA 3FY1A 1Y5VA 3GIYA 3DYPA 2FGZA 3CUIA 2X16A 5REQB 3MZNA 1IWPA 1E56A 1LP6A 2PU0A 4RZ6A 1C3FA 4XSMA 4H83A 3MHGA 2X30A 2R6OA 1DWGM 5ABEA 4E2OA 1S5WA 1R5YA 3EEGA 2G5WA 2E5DA 2PCQA 4K38A 4JNMA 2EBNA 4ZENA 4Z08A 3WQCA 4DWSD 1TA3A 1J0ZA 1N82A 3AMGA 1YQ2A 3M0YA 1IWAA 2ATMA 2P5NA 3O6YX 1BEUA 1KCLA 2NVAA 1CECA 5HQMA 4K39A 3MBFA 3KL3A 5BOOA 3H2CA 2OO0A 2PDCA 5CGTA 1OFRA 1R8LA 5BXSA 4X9YA 5F4XA 1W8GA 2VC7A 3WL0A 3PANA 3T05A 1PTGA 1SO3A 1EQCA 3EDJA 4PCNA 1IQ8A 2A3AA 1M7OA 2VO5A 1WDPA 4HZ7A 1MYRA 3RO8A 2DZUA 3UJSA 4FNPA 1KBKA 3VYLA 3BGAA 3OU8A 3QV6A 3KX6A 2G3IA 1H7OA 4DUOA 4LS2A 3OG3A 1XHGA 3BSMA 2Y8VA 1ML1A 1VBRA 1DE5A 4OV9A 1QOQA 4ZSTA 3V5FA 3ITLA 1T6MA 3SJ3A 2XSJA 3E0VA 3MCNA 1TRDA 3P81A 1K4HA 3WQ4A 2OT0A 5I3FA 5C0QA 3LUTA 5XIMA 4C5ZA 2ZWZA 5T9BG 3I10A 3ZT6A 1JUEA 3NO3A 2PWEA 1XLHA 1UBSA 1RVKA 1UKSA 1W2PA 2QUMA 1H7WA 3MM9B 4DI9A 2XVLA 3THDA 3TYEA 1SU5A 1VEMA 4FOKA 4M80A 2V5CA 4QAIA 1EJUC 3UXDA 1D2KA 2DT2A 2FJUB 8A3HA 1UZHA 4PTMA 4S23A 1EYEA 4DM2A 2EO7A 3IIZA 3MUIA 1ME9A 1XFCA 2G0WA 4MF4A 2ZRXA 3EKZA 3KCLA 2P0OA 2OWWA 3MUZ1 3BPWA 1GZJA 3F5KA 4KMQA 4UTWA 2XIQA 5DO8A 1FWCC 1MQPA 1A47A 4C6BA 4DO6A 1OX6A 4G7FA 4EWND 1NOFA 2RDTA 4Q6JA 1RY8A 4J1OA 1J0IA 5CBBA 5I5RA 1WX0A 4EXBA 2BFGA 2OX1A 5ABFB 4O1CA 2C8NA 4NT0A 4B90A 1Q2SA 3KAOA 5IBXC 1O1ZA 5F2IA 3MCMA 1H50A 4ZB5A 4CCEA 1ISXA 3FDKA 4FOJA 3L4YA 4X60A 4MWAA 1GNXA 3UNTA 2VWSA 1JD7A 3QFWA 4ICNA 4CEUC 3FKKA 4IM4A 5HXMA 3RM8A 7TIMA 4AB4A 1HJSA 3WH8A 5CPTA 3BE7A 3B9DA 3UJEA 3W53A 4A8IA 3MM7A 2QCGA 2X0YA 3G77A 1GHSA 4Q7IA 3TOYA 3W38A 3VCCA 3S9ZA 1DTUA 3C2EA 5EL1A 2WMGA 2NQ9A 2FH8A 5GNZA 3K4DA 4GC3A 1EH9A 1HKIA 4O18A 2AGKA 4HSNA 4O19A 4OQVA 2XU2A 1EGMA 2Y88A 2XG9A 1ZALA 3M0JA 3VGHA 4IJCA 1DXFA 3IACA 1W3KA 3STFA 2G4FA 2IQDA 2EPMX 4NY2A 1JDFA 3DECA 4JTEA 5LKYA 1R38A 2YBUA 2J7DA 4R7OA 4Y8EA 1UKPA 5F4WA 3EB4A 2XVGA 1P0DA 1G67A 1HVQA 3KBVA 1CGWA 2PA6A 5EBAA 2PP0A 3UBPC 1XXXA 4QE1A 1E9ZB 1KKRA 1EGZA 1DJIA 1OX4B 3PHAA 2FTPA 2Z24A 2VDIA 1ME8A 1RLDA 3BG5A 4O15A 3W0KA 2J7HA 3OB8A 4S3FA 3W1PA 3GC5A 2F2HA 1ZTVA 3G3MA 2GQ8A 4OUEA 3PK7A 4CVUA 1K8XA 5C9ZA 4G5DA 1VLWA 3WD1A 2EAWA 1OG0A 1W9VA 3W6MA 3IAQA 4D71A 4XZ9A 2I7GA 3IV3A 5LA1A 3WCZA 5ABHA 1E15A 3RUBL 2GGEA 1M9HA 4LS1A 3BV4A 2PUZA 4NZ1A 2PDKA 1BVZA 5CAHA 1VEPA 4MKSA 4WDXA 3VGEA 3S1GA 7A3HA 4J40A 2DZVA 4KCUA 3ZSSA 1ZBWA 1UHVA 1Q8JA 4LX4A 1H09A 4QS6A 1F76A 5JBEA 4UTTC 1R85A 2NWSA 4WEVX 3MANA 5A69A 2POTA 1A50A 3V0TA 3W84A 1OYCA 1TZZA 5GJMA 1WXYA