The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
23
|
sequence length |
111
|
structure length |
111
|
Chain Sequence |
MFTAKLIKGKTYNVMGITFRAGVSQTVPKKLYEYLNENPYFILTQELNNQKDDPINYTESELKGMNKAEHESIISNLGRNPSDFKNADERIAYILKQIDNKGELEHHHHHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
NMR Structure of Bacillus Subtilis Protein YqbF, Northeast Structural Genomics Target SR449
rcsb |
molecule tags |
Structural genomics
|
source organism |
Bacillus subtilis
|
molecule keywords |
Hypothetical protein yqbF
|
total genus |
23
|
structure length |
111
|
sequence length |
111
|
ec nomenclature | |
pdb deposition date | 2006-06-30 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF14553 | YqbF | YqbF, hypothetical protein domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 | Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Ribosomal Protein L9; domain 1 | YqbF domain |
#chains in the Genus database with same CATH superfamily 1E7D A; 2HJQ A; 1A63 A; 1E7L A; 2A8V A; 1EN7 A; 3L0O A; 2QNF A; 1A8V A; 2QNC A; 1A62 A; #chains in the Genus database with same CATH topology 3S2Q A; 1Y02 A; 1E7L A; 2X49 A; 2LC3 A; 1DIV A; 2HBA A; 4FSD A; 2QNF A; 2KVE A; 3FND A; 3FLG A; 1E7D A; 1H9E A; 2EHO C; 1KHC A; 2G80 A; 2JVW A; 1ZBH A; 1CQU A; 2Q9Q B; 1JJR A; 2MPH A; 2QH7 A; 4UY8 H; 1GL9 B; 4F2C A; 3REE A; 5GHR B; 5EG5 A; 3L0O A; 1JEI A; 1H1J S; 1H9F A; 2QNC A; 2E9X B; 3QKJ A; 4UZW A; 2KFV A; 2HVF A; 2QD0 A; 1GKU B; 3ANW A; 1GJJ A; 3EW0 A; 2Q9Q A; 4OO7 A; 2RNN A; 4FR0 A; 2RNO A; 3LLR A; 4KW7 A; 2HJQ A; 4F1E A; 1YNS A; 2KVU A; 2LSM A; 3J7Z H; 2A8V A; 1V66 A; 1ZS9 A; 3TBN A; 2LD7 A; 3TBO A; 4F28 A; 4RSR A; 3CO4 A; 2KVD A; 2E9X D; 1A8V A; 3LPQ A; 4OOA A; 1JEQ A; 2ODG C; 2OUT A; 2DK4 A; 1A62 A; 3FNV A; 3S2R A; 2ODC I; 4BIT A; 2WQG A; 2KW9 A; 1EN7 A; 4EZF A; 2W51 A; 2X4A A; 5GHS C; 2HBB A; 1A63 A; 4FS8 A; 2R13 A; 5CIU A; #chains in the Genus database with same CATH homology 1GL9 B; 1Y02 A; 1E7L A; 2ODG C; 2LC3 A; 2DK4 A; 1A62 A; 2HJQ A; 1YNS A; 3L0O A; 2QNF A; 1JEI A; 2ODC I; 1H9F A; 2QNC A; 2A8V A; 1E7D A; 1H9E A; 1ZS9 A; 2KFV A; 2G80 A; 2LD7 A; 1EN7 A; 2W51 A; 1GKU B; 1GJJ A; 1A63 A; 2MPH A; 1A8V A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...